Dataset for protein classical BH3-containing proteins of organism Canis lupus dingo

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8C0JZ72_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus dingo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A8C0JZ72_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus dingo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A8C0KNS8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus dingo GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A8C0L0H0_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Canis lupus dingo GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLALRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPRALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C0L1H3_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus dingo GN=PMAIP1 (length=54 residues).
MPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT
>gnl|bcl2dbpro|A0A8C0L5G0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A8C0L5G0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2L11 (length=204 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
© 1998-2022Legal notice