Dataset for protein classical BH3-containing proteins of organism Canis lupus dingo

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0L1H3_PMAIP1-      --------------------------------------------------
A0A8C0L0H0_HRK-01       --------------MCPCPLHRGRGPPAVCACSAGRLA-----------L
A0A8C0L5G0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQ----------------L
A0A8C0KNS8_BAD-01       MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGH
A0A8C0L5G0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQ----------------L
                                                                          

A0A8C0L1H3_PMAIP1-      --------------------------------------------------
A0A8C0L0H0_HRK-01       RSSAAQLTAARLKALGD---------------------------------
A0A8C0L5G0_BCL2L11      RPGAPTSLQTEQQ-------------------------------------
A0A8C0KNS8_BAD-01       QQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSA
A0A8C0L5G0_BCL2L11      RPGAPTSLQTEQQGNPEGEGDRC--PQGSPQGPLAPPASPGPFATRS---
                                                                          

A0A8C0L1H3_PMAIP1-      -----------------------------MPGRKARKSAQPGPTRAPEEL
A0A8C0L0H0_HRK-01       -------------------------ELHQRTMWRRRARSRRAPAPRALPT
A0A8C0L5G0_BCL2L11      -------------------------DRSPAPMSCDKSTQTPSPPCQAFNH
A0A8C0KNS8_BAD-01       PPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSP--SWTR
A0A8C0L5G0_BCL2L11      -PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH
                                                      .           ..  .   

A0A8C0L1H3_PMAIP1-      EVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT-----------------
A0A8C0L0H0_HRK-01       YWPWLCAAAQVAALAA------WLLGRRNL--------------------
A0A8C0L5G0_BCL2L11      YLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRV---FLNN
A0A8C0KNS8_BAD-01       VIQS------------------WWDRNLGRGGSAPSQ-------------
A0A8C0L5G0_BCL2L11      YLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVMMFYLLL
                                              .                           

A0A8C0L1H3_PMAIP1-      --------------------------------
A0A8C0L0H0_HRK-01       --------------------------------
A0A8C0L5G0_BCL2L11      YQAAEAHPQMIILRLLRYIVRLVWRLQ-----
A0A8C0KNS8_BAD-01       --------------------------------
A0A8C0L5G0_BCL2L11      LLTPSPSPQFFFFKVTSKNSILILEMQGITYM
                                                        

© 1998-2023Legal notice