Dataset for protein classical BH3-containing proteins of organism Canis lupus dingo

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0L1H3_PMAIP1-      ----------------------------------MPGRKA----------
A0A8C0L0H0_HRK-01       --------------------------------------------------
A0A8C0JZ72_BMF-01       ----------MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQL
A0A8C0JZ72_BMF-02       ----------MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQL
A0A8C0KNS8_BAD-01       MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPS--PGKHQQTAPGLLGEA
A0A8C0L5G0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---
A0A8C0L5G0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNP
                                                                          

A0A8C0L1H3_PMAIP1-      --------------------------------------------------
A0A8C0L0H0_HRK-01       --------------------------------------------------
A0A8C0JZ72_BMF-01       DCPLSRLHLFPLTHCCGPGLRPTSQEDKA---------------------
A0A8C0JZ72_BMF-02       DCPLSRLHLFPLTHCCGPGLRPTSQEDKA---------------------
A0A8C0KNS8_BAD-01       GHQQGQPASRKHHGGAGAETRS----------------------------
A0A8C0L5G0_BCL2L11      --------------------------------------------------
A0A8C0L5G0_BCL2L11      EGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFS
                                                                          

A0A8C0L1H3_PMAIP1-      ---RKSAQPGPTRAPEELE-------------------------------
A0A8C0L0H0_HRK-01       ------MCPCPLHRGRGPPAVCACSAGRLA--------------------
A0A8C0JZ72_BMF-01       ---TQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A8C0JZ72_BMF-02       ---TQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A8C0KNS8_BAD-01       ---RHSSFPAGTDEDEGME----EEELSPF-----------R--------
A0A8C0L5G0_BCL2L11      ---DRSPAPMSCDKSTQTP----SPPCQAF-----------NHYLSAMAS
A0A8C0L5G0_BCL2L11      FDTDRSPAPMSCDKSTQTP----SPPCQAF-----------NHYLSAMAS
                                *                                         

A0A8C0L1H3_PMAIP1-      --------------VECAIQLRKFGDKLNF--------------------
A0A8C0L0H0_HRK-01       --------LRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPA-----
A0A8C0JZ72_BMF-01       LEQPPEGQWQHRAEVQIARKLQCIADQFHRLH------------------
A0A8C0JZ72_BMF-02       LEQPPEGQWQHRAEVQIARKLQCIADQFHRLH------------------
A0A8C0KNS8_BAD-01       -GRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQS
A0A8C0L5G0_BCL2L11      MRQSQAVPADMRPEIWIAQELRRIGDEFNAYY------------------
A0A8C0L5G0_BCL2L11      MRQSQAVPADMRPEIWIAQELRRIGDEFNAYY------------------
                                         .  *. :.*:::                     

A0A8C0L1H3_PMAIP1-      ---RQKLLNLLSKLFRSGT-------------------------------
A0A8C0L0H0_HRK-01       ---PRALPTYWPWLCAAAQVAALAAWLLGRRNL-----------------
A0A8C0JZ72_BMF-01       --------------MQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR
A0A8C0JZ72_BMF-02       --------------MQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR
A0A8C0KNS8_BAD-01       PSWTRVIQSWWDRNLGRGGSAPSQ--------------------------
A0A8C0L5G0_BCL2L11      ---PRRV---FLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ---------
A0A8C0L5G0_BCL2L11      ---PRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM----
                                                                          

© 1998-2022Legal notice