Dataset for protein Bim of organism Callorhinchus milii

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A4W3IWD3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Callorhinchus milii GN=BCL2L11 (length=156 residues).
MCSGVVKEYPGMSRGELSGQSDFPINTTCENIQLSPAFITTCPLFNTNFFRTPYSPVSPSSRTSRLSSGYFTFDVDIGLM
ARPTSCDKSTQTPSPTCQAIYLAHHTSLSLISTNKQFLGNHNRELEMMVMRYSKQCVKGVHLKSTPFNFPVLLKSL
>gnl|bcl2dbpro|A0A4W3IWD3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Callorhinchus milii GN=BCL2L11 (length=164 residues).
RCSQFQFHTLTDKREGRQGVPSDFPINTTCENIQLSPAFITTCPLFNTNFFRTPYSPVSPSSRTSRLSSGYFTFDVDIGL
MARPTSCDKSTQTPSPTCQAIYLARQALAQAPLDHTSLSLMSVNFLGNHNRELEMMVMRYSKQCVKGVHLKSTPFNFPVL
LKSL
>gnl|bcl2dbpro|A0A4W3IWD3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Callorhinchus milii GN=BCL2L11 (length=124 residues).
MQSSRSTQNIQLSPAFITTCPLFNTNFFRTPYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTPSPTCQAIYL
ARQALAQAPHSQTHGKNLLLCIFLPSMTAFNIELDPRGKGFVIV
© 1998-2020Legal notice