Dataset for protein Bim of organism Callorhinchus milii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W3IWD3_BCL2L11      -----------------------MQSSRSTQNIQLSPAFITTCPLFNTNF
A0A4W3IWD3_BCL2L11      MCSGV-VKEYPGMSRGELSGQSDFPINTTCENIQLSPAFITTCPLFNTNF
A0A4W3IWD3_BCL2L11      RCSQFQFHTLTDKREGRQGVPSDFPINTTCENIQLSPAFITTCPLFNTNF
                                               :  . : :*******************

A0A4W3IWD3_BCL2L11      FRTPYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTPSPTCQA
A0A4W3IWD3_BCL2L11      FRTPYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTPSPTCQA
A0A4W3IWD3_BCL2L11      FRTPYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTPSPTCQA
                        **************************************************

A0A4W3IWD3_BCL2L11      IYLARQALAQAPHSQT--------------HGKNL-LLCIFLPSMTAFNI
A0A4W3IWD3_BCL2L11      IYLAH---------HTSLSLISTNKQFLGNHNRELEMMVMRYSKQCVKGV
A0A4W3IWD3_BCL2L11      IYLARQALAQAPLDHTSLSLMSVN--FLGNHNRELEMMVMRYSKQCVKGV
                        ****.         :*              *..:* :: :  ..  . .:

A0A4W3IWD3_BCL2L11      ELDPRGKGFVIV----
A0A4W3IWD3_BCL2L11      HLKSTPFNFPVLLKSL
A0A4W3IWD3_BCL2L11      HLKSTPFNFPVLLKSL
                         *..   .* ::    

© 1998-2020Legal notice