Dataset for protein classical BH3-containing proteins of organism Buteo japonicus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C0AW70_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Buteo japonicus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A8C0B3C7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Buteo japonicus GN=BCL2L11 (length=183 residues).
MLLRGELSRFPPTDGKSFSLLEAGFLGVQIQLWLSSQYDKTDRFPFSCCALQNGLGRKCENVIKLSRQRFFKVREGAAAV
PARKEGYLERGKEKVLLGKESGAWHLSFPPYLIGDQTSRWQSHSLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLDNQ
AGNPQIIILRLLRYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C0HKC1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Buteo japonicus GN=PMAIP1 (length=43 residues).
PPASSSSAPVEAQCALQLRRIGDKWDLRQKILNLLTKLFFPET
© 1998-2022Legal notice