Dataset for protein classical BH3-containing proteins of organism Buteo japonicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0HKC1_PMAIP1-      --------------------------------------------------
A0A8C0AW70_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C0B3C7_BCL2L11      ----MLLRGELSRFPPTDGKSFSLLEAGFLGVQIQLWLSSQYDKTDR---
                                                                          

A0A8C0HKC1_PMAIP1-      --------------------------------------------------
A0A8C0AW70_BMF-01       LLGRFQLFPLTHC---------CGPGIRHPEQQ-DKATQTLSPSSSSQDV
A0A8C0B3C7_BCL2L11      -------FPFSCCALQNGLGRKCENVIKLSRQRFFKVREGAAAVPARKEG
                                                                          

A0A8C0HKC1_PMAIP1-      --------------------------------------PPASSSSAPVEA
A0A8C0AW70_BMF-01       MLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEV
A0A8C0B3C7_BCL2L11      YLERG--KEKVLLGKESGAWHLSFPPY-LIGDQTSRWQSHSLAEDVQPEI
                                                              .     ..  * 

A0A8C0HKC1_PMAIP1-      QCALQLRRIGDKWD-------------------LRQKILNLLTKLFFPET
A0A8C0AW70_BMF-01       QIARKLQCIADQFH------RLHIQRHQQNRNQVWWQLFLFLHNLALNAE
A0A8C0B3C7_BCL2L11      WIAQELRRIGDEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
                        . * :*. *.*::                    :  .::  : .*     

A0A8C0HKC1_PMAIP1-      ---------
A0A8C0AW70_BMF-01       ANRNHTGQR
A0A8C0B3C7_BCL2L11      ---------
                                 

© 1998-2022Legal notice