Dataset for protein Bim of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A663E970_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL2L11 (length=108 residues).
MAKQPPEVKAQRDGEGGRLPPAEGPGPAAQLRPGAPAALPGSRSPAPLSCDKATQTPSPPCQALSHCLSAMGDSSLGFLL
LFLHKPRGVIGARVVQLPLVLVRPKIGA
>gnl|bcl2dbpro|A0A663E983_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL2L11 (length=66 residues).
ITQAAPFSPEDVQPEIWIAQELRRIGDEFNASYCPRRVTFIFSLSISLRTVSKREKLNHLWKLVLW
© 1998-2020Legal notice