Dataset for protein Bim of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A663E970_BCL2L11      MAKQPPEVKAQRDGEGGRLPPAEGPGPAAQLRPGAPAALPGSRSPAPLSC
A0A663E983_BCL2L11      ---------------------------ITQAAPFSPEDV-----------
                                                    :*  * :*  :           

A0A663E970_BCL2L11      DKATQTPSPPCQALSHCLSAMGDSSLGFLLLFLHKPRGVIGARVVQLPLV
A0A663E983_BCL2L11      --------QPEIWIAQELRRIGDE---FNASYCPRRVTFIFSLSISLRTV
                                 *   ::: *  :**.   *   :  .   .* :  :.*  *

A0A663E970_BCL2L11      LVRPKIGA-------
A0A663E983_BCL2L11      SKREKLNHLWKLVLW
                          * *:.        

© 1998-2020Legal notice