Dataset for protein Bmf of organism Apteryx owenii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9NX34_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Apteryx owenii GN=BMF (length=223 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHAPPVGFALDPHLQEEPQEGQREAHVEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNGEANRNHTGQRQNCFCKSILQNPAWSYWWLFSVCNCLLPVQ
>gnl|bcl2dbpro|A0A8B9NX34_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Apteryx owenii GN=BMF (length=178 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHAPPVGFALDPHLQEEPQEGQREAHVEVQIARKLQCIADQFHRLHVQR
LPLPKAKETLRTAPQQKE
© 1998-2022Legal notice