Dataset for protein Bmf of organism Apteryx owenii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9NX34_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8B9NX34_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       **************************************************

A0A8B9NX34_BMF-01      LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8B9NX34_BMF-02      LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                       **************************************************

A0A8B9NX34_BMF-01      RRLFYGNAGYRLHAPPVGFALDPHLQEEPQEGQREAHVEVQIARKLQCIA
A0A8B9NX34_BMF-02      RRLFYGNAGYRLHAPPVGFALDPHLQEEPQEGQREAHVEVQIARKLQCIA
                       **************************************************

A0A8B9NX34_BMF-01      DQFHRLHVQRHQQNRNQVWWQLFLFLHNLALNGEANRNHTGQRQNCFCKS
A0A8B9NX34_BMF-02      DQFHRLHVQRLPLPKAK----------------ETLRTAPQQKE------
                       **********    . :                *: *. . *.:      

A0A8B9NX34_BMF-01      ILQNPAWSYWWLFSVCNCLLPVQ
A0A8B9NX34_BMF-02      -----------------------
                                              

© 1998-2022Legal notice