Dataset for protein Bim of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5CA89_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPSD
>gnl|bcl2dbpro|A0A2K5CA89_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=105 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGDISLWFRF
IFTFFDLYGHHHSQGTEQLHHKYFS
© 1998-2020Legal notice