Dataset for protein Bim of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CA89_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5CA89_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
                                                                          

A0A2K5CA89_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGDI------------SLWF
A0A2K5CA89_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
                         ******************************..:            .:*:

A0A2K5CA89_BCL2L11      -----RFIFTFFDLYGHHHSQGTEQLHHKYFS
A0A2K5CA89_BCL2L11      AQELRRIGDEFNAYYPRRISLPSD--------
                             *:   *   * .. *  ::        

© 1998-2020Legal notice