Dataset for protein Bmf of organism Anas zonorhyncha

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9VI07_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anas zonorhyncha GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
>gnl|bcl2dbpro|A0A8B9VI07_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Anas zonorhyncha GN=BMF (length=126 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNHTGQSHRKEGLFL
>gnl|bcl2dbpro|A0A8B9VI07_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Anas zonorhyncha GN=BMF (length=199 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
VGCFQRGRWGLTYPGVVLLKPGSRHQPSRLLPEAAGCQQ
© 1998-2022Legal notice