Dataset for protein Bmf of organism Anas zonorhyncha

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9VI07_BMF-03      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8B9VI07_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8B9VI07_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       ******************************                    

A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-01      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8B9VI07_BMF-02      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                                                                         

A0A8B9VI07_BMF-03      -----GNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIA
A0A8B9VI07_BMF-01      RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIA
A0A8B9VI07_BMF-02      RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIA
                            *********************************************

A0A8B9VI07_BMF-03      DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNHTGQS-HRKEGL
A0A8B9VI07_BMF-01      DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR-------
A0A8B9VI07_BMF-02      DQFHRLHIQRVGCFQRGRWG---LTYPGVVLLKPGSRHQPSRLLPEAAGC
                       **********    ..  *    *   .:.*   ..*::...        

A0A8B9VI07_BMF-03      FL
A0A8B9VI07_BMF-01      --
A0A8B9VI07_BMF-02      QQ
                         

© 1998-2022Legal notice