Dataset for protein classical BH3-containing proteins of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A493SWX7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=PMAIP1 (length=51 residues).
MPCRTLRKPAQPSAERQAVAECALELRRIGDKADFRQRILNLITKLFCPKT
>gnl|bcl2dbpro|A0A493T7X1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BMF (length=236 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYASAEQKSSVVAAFSLSTQLGLKRGGEQEPHWAEVSFTHLFQATSSLQGALNKHWF
GGETCTPPAGCEDSEILLLVFKFGVLWTPLCCSLPCEAGSSCPTLSKESQNVGVFGKACCWVPAPVTSVQERQVLG
>gnl|bcl2dbpro|A0A493T7X1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
>gnl|bcl2dbpro|U3IW89_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL2L11 (length=159 residues).
GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLA
EEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLVPRLPPPFPRPGSVAGGVCLVGAVQLGIKVTFFTLFSF
© 1998-2020Legal notice