Dataset for protein classical BH3-containing proteins of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A493SWX7_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       -----------------GGAGKHGAGTGRDGRGGQ-------RQPRARSP
A0A493T7X1_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A493T7X1_BMF-02       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                                                                          

A0A493SWX7_PMAIP1-      -------------------------------------------MPCRTLR
U3IW89_BCL2L11-01       LLSRSSSGYFSFEAERSPA---PMSCDKATQTPSP---------PCQA--
A0A493T7X1_BMF-01       LLGRFQ--LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTE
A0A493T7X1_BMF-02       LLGRFQ--LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTE
                                                                    ** .  

A0A493SWX7_PMAIP1-      KP-----------------------------AQPSAERQAVAECALELRR
U3IW89_BCL2L11-01       -----------------VSHYLSAMASRWRSHSLAEEIQPEIWIAQELRR
A0A493T7X1_BMF-01       EPRRLFYASAEQKSSV-VAAFSLSTQLGLKRGGEQEPHWAEVSFTHLFQA
A0A493T7X1_BMF-02       EPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQC
                                                              ..    :  :. 

A0A493SWX7_PMAIP1-      IGDKADFRQ---------------------------RILNLITKL-----
U3IW89_BCL2L11-01       IGDEFNASYCPRR-----------------------VIFLFLLSISLH--
A0A493T7X1_BMF-01       TSSL---------QGALNKHWFGGETCTPPAGCEDSEILLLVFKFGVLWT
A0A493T7X1_BMF-02       IADQFHRLHIQRHQQNRNQVWW--------------QLFLFLHNLALN--
                         ..                                  :: :: .:     

A0A493SWX7_PMAIP1-      ------------FCPKT---------------------------------
U3IW89_BCL2L11-01       ------------LVPRLPPPFPRPGSVAGGVCLVGAVQLGIKVTFFTLFS
A0A493T7X1_BMF-01       PLCCSLPCEAGSSCPTLSKESQNVGVFGKACCWVPAPVTSVQERQVLG--
A0A493T7X1_BMF-02       ---------------------------------VEANRNHTGQR------
                                                                          

A0A493SWX7_PMAIP1-      -
U3IW89_BCL2L11-01       F
A0A493T7X1_BMF-01       -
A0A493T7X1_BMF-02       -
                         

© 1998-2020Legal notice