Dataset for protein Noxa of organism Ailuropoda melanoleuca

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1LIZ7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=53 residues).
IGSLLSGEPASPSPSAAPPPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
© 1998-2021Legal notice