Dataset for protein Noxa of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N5JEA5_PMAIP1-      MPGKKARKSAQASPARTPAEPEVECAIQLRRFGDKLNFRQKLLNLISKLF
G1LIZ7_PMAIP1-01        IGSLLSGEPASPSPSAAPP-PEVECAIQLRRFGDKLNFRQKLLNLISKLF
                        : .  : :.*..**: :*. ******************************

A0A7N5JEA5_PMAIP1-      RSGT
G1LIZ7_PMAIP1-01        RSGT
                        ****

© 1998-2022Legal notice