Dataset for protein Puma of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A7N5KJL4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=180 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLWPAGVVGADHAPPPPRLFPGP
QPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYN
LIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A7N5KJL4_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=184 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCHRLRGGSEGGGAGRHLPNPS
PPGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWR
VLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2022Legal notice