Dataset for protein Puma of organism Ailuropoda melanoleuca

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1LNV7_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=152 residues).
GSGARGDPISRPQAQVWKLRPRCVTGGKHRLRGGSEGGGAGRHLPNPSPPGPQPSLSPAEQHLESPVPSAPGALAGGPTQ
AAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2020Legal notice