Dataset for protein Puma of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1LNV7_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLC
G1LNV7_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYL-
                    *********************************************************** 

G1LNV7_BBC3-01      HRLRGGSEGGGAGRHLPNPSP---PGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGV
G1LNV7_BBC3-02      ------WPAGVVGADHAPPPPRLFPGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGV
                            .* .*   . *.*   ************************************

G1LNV7_BBC3-01      RGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPLPRGRG
G1LNV7_BBC3-02      RGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPLPRGRG
                    ************************************************************

G1LNV7_BBC3-01      APEMEPN
G1LNV7_BBC3-02      APEMEPN
                    *******

© 1998-2021Legal notice