Dataset for protein Bmf of organism Accipiter nisus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9MY06_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Accipiter nisus GN=BMF (length=390 residues).
HLEQDGGLSFPAKTGDAQAVISQGCSPRRAALSPGRGLGPLLRLRPTPGTDEESGEASTRGSPPGLARPAGVLRAGSCGV
TDGSPGRAPAGAGPGRAQPAPARGGDSRPRPPAPQPGRAGPGRAHLSRGGGGCPSRRAPPLPAHWPAGGGGARRGRGRRQ
LFAVRPAAAAAVWRWGGAAAAPGTPRPRGTPVPLLGAMDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFT
QNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDP
HLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A8B9MY06_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Accipiter nisus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
© 1998-2022Legal notice