Dataset for protein Bmf of organism Accipiter nisus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9MY06_BMF-01      HLEQDGGLSFPAKTGDAQAVISQGCSPRRAALSPGRGLGPLLRLRPTPGT
A0A8B9MY06_BMF-02      --------------------------------------------------
                                                                         

A0A8B9MY06_BMF-01      DEESGEASTRGSPPGLARPAGVLRAGSCGVTDGSPGRAPAGAGPGRAQPA
A0A8B9MY06_BMF-02      --------------------------------------------------
                                                                         

A0A8B9MY06_BMF-01      PARGGDSRPRPPAPQPGRAGPGRAHLSRGGGGCPSRRAPPLPAHWPAGGG
A0A8B9MY06_BMF-02      --------------------------------------------------
                                                                         

A0A8B9MY06_BMF-01      GARRGRGRRQLFAVRPAAAAAVWRWGGAAAAPGTPRPRGTPVPLLGAMDR
A0A8B9MY06_BMF-02      -----------------------------------------------MDR
                                                                      ***

A0A8B9MY06_BMF-01      PSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLG
A0A8B9MY06_BMF-02      PSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLG
                       **************************************************

A0A8B9MY06_BMF-01      RFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRL
A0A8B9MY06_BMF-02      RFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRL
                       **************************************************

A0A8B9MY06_BMF-01      FYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQF
A0A8B9MY06_BMF-02      FYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQF
                       **************************************************

A0A8B9MY06_BMF-01      HRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
A0A8B9MY06_BMF-02      HRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
                       ****************************************

© 1998-2022Legal notice