Dataset for protein BCL-2-like of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

727 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMC-------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A2K5DMS4_MCL1-01      -----------------------MFGFQVVIRLNLYC-------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          ---------------------MFGLRRNAVIGLNLYC---------GGA-
A5PJR2_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A452GA25_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
G1L3L7_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
G1T2Q0_MCL1-01          -------------------MAMFSLRRNAVIGLNLYL---------GGP-
F7AVA6_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A337S3J9_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A337S3J9_MCL1-03      ---------------------MFGLKRNAVIGLNLYC---------GGA-
Q7YRZ9_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
F1PAP1_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
Q8HYS5_MCL1-01          ---------------------MFGLKRNAVIRTQLYC---------GGA-
M3XZZ5_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A452RHX5_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
H0XFB7_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
F7GTF7_MCL1-01          ---------------------MFGLQRNAVIGLNLYC---------GGA-
A0A2K5CFH3_MCL1-01      ---------------------MFGLQRNAVIGLNLYC---------GGA-
A0A2K6V5Y3_MCL1-01      ---------------------MFGLQRNAVIGLNLYC---------GGA-
A0A2K6KRW9_MCL1-01      ---------------------MFGFKRNAVIGLNLYC---------GGA-
A0A2K5XSB2_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A0D9RZP5_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
I7G687_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2K5LXU8_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2I3GJZ3_MCL1-02      ---------------------MFGLRRNAVIGLNLYC---------GGA-
H2N5Y9_MCL1-01          ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2R9BPJ5_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2I3RTV4_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2I2YQH7_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2K5C7L5_MCL1-01      ---------------------MFGLQRNALIGLNLYC---------EWA-
A0A2K5I9I0_MCL1-02      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2K6GI15_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2I3GJZ3_MCL1-01      ---------------------MFGLRRNAVIGLNLYC---------GGA-
A0A2K5CFH3_MCL1-03      ---------------------MFGLQRNAVIGLNLYC---------GGA-
A0A2K5R5E2_MCL1-03      ---------------------MFGLQRNAVIGLNLYC---------GGA-
A0A2K5W0W9_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2K6ECR0_MCL1-02      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2I3LFM0_MCL1-01      ---------------------MFGLKRNAVIGLNLYC---------GGA-
A0A2K6KRW9_MCL1-02      ---------------------MFGFKRNAVIGLNLYC---------GGA-
A0A2K6PPI3_MCL1-02      ---------------------MFGFKRNAVIGLNLYC---------GGA-
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        -------------MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEA-
B6V6J0_MCL1-01          -------------MMHQSVIAKQRPSTSFLIPCQFYC-------------
G3PJT0_MCL1-01          ---------------------MNIIQRPKLAALNMTGVMSCIILPQNGVA
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        ------------------------MGWPNLKYLLLGLSPYIHASLLCLT-
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      ---------------------------DLWINLGISC---------GRA-
G1QAV8_MCL1-01          --------------------MFG-PKRNAFIGLNLHC---------GGAV
H9GEA6_MCL1-02          ------------------------------------MAPNTPASPGAGG-
H9GEA6_MCL1-01          --------------------MFNKKSMVLVCGGAPSMAPNTPASPGAGG-
A0A493U0E8_MCL1-01      ------------------------------------------------G-
A0A1L1RNM6_MCL1-01      --------------------MFA-VKRNAVIGFNLYC---------GGG-
A0A1L1RNM6_MCL1-02      --------------------MFA-VKRNAVIGFNLYC---------GGG-
G2HFR3_MCL1-01          ---------------MDICRLSAAMREFYIVHLDIY--------------
F6ZMX1_MCL1-01          --------------------MLGPFKKNAVIGLNLYC---------GGA-
F6ZMX1_MCL1-03          --------------------MLGPFKKNAVIGLNLYC---------GGA-
F6ZMX1_MCL1-02          --------------------MLGPFKKNAVIGLNLYC---------GGA-
G1T2Q0_MCL1-02          --------------------MFS-LRRNAVIGLNLYL---------GGP-
F1PAP1_MCL1-02          --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A337S3J9_MCL1-04      --------------------MFG-LKRNAVIGLNLYC---------GGA-
F7AVA6_MCL1-02          --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2K6GI15_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
C8YZ26_MCL1-01          --------------------MFG-LKRNAVIGLNLYC---------GGA-
F7GTF7_MCL1-02          --------------------MFG-LQRNAVIGLNLYC---------GGA-
A0A2K5R5E2_MCL1-04      --------------------MFG-LQRNAVIGLNLYC---------GGA-
A0A2K6V5Y3_MCL1-03      --------------------MFG-LQRNAVIGLNLYC---------GGA-
A0A2K5LXU8_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2K5I9I0_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2I2YQH7_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
Q07820_MCL1-04          --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2K5W0W9_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2K6ECR0_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2K5XSB2_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2R9BPJ5_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2I3RTV4_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2I3LFM0_MCL1-03      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A2K6PPI3_MCL1-03      --------------------MFG-FKRNAVIGLNLYC---------GGA-
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A287DCH9_MCL1-02      --------------------MFG-LKRNAVIGLNLYC---------GGA-
P97287_MCL1-01          --------------------MFG-LRRNAVIGLNLYC---------GGA-
A0A452GA25_MCL1-02      --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A287DCH9_MCL1-01      --------------------MFG-LKRNAVIGLNLYC---------GGA-
G3T756_MCL1-01          --------------------MFG-FKRNAVIGLNLYC---------GGA-
A0A1S3F3I1_MCL1-01      --------------------MFG-LRRNAVIGLNFYC---------GGA-
G1L3L7_MCL1-02          --------------------MFG-LKRNAVIGLNLYC---------GGA-
A0A287BK44_MCL1-01      --------------------MFG-LQRNAVIGLNLYC---------GGA-
A0A287BK44_MCL1-02      --------------------MFG-LQRNAVIGLNLYC---------GGA-
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       ------------------------------------------MSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P8PVZ8_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P9BLI0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------MFQLSWGLFLLEAESADK
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        ------------------------------MPSARNSPLPRQSAAPQPCC
A0A2K5CWY6_BCL2L2-      ------------------------------MPLLVLCPYIHASLSSLPL-
A0A2K5CWY6_BCL2L2-      ------------------------------------------HLSSLPL-
G3TMU7_BCL2L2-01        --------------------------------------YIHVSLSSLTL-
G1TW27_BCL2-02          --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------DILVELDSFLCAPSDRRTGDSVTERRTASRESRAFV
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A2K5DMS4_MCL1-01      ----------------------GAIPPGPRLL------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------MGGSL-------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          --------------SLGAG---GGSPAGTRLAA--EEAKARRE-GGGEA-
A5PJR2_MCL1-01          --------------GLGQG-S-GASSPGGRLLAAGKEATARREVGGGEAG
A0A452GA25_MCL1-01      --------------GLGQG-S-GASSPGGRLLAAGKEATARREVGGGEAG
G1L3L7_MCL1-01          --------------GLGAG-SGGGXS-GGRLLASGKEATARREIGGGEAG
G1T2Q0_MCL1-01          --------------GLGAG-GGGVAPPAERLLAAEKEAAARLEVGGGEAG
F7AVA6_MCL1-01          --------------GLGAG-GGGASSPGGRLLAAGKEATARREGGGGEAG
A0A337S3J9_MCL1-01      --------------GLAAG-SGGASSSGGRLVAVGKEATARREVGGGEAG
A0A337S3J9_MCL1-03      --------------GLAAG-SGGASSSGGRLVAVGKEATARREVGGGEAG
Q7YRZ9_MCL1-01          --------------GLAAG-SGGASSSGGRLVAVGKEATARREVGGGEAG
F1PAP1_MCL1-01          --------------GLGAG-SGGASSSGGRLLASGKEATTRREGGGGEAG
Q8HYS5_MCL1-01          --------------GLGAG-SGGASSSGGRLLASGREATTRREGGGGEAG
M3XZZ5_MCL1-01          --------------GLGAG-TGGASSSGGRLLASGKEATARREVGGGEAG
A0A452RHX5_MCL1-01      --------------GLGAG-SGGAASSGGRLLASGKEATARREVGGGEAG
H0XFB7_MCL1-01          --------------GLGAG-SGGATPPGGRLLAAEKEAAARREAGGGEAG
F7GTF7_MCL1-01          --------------GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAG
A0A2K5CFH3_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAG
A0A2K6V5Y3_MCL1-01      --------------GLGAG-SGGATPPGGRLLAAEKEASAQREVGGGEAG
A0A2K6KRW9_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K5XSB2_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A0D9RZP5_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
I7G687_MCL1-01          --------------GLGAG-SSGATPPGGRLLATEKEASARREIGGGEAG
A0A2K5LXU8_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2I3GJZ3_MCL1-02      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
H2N5Y9_MCL1-01          --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2R9BPJ5_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2I3RTV4_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2I2YQH7_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K5C7L5_MCL1-01      --------------GLGTG-SGGTTPPGGRLLATEKEASAQREVGGGEAG
A0A2K5I9I0_MCL1-02      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K6GI15_MCL1-01      --------------GLGAG-SSGATPPGGRLLAAEKEATARREVGGGEDG
A0A2I3GJZ3_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K5CFH3_MCL1-03      --------------GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAG
A0A2K5R5E2_MCL1-03      --------------GLGAG-SGGATPPGGRLLATEKEASAQREVGGGEAG
A0A2K5W0W9_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K6ECR0_MCL1-02      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2I3LFM0_MCL1-01      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K6KRW9_MCL1-02      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
A0A2K6PPI3_MCL1-02      --------------GLGAG-SGGATPPGGRLLATEKEASARREIGGGEAG
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------GYNADGSVPPSPPTPSTP------------------
E2RS00_BCL2A1-01        --------------RLRDPEGSTRPPPGPQGLPGTLMTNVSIGKERKKDW
B6V6J0_MCL1-01          --------------SGGGSSEKTLSARGASPW------------------
G3PJT0_MCL1-01          PMRQLAMGSAKDSHNGNAGTNDTPKRPSALGV------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K6TM77_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K5RUN8_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K6GWM6_BCL2L2-      -------------------MATPASAPDTRAL------------------
W5QDH4_BCL2L2-01        --------------PTAARMATPASAPDTRAL------------------
A0A2K6ME72_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K6RW35_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A287ATE4_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2R8M4C0_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A452UF16_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K5MZX9_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K5HEJ9_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K5V0Q3_BCL2L2-      -------------------MATPASAPDTRAL------------------
F7G4L5_BCL2L2-02        -------------------MATPASAPDTRAL------------------
A0A2K6EA59_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K6AI25_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A1U7RC37_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2I3GEA7_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2R9A2Q3_BCL2L2-      -------------------MATPASAPDTRAL------------------
H2Q805_BCL2L2-02        -------------------MATPASAPDTRAL------------------
A0A096NX09_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A287ATE4_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A4D6NWN1_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A1U7UJF2_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A452UF16_BCL2L2-      -------------------MATPASAPDTRAL------------------
A0A2K6F6N9_MCL1-01      --------------DL----------------------------------
G1QAV8_MCL1-01          GGLWRQRSLHLLQEGGPCPQESGAGRETGTVI------------------
H9GEA6_MCL1-02          --------------GVGESSGGNNNDGGGVSV------------------
H9GEA6_MCL1-01          --------------GVGESSGGNNNDGGGVSV------------------
A0A493U0E8_MCL1-01      --------------GWGTESWRNTSWPSKGPARSDHLGSV----------
A0A1L1RNM6_MCL1-01      --------------SPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPL
A0A1L1RNM6_MCL1-02      --------------SPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPL
G2HFR3_MCL1-01          ------------------------PPPECTIH------------------
F6ZMX1_MCL1-01          --------------GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGG
F6ZMX1_MCL1-03          --------------GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGG
F6ZMX1_MCL1-02          --------------GMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGG
G1T2Q0_MCL1-02          --------------GLGAG-GGGVAPPAERLL------------------
F1PAP1_MCL1-02          --------------GLGAG-SGGASSSGGRLL------------------
A0A337S3J9_MCL1-04      --------------GLAAG-SGGASSSGGRLV------------------
F7AVA6_MCL1-02          --------------GLGAG-GGGASSPGGRLL------------------
A0A2K6GI15_MCL1-03      --------------GLGAG-SSGATPPGGRLL------------------
C8YZ26_MCL1-01          --------------GLGAG-SGGATRPGGRLL------------------
F7GTF7_MCL1-02          --------------GLGAG-SGGATPPGGRLL------------------
A0A2K5R5E2_MCL1-04      --------------GLGAG-SGGATPPGGRLL------------------
A0A2K6V5Y3_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2K5LXU8_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2K5I9I0_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2I2YQH7_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
Q07820_MCL1-04          --------------GLGAG-SGGATRPGGRLL------------------
A0A2K5W0W9_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2K6ECR0_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2K5XSB2_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2R9BPJ5_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2I3RTV4_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2I3LFM0_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A2K6PPI3_MCL1-03      --------------GLGAG-SGGATPPGGRLL------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------GLGA--------------------------------
A0A287DCH9_MCL1-02      --------------EV----------------------------------
P97287_MCL1-01          --------------SLGA---GGGSPAGARLVA--EEAKARREGGGE---
A0A452GA25_MCL1-02      --------------GLGQ--GSGASSPGGRLLAAGKEATAR---------
A0A287DCH9_MCL1-01      --------------GLGA--SGGATPPGAQLLAAEKEAAARREAGGGE--
G3T756_MCL1-01          --------------GLGA--GGCATPPGGRLPAPGKEATARQEVGGGD--
A0A1S3F3I1_MCL1-01      --------------GLGAGSGAAAA-PGGRLL-TAEEASARREAGGGEAG
G1L3L7_MCL1-02          --------------GLGAGSGGGXS--GGRLLASGKEATARREIGGGEAG
A0A287BK44_MCL1-01      --------------GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAG
A0A287BK44_MCL1-02      --------------GLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAG
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       ----------------------------------DELKLRTRRLLTEFLE
I3KXG5_MCL1-01          --------------------------------LERETKLIIHSFLGDFT-
H0ZCL9_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
U3JTB2_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
A0A218V8Z6_BCL2A1-      --------------------------------METAEFYYVYYLAQDYLQ
Q9W6F2_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
A0A493SSZ7_BCL2A1-      --------------------------------METAEFYYVYYLAQDYLQ
G1N8C5_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
A0A452J3N6_BCL2A1-      --------------------------------MESSEYCYVYYLVQDYLK
K7G130_BCL2A1-01        --------------------------------MESSEFRYVYYLVQDYLK
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------MTDCEFGYIHMLAQDYLK
F6SFL4_BCL2A1-01        --------------------------------MDDYEFHYVHMLARDYLK
G3WSP8_BCL2A1-01        --------------------------------MADCEFHYVHMLAQDYLK
A0A2K5PYQ3_BCL2A1-      --------------------------------MTDSEFGYIHNLTQDYLW
A0A2K5PYQ3_BCL2A1-      --------------------------------MTDSEFGYIHNLTQDYLW
F6S8G3_BCL2A1-01        --------------------------------MDDGVFWSVRALALDYLD
O55178_BCL2A1-01        --------------------------------MAEYELMHIHSLAEHYLQ
Q0P538_BCL2A1-01        --------------------------------MAEYELMHIHSLAEHYLQ
G3V977_BCL2A1-01        --------------------------------MTDCEFMYIHSLAENYLQ
Q925A9_BCL2A1-01        --------------------------------MTDCEFMYIHSLAENYLQ
Q07440_BCL2A1-01        --------------------------------MAESELMHIHSLAEHYLQ
O55179_BCL2A1-01        --------------------------------MSEYEFMYIHSLAEHYLQ
O55177_BCL2A1-02        --------------------------------MAEYEFMYIHSLAEHYLQ
Q497M6_BCL2A1-01        --------------------------------MAEYEFMYIHSLAEHYLQ
Q8K164_BCL2A1-01        --------------------------------MAEYEFMYIHSLAEHYLQ
Q4FK02_BCL2A1-01        --------------------------------MSEYEFMYIHSLAEHYLQ
A0A452SIR9_BCL2A1-      --------------------------------MTDCEFGYTLTLAQDYVK
M3YVH4_BCL2A1-01        --------------------------------MTDSEFGYTLSLAQDYVR
U6CQS8_BCL2A1-01        --------------------------------MTDGEFGYTLSLAQDYVR
I3MCZ7_BCL2A1-01        --------------------------------MNDCEFRFIHTLAQDYLQ
G3T8E6_BCL2A1-01        --------------------------------MTDCEFGYIYKLVQDYLK
H0WZ23_BCL2A1-01        --------------------------------MTDCEFGYIHRLAQDYLQ
A0A2I3HBP6_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5D2I1_BCL2A1-      --------------------------------MTDCEFGYIHNLTQDYLR
B4E1X9_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2I2YML2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2R8ZJX9_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2I3HBP6_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6PHF2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6LV19_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5TMD1_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KAA3_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6DS18_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A096NMX5_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6AD27_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6TLJ5_BCL2A1-      --------------------------------MTDHEFGYIHNLTQDYLR
F7HXW0_BCL2A1-01        --------------------------------MTDSEFGYIHNLTQDYLQ
A0A2K6TLJ5_BCL2A1-      --------------------------------MTDHEFGYIHNLTQDYLR
A0A2K6EKG1_BCL2A1-      --------------------------------MTDCEFGYTHRLVQDYLQ
A0A452EK63_BCL2A1-      --------------------------------MTDTEFDYVHKLAEDYLK
W5Q0N6_BCL2A1-01        --------------------------------MTDTEFDYVHKLAEDYLK
L8IZT5_BCL2A1-01        --------------------------------MTDTEFGYVHGLAEDYLK
Q3C2I0_BCL2A1-01        --------------------------------MTDTEFGYVHGLAEDYLK
F7CP56_BCL2A1-04        --------------------------------MTDCEFGYIHMLAQDYLK
C7F841_BCL2A1-01        --------------------------------MTDDEFGYIHMLAQDYLK
A0A2K5D2I1_BCL2A1-      --------------------------------MTDCEFGYIHNLTQDYLR
H2NNZ9_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2I2YML2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6LV19_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6PHF2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KHH8_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KHH8_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KAA3_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5TMD1_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
F7E8V5_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6DS18_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6AD27_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A096NMX5_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A0D9RRC3_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
Q16548_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2R8ZJX9_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
W5MMB7_MCL1-01          ---------------------------------MSLSSLKRTSASAVIQL
A0A3B3SG34_MCL1-01      --------------------------------MNPQSLKSYAPIMVSMNY
Q4SW32_MCL1-01          --------------------------------MSVIANRTAIDTM-----
D2ITA0_MCL1-03          -------------------------------MLSQKLTSNYGTSLVQTCW
D2ITA0_MCL1-04          -------------------------------MLSQKLTSNYGTSLVQTCW
A0A3P9ILF6_MCL1-01      -------------------------------MFPLQKQM--------VNS
A0A3P9ILF6_MCL1-02      -------------------------------MFPLQKQM--------VNS
Q0KFR9_MCL1-01          --------------------------------MSLSNSITRATTT-----
A0A3P8Y1W8_MCL1-02      --------------------------------MNLSKSLTRATTT-----
A0A3P8Y1W8_MCL1-01      --------------------------------MNLSKSLTRATTT-----
A0A3Q2XZL8_MCL1-01      --------------------------------MSMVQ--PTSQVLKPQGR
A0A3B4AFB7_MCL1-02      --------------------------------MNIINSPKRTALKLSTMG
A0A3B3VM25_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      -------------------------------MNTCTMRNCRMGSYKNVMD
A0A3B4T8L9_MCL1-02      --------------------------------MNLIQ-SPKPTAFTAMNY
A0A3B4T8L9_MCL1-01      --------------------------------MNLIQ-SPKPTAFTAMNY
A0A3Q1EQB9_MCL1-02      --------------------------------MNMIP--TKRTTL--MNC
A0A3B4ZKP6_MCL1-01      --------------------------------MNIIP-TTKRTAL--MSC
A0A3Q1BKL8_MCL1-02      --------------------------------MNMIPTTTKRTAF--MNY
A0A3Q1EQB9_MCL1-01      --------------------------------MNMIP--TKRTTL--MNC
A0A3Q1BKL8_MCL1-01      --------------------------------MNMIPTTTKRTAF--MNY
A0A3P8RQX7_MCL1-01      --------------------------------MNMIPTTTKRTAF--MNY
A0A3P8RQX7_MCL1-02      --------------------------------MNMIPTTTKRTAF--MNY
A0A3Q3VP02_MCL1-01      -------------------------------------------------M
A0A3B5K5B3_MCL1-01      -------------------------------------MNIIANHTALRIM
A0A3B3IJ04_MCL1-01      ---------------------------------------MFPLQKQMVNS
A0A3P9L1F3_MCL1-01      ---------------------------------------MFPLQKQMVNS
A0A3B3IJ04_MCL1-02      ---------------------------------------MFPLQKQMVNS
A0A3P9L1F3_MCL1-02      ---------------------------------------MFPLQKQMVNS
A0A3B3CEX1_MCL1-02      ---------------------------------------MLPLQKHMVNS
A0A3B3CEX1_MCL1-01      ---------------------------------------MLPLQKHMVNS
A0A3Q3B4P5_MCL1-01      -----------------------------------------MFPKPKPSY
A0A3Q3B4P5_MCL1-02      -----------------------------------------MFPKPKPSY
A0A3Q2EDX8_MCL1-01      -----------------------------------------------MSY
A0A3Q2P7X9_MCL1-01      --------------------------------------MSKAPTSTQLVN
A0A3Q2P7X9_MCL1-02      --------------------------------------MSKAPTSTQLVN
A0A3B5PQ55_MCL1-02      ---------------------------------------MTANSTNALNY
A0A3B5PQ55_MCL1-01      ---------------------------------------MTANSTNALNY
A0A3P9Q4I8_MCL1-02      ---------------------------------------MTANSTTALNY
A0A3P9Q4I8_MCL1-01      ---------------------------------------MTANSTTALNY
A0A087X830_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3B3YCD0_MCL1-01      ---------------------------------------MTANSTTALNY
I3JHR5_MCL1-01          ----------------------------------MTNFLMSKRNQCTFID
A0A3Q4HLQ8_MCL1-01      ----------------------------------MTNYMMSKRNQCTFID
A0A3P8NP63_MCL1-02      ----------------------------------MANYMMLKRNQCTLME
A0A3Q2VNL8_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A3P8NP63_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A3P9BVM3_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A3B4G4Z6_MCL1-01      ----------------------------------MANYMMLKRNQCTLME
A0A2U9CJ81_MCL1-01      -----------------------------MNIIPSTKRAAFNVTTGVMGC
A0A3P8VKM5_MCL1-05      -----------------------------MNIIKN-NQAKLNVATGVLGC
A0A3P8VKM5_MCL1-04      -----------------------------MNIIKN-NQAKLNVATGVLGC
A0A3P8VKM5_MCL1-03      -----------------------------MNIIKN-NQAKLNVATGVLGC
A0A3Q3IZW0_MCL1-01      -----------------------------MNIITS-KKWADVNVTTEIMS
A0A3Q1GX28_MCL1-02      ------------------------------MLPSG-RTAMKL-ATGGMSC
A0A3Q1GX28_MCL1-01      ------------------------------MLPSG-RTAMKL-ATGGMSC
A0A3B4XKA5_MCL1-01      -----------------------------MNLIQA-PKQAAL-T--AVNY
A0A3Q3GP42_MCL1-01      -----------------------------MDIINM-KRAAVS-VSAGVMS
A0A3Q3M6G2_MCL1-01      -----------------------------MSFIPS-TRRAAL-IP-GVM-
A0A3Q3M6G2_MCL1-02      -----------------------------MSFIPS-TRRAAL-IP-GVM-
A0A3B1IEV7_MCL1-01      ---------------------------------------------MNPTA
A0A3B4CGU9_MCL1-03      ---------------------------------------------MESAA
A0A3B4CGU9_MCL1-02      ---------------------------------------------ME---
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q9Z0F3_BCL2L10-01       -----------------------------MADSQDPLHERTRRLLSDYIF
E1B9B3_BCL2L10-01       --------------------------MTEGGAMVDPFRERTARLLMDYLE
A0A1U7QVA0_BCL2L10      --------------------------------MADPLRVRTRLLLTDYLT
F1RZB9_BCL2L10-01       --------------------------------MADAFRERTARLLTDYLE
F1MV39_BCL2L10-01       -----------------------------VADGQESLVERTARLLMDYLE
W5QIG4_BCL2L10-01       -----------------------GRPPGRGGAMVDPFRERTARLLMDWLE
Q99M66_BCL2L10-01       --------------------------------MGDPLQDRTRRLLTDYIL
F6ZPD4_BCL2L10-01       -------------------------------AVAEALRERTALLLIDYLQ
A0A2K6F2Q2_BCL2L10      --------------------------------MGDRFRERTERLLADYLE
H0WZ06_BCL2L10-01       --------------------------------MADPLRERTERLLTDYLE
A0A1U7UZD8_BCL2L10      --------------------------------MADPLEERTARLLADYLE
G1T264_BCL2L10-01       --------------------------------MADALEERTARLLTDYLE
A0A0D9RG38_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5RIU7_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K5F974_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K6TIT7_BCL2L10      --------------------------------MADPLQQRTEQLVADYLE
F7CT87_BCL2L10-01       --------------------------------MADPLRQRTEQLVTDYLE
A0A096NM44_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K6R5T5_BCL2L10      --------------------------------MADPLRERTERLLADYLG
Q9HD36_BCL2L10-02       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
G1R3W6_BCL2L10-01       --------------------------------MVDQLRERTERLLADYLG
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K6M5H5_BCL2L10      ----------------------MADPLRERTTVADPLRERTERLLADYLG
A0A2K5TKG9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
F7H6U5_BCL2L10-01       --------------------------------MADPLRERTERLLADYLG
A0A2K6B2D9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5MMZ4_BCL2L10      --------------------------------MADPLRERTERLLADYLG
H2NN92_BCL2L10-01       ----------------------MVDQLRERTITADLLRERTERLLADYLG
A0A2R9BCD9_BCL2L10      ----------------------MVDQWRERTTMADPLRERTERLLADYLG
H2Q9G4_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
G3QLU6_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
A0A337RYG8_BCL2L10      --------------------------------MADALRERTAQLLTDYLE
G1LKR4_BCL2L10-01       --------------------------------MADALRG-TARLLTDYLE
A0A452QJG0_BCL2L10      --------------------------------MADALRERTARLLTDYLE
R4JQR8_BCL2L1-01        -----------------------------------MNQFSSRYLVADFIN
A0A346RRN1_BCL2L1-      -----------------------------------MNQYSSRYLVVDFVN
A0A3Q4MN81_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3B4ETX9_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
D2IT42_BCL2L10-02       --------------------------------MSCRLWKETLALSEDYLL
A0A3Q0S9R1_BCL2L10      --------------------------------MVPGLWKETLGLAEDYLS
I3J363_BCL2L10-01       SLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P8PVZ8_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P9BLI0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2PJS5_BCL2L10      -------------------MCREPSHIAGRKMS-CGLWKETVAVAEDYMR
A0A3Q2GL87_BCL2L10      -------------------MCREPLHITGRKMS-CGLWKETVAVAEDYMR
A0A3B5MJ12_BCL2L10      -------------------------------MS-CGLWKETVVVAEDYIR
M4AUW7_BCL2L10-01       -------------------------------MS-CGLWKETVVVAEDYIR
A0A096ME02_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3B3TYN4_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIR
A0A3B3YT99_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9NE65_BCL2L10      ---------MRRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9IIZ2_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
A0A3P9LM07_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
H2MBQ3_BCL2L10-01       -------------------------------MS-CGLRKETLAVALDYLS
A0A3B4AAV4_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3JQ78_BCL2L10      -------------------MCREHLDIAGRKMS-CGLWKDTLALAEDYLS
A0A3B4TIY6_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLY
A0A3B4WGF4_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLF
A0A3Q3KZW1_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3B5KD08_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3VI28_BCL2L10      -------------------------------MS-CGLWKETLALAQDYLS
A0A3Q1GM98_BCL2L10      -------------------------------MS-CGLWKETVVLAEDYLS
A0A3Q1D2L0_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3P8RL82_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3B4ZFS0_BCL2L10      -------------------------------MS-CGLWKETLVVAEDYLS
A0A3B3C5I4_BCL2L10      -----------------------MDGFSAQKMS-CGLRKETLAVALDYLS
A0A3Q1IAB0_BCL2L10      CADAEGKLRVHRGSPSAVRMCREQTDIAGRKMS-CGLWKDTLALAEDYLS
A0A3P8W7K5_BCL2L10      --------MCNSASPSAVSTSSEQSDIAGRKMS-CGLWKETLAVAEDYLS
H3AAS7_BCL2L2-02        ----------------------------------MDSLYSNRGVVEDFIY
H3AAS7_BCL2L2-01        ----------------------------------MDSLYSNRGVVEDFIY
G1Q051_BCL2L2-01        -----MNEFSLDNFMLYSFDSVDIRPKVLGPKSSQPQAPDTQALVADFVG
G3WPT1_BCL2L2-01        ---------------HSSSPIFFSLPFIASQMATPASAPDTRALVADFVG
A0A287D9B3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A482LX62_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
W5QDH4_BCL2L2-02        -MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVG
Q7TS60_BCL2L2-01        -----MSLFGLCQYFSYIYVSLSSLPLSAARMATPASTPDTRALVADFVG
G1LMC3_BCL2L2-01        ---------------PYIHASLSSLTLTAARMATPASAPDTRALVADFVG
M3Y5X5_BCL2L2-01        -----KPEAPLLAFQPYIHASLSSLTLTAARMATPASAPDTRALVADFVG
G1P3J2_BCL2L2-01        -----PEMLHSVSLTKYTHASLLSLTFTAARMATPASAPDTRALVADFVG
G3WPT1_BCL2L2-02        -------------------------------MATPASAPDTRALVADFVG
G1TV33_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
P70345_BCL2L2-01        -------------------------------MATPASTPDTRALVADFVG
O88996_BCL2L2-01        -------------------------------MATPASTPDTRALVADFVG
A0A3Q9B4M8_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
H0XR82_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A250YBR2_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A250YBR2_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
L8HP19_BCL2L2-02        -------------------------------MATPASAPDTRALVADFVG
L8HP19_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
Q1RMX3_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A452ECF0_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A286XQQ9_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5RUN8_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5MZX9_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A0D9RU30_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5HEJ9_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A1S3FYD8_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2I2UAE3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2I2YPX6_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A287D9B3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5V0Q3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
F7G4L5_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A2K6EA59_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6AI25_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A1U7RC37_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2I3GEA7_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2R9A2Q3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
H2Q805_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A096NX09_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6GWM6_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6ME72_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6RW35_BCL2L2-      -------------------------------MATPASAPDTRALVADFLG
A0A2K6RW35_BCL2L2-      -------------------------------MATPASAPDTRALVADFLG
A0A2K6TM77_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A287ATE4_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A1U7UJF2_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A452SHI1_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
Q05KI8_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
Q568V1_MCL1-01          ---------------------------------------------MSFLA
Q1L8X3_MCL1-01          ---------------------------------MALSLDFRRTATMSFFA
Q9I9N3_MCL1-01          ---------------------------------MALSLDFRRTATMSFFA
A0A286XUI2_BCL2A1-      ------------------------------------MGHILLSATAGSLD
A0A452U285_BCL2A1-      ------------------------------------MHTEIPPASARPMS
A0A452U285_BCL2A1-      ------------------------------------MHTEIPPASARPMS
A0A3B3R4U0_MCL1-01      --------------------------------MNLINRTTATGLFCPGIK
F7CP56_BCL2A1-03        --------------------------------------MTDCILIKKLLP
Q2TAP5_BCL2L1-01        ------------------------------------MEGSSRDLVEKFVS
Q91828_BCL2L1-01        ------------------------------------MEGSSRDLVEKFVS
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3P8V8T6_MCL1-01      ---------------------LDMVLISSVCLTLCTLENDTRQLICDFLK
A0A3P8YNB4_BCL2-01      -----------------------------------MADDDNRFIVEKYIC
A0A3P8WUE9_BCL2-01      --------------------------MYLVPNSAGMASECNRYIVEKYIC
A0A3B4A3G8_BCL2-01      -----------------------------------MANDCNRNIVEKYIC
A0A3Q3G1D7_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3Q2XQX2_BCL2-02      -----------------------------------MANERNRTIVENYIC
A0A3Q2XQX2_BCL2-01      -----------------------------------MANERNRTIVENYIC
A0A3Q3B0R2_BCL2-01      -------------------------------------MEVNRFIVENYIC
A0A3Q2PN77_BCL2-01      -----------------------------------MANDCNRDIVENYIF
A0A3P9J8Y9_BCL2-01      -----------------------------------MANVSNRSIVEKYIC
A0A3Q0S5Z7_BCL2-01      -----------------------------------MANEYNRNIVEKYIC
A0A3P8QVM8_BCL2-01      -----------------------------------MENEYNRNIVEKYIC
A0A3P9DIG5_BCL2-01      -----------------------------------MENEYNRNIVEKYIC
A0A3Q2UYW8_BCL2-01      -----------------------------------MANEYNRNIVEKYIC
A0A3B4G3K4_BCL2-01      -----------------------------------MANEYNRNIVEKYIC
A0A2U9BJ09_BCL2-01      -----------------------------------MASECNRNIVEKYIC
A0A3Q1I5N1_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3Q3K1K1_BCL2-01      -----------------------------------MANECNRNVVEKYIC
A0A3Q3MEY1_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A1X9JZA1_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A4D6FTA2_BCL2-01      -----------------------------------MANERNRNIVEKYIC
A0A3Q1FLK7_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3Q1B8C3_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3P8S9L3_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3B5BBQ0_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3B4TX71_BCL2-01      -----------------------------------MASEYNRNIVEKYIC
A0A3B4YAG2_BCL2-01      -----------------------------------MASEYNRNIVEKYIC
Q5XGJ4_BCL2L2-01        ---------------------------------MAQSELGSRALVEDFVR
F7G6M3_BCL2L2-01        LAPCPSRPPGSPPDAPPRPPPPRCPAAPRMATPAPASVSDTRALVADFVG
A0A2K5CWY6_BCL2L2-      -------------------------IAARMATPASA--PDTRALVADFVG
A0A2K5CWY6_BCL2L2-      -------------------------IAARMATPASA--PDTRALVADFVG
G3TMU7_BCL2L2-01        -------------------------AAARMATPASA--PDTRALVADFVG
G1TW27_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
E2RS00_BCL2A1-02        ------------------------MSHLFGGSYDAQRCSGERRLPAVGFM
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
H9GHK7_BCL2L1-01        ------------------------------------MSSSNRALVVDFLS
Q07816_BCL2L1-04        ------------------------------------MSSSNRELVIDFVS
A0A493TIA6_BCL2L1-      ------------------------------------MSSGNRELVIDFVS
Q07816_BCL2L1-03        ------------------------------------MSSSNRELVIDFVS
Q07816_BCL2L1-02        ------------------------------------MSSSNRELVIDFVS
Q07816_BCL2L1-01        ------------------------------------MSSSNRELVIDFVS
G1N5N5_BCL2L1-01        ------------------------------------MSSSNRELVIDFVS
A0A452ILL8_BCL2L1-      ------------------------------------MSNTNRELVIDFLS
A0A452ILL8_BCL2L1-      ------------------------------------MSNTNRELVIDFLS
K7F655_BCL2L1-01        ------------------------------------MSNTNRELVIDFLS
A0A452E1B1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
W5PSA5_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
P53563_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
P53563_BCL2L1-03        ------------------------------------MSQSNRELVVDFLS
A0A287CZ07_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A3Q2H0F6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
F6WA14_BCL2L1-01        ------------------------------------MSHSNRELVIDFLS
G3WKX6_BCL2L1-01        ------------------------------------MSHSNRELVVDFLS
M3XA94_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
M3XA94_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
H0X6V2_BCL2L1-01        ------------------------------------MSQSNRELVVDFIS
G3SPN0_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
M3XA94_BCL2L1-03        ------------------------------------MSQSNRELVVDFLS
G1RER8_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A1S2ZQT6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
Q64373_BCL2L1-09        ------------------------------------MSQSNRELVVDFLS
Q64373_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
P53563_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
O77737_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q9MYW4_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A3Q2H0F6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
L8J061_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q05KJ0_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
Q05KJ0_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
E2IV76_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K6G3C5_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
B2Z3Z4_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
G3HEA7_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
G3HEA7_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A1U7T4L4_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
M3Z2H9_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A1U7QU73_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A0D9RJZ8_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A286Y5D6_BCL2L1-      ------------------------------------MSQSNWELVVDFLS
A0A250YD48_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A1L5BWY3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
I3MUP5_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
I3MUP5_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
I3MUP5_BCL2L1-03        ------------------------------------MSQSNRELVVDFLS
G1P9D2_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K5EBP4_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
E2IV75_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
F7IT34_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q76LT7_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K5Q6R6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5Q6R6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5M8B1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5H963_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
Q8SQ42_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K5VPG2_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5YR37_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2R8Z9D7_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A096NV05_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2J8VIH3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K6QFA2_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K6QFA2_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K6UWY8_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
E2IV77_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A452SDS4_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A384D3U1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A452FWV3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
Q9MZS7_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A3B3TCS4_BCL2-01      --------------------------------MANDVPYDSRNIVEIYIY
A0A0U3DHY6_BCL2-01      --------------------------------MANENPYDSRFIVEKYIH
A0A3P9AAB2_BCL2-01      --------------------------------MANENPYDSRVIVENYIY
F6YNL8_BCL2-01          -----------------------------MMAHPGRRGYDNREIVMKYIH
A0A218UQA0_BCL2-01      ------------------------------MAHPGRRGYDNREIVLKYIH
Q00709_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
A0A493T1X3_BCL2-01      ------------------------------MAHPGRRGYDNREIVLKYIH
U3KEW4_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
G3WZW9_BCL2-01          ------------------------------MAHPGRRGYDNREIVMKYIH
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
M3YYK3_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6R2I5_BCL2-02      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2R9APW6_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
M3X1R9_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
G3SLZ1_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
Q75SV7_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
M3X1R9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
Q8I008_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A076FU27_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
A0A4P8GLJ2_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
F6R2C4_BCL2-01          ------------------------------MAHAGGTGYDNREIVMKYIH
O02718_BCL2-01          ------------------------------MAHAGGTGYDNREIVMKYIH
A0A076FZV9_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
A0A452EV13_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
A0A250YD83_BCL2-01      ------------------------------MAQAGRTGYDNREIVMKYIH
A9QXG9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5NZS5_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A0D9S017_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6CIX3_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5XRD4_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6KHG1_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6R2I5_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5HK49_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
G3QES9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
H2QEM8_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2I3GZF9_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6UEL3_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
G3WZW9_BCL2-02          --------------PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIH
G3SLZ1_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A452T603_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
H3ANS8_BCL2L1-01        ------------------------------------KMSFNRLLVVDHIS
A0A452FHY1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A452FHY1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A1S3EPX7_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
H0Z8G3_BCL2L1-01        ------------------------------------MYSSNRELVIDFVS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
U3JSL7_BCL2L1-01        ------------------------------------MYSSNRELVIDFVS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
Q4U2V6_BCL2L1-01        ------------------------------------MSSSNRELVIDFVS
X4ZGI8_BCL2-01          --------------------------------MANEIRYDNRNIVEKYLN
A0A3B3E2W4_BCL2L1-      ------------------------------------MSHCNRELVQFYLG
A0A3B3I2Q5_BCL2L1-      ------------------------------------MSHCNRELVRFYLA
A0A3P9I2N4_BCL2L1-      ------------------------------------MSHCNRELVRFYLA
A0A3P9MKK4_BCL2L1-      ------------------------------------MSHCNRELVRFYLA
A0A3B5B4X7_BCL2L1-      ---------------------------------MEIMSYSNRELVEFFIS
A0A3B4BFZ8_BCL2L1-      ------------------------------------MSPSNRELVEFFIS
A0A3Q3FUB6_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3B5MGS2_BCL2L1-      ------------------------------------MAYSNRELVEFYIS
M4A558_BCL2L1-01        ------------------------------------MAYSNRELVEFYIS
A0A3P9QFB3_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A087YBW4_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3B3VWI7_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3B3XN57_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3Q2C6K4_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3Q2NRP4_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A0B4KJI5_BCL2L1-      ------------------------------------MSYSNRELVESFLS
A0A3Q1JZ46_BCL2L1-      ---------------------------------MEEMSNSNRELVEFFIM
A0A3Q1JZ46_BCL2L1-      ---------------------------------MEEMSNSNRELVEFFIM
A0A3Q3NFM4_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3Q3NFM4_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3B4V9K8_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3B4XS24_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
C1BLI0_BCL2L1-01        ------------------------------------MSYSNRELVVFFIS
C0HAD8_BCL2L1-01        ------------------------------------MSYSNRELVVFFIS
A0A3B3ZMX9_BCL2L1-      -------------------------------------MSLNRELVEFYIQ
A0A3B5K6B9_BCL2L1-      -------------------------------------MSQNRELVIFYIK
A0A3B5K6B9_BCL2L1-      -------------------------------------MSQNRELVIFYIK
H3CH49_BCL2L1-01        ----------------------RSHPGAKSKGASTQRMSLNRELVIFYIK
A0A3B3TFR4_BCL2L1-      ------------------------------------MSYSNRELVEYFVS
A0A3P8XYL5_BCL2L1-      ------------------------------------MTYNNKELVAYYIT
Q90Z98_BCL2L1-02        ------------------------------------MSYYNRELVVFFIK
Q90Z98_BCL2L1-01        ------------------------------------MSYYNRELVVFFIK
A0A059PJI5_BCL2L1-      ------------------------------------MSYYNRELVVYFIK
A0A3B4DTL9_BCL2L1-      ------------------------------------MSYYNRELVVYFIK
A0A3Q2FR43_BCL2L1-      -------------------------------------MSQNRELVLFYIK
B5XAY3_BCL2L1-01        -----------------------------------MMTYNNRELVVYYIT
W5MG74_BCL2L1-01        -----------------------------------KMSYSNRDLVVYYIN
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A3Q3B3X5_BCL2L1-      -------------------------------------MSQNKELVLFYIM
A0A3B3IB64_BCL2L1-      -------------------------------------MSRNRELVVFYVK
A0A3P9JYH1_BCL2L1-      -------------------------------------MSRNRELVVFYVK
A0A3B3DHA1_BCL2L1-      -------------------------------------MSRNRELVVFYVK
A0A3Q0RTF8_BCL2L1-      -------------------------------------MSQNRELVLFYIT
I3IZK7_BCL2L1-01        -----------------------------------YKMSQNRELVLFYIR
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A0D6DR75_BCL2L1-      -------------------------------------MSQNRELVVYYIT
A0A3Q3WIW8_BCL2L1-      -------------------------------------MSVNRELVAYYIN
A0A219P0Y3_BCL2L1-      -------------------------------------MCQNRELVVCYIK
A0A3Q3MX20_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q3G2E1_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q3G2E1_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q3G2E1_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q1GZ93_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q1GZ93_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q1GZ93_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3B4V3T1_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3B4XU17_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3P9MKK4_BCL2L1-      ---------------------------------------MTKWKKSWHLT
A0A3B3I2Q5_BCL2L1-      ---------------------------------------MTKWKKSWHLT
A0A3P9I2N4_BCL2L1-      ---------------------------------------MTKWKKSWHLT
A0A3B4AFB7_MCL1-01      ------------------DTTCLQGVLTPPLGTAHICGSPHPRPTALVMK
B9ZYL7_BCL2-01          ------------------------------MAHPRRGGYDHRDIVVKYIH
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLE
A0A3Q2Y539_MCL1-01      -------------------------------------MPESKRFPLYNFK
A0A3Q3BEB7_BCL2L1-      ------------------------------------MSHSNRDLVQFYIS
A0A3P8VMA1_BCL2L1-      ------------------------------------MSCSNRELVKFFLG
A0A345BSW9_BCL2L1-      ------------------------------------MSYYNRELVVFFIK
A0A286MU87_BCL2L1-      ------------------------------------MSYSNRELVVFFIS
A0A3P8XFS0_BCL2L1-      ------------------------------------MSYSNRELVVFFIN
A0A3P8XFS0_BCL2L1-      ------------------------------------MSYSNRELVVFFIN
A0A0F7L1T6_BCL2L1-      ------------------------------------MSYNNRELVEHFLR
H2U5I3_BCL2L1-01        ------------------------------------MSYNNRELVEHFLR
H2U5I3_BCL2L1-02        ------------------------------------MSYNNRELVEHFLR
A0A3Q3J5K3_BCL2L1-      ------------------------------------MSYSHRELVEFYIS
A0A3Q1EVP6_BCL2L1-      ------------------------------------MSCSNRELVEFFIS
A0A3Q1BQA0_BCL2L1-      ------------------------------------MSYSNRELVEFFVS
A0A3P8U812_BCL2L1-      ------------------------------------MSYSNRELVEFFVS
E6ZFR0_BCL2L1-01        ------------------------------------MSYSNRELVEFFIS
G3P7B4_BCL2L1-01        ------------------------------------MANINRELVEFFLS
A0A3Q3X5M5_BCL2L1-      ------------------------------------MSHSNRELVEFFIS
A0A2U9BIG9_BCL2L1-      ------------------------------------MSDSNRELVEFFIG
D2ITA2_BCL2L1-02        ------------------------------MSIDTSMSISNRELVFFFLS
A0A3B3ZMX9_BCL2L1-      -------------------------------------MSLNRELVEFYIQ
G3NJY1_BCL2L1-01        -------------------------------------MSQNRELVVFYIN
A0A2U9BY16_BCL2L1-      ---------------------------DARQRFCGEHHSRPEWIRQLFCR
A0A3Q3DUT7_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q3DUT7_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q3DUT7_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3B1JJ42_BCL2L1-      -----------------------------------VMSYYNRELVVYFIK
A0A3P8UWG7_BCL2L1-      ----------------------------------TLTFNINRKLVVDYIQ
A0A3Q3IVF5_BCL2L1-      -------------------------------------MSQNKELVVFYIT
A0A3Q1DHJ3_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q1DHJ3_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q1DHJ3_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3P8TL99_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3P8TL99_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q1FR00_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3B4Z3X2_BCL2L1-      -------------------------------------MSQNRELVVYYIK
A0A3B4Z3X2_BCL2L1-      -------------------------------------MSQNRELVVYYIK
C3VIT1_BCL2L1-01        -------------------------------------MSQNRELVVFYIK
A0A3P8P0F1_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q2X557_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3P9D632_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3P9D632_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q4N4B5_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3B4FNX1_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q2QPL9_BCL2L1-      -------------------------------------MSQNRELVLSYVK
A0A3B5PQJ0_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A087X9B7_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3B3TUS7_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3B3WI27_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3P9N9Y4_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3B3QRZ2_BCL2L1-      ------------------------------------MSYSNRELVMDFIT
Q564A4_BCL2-01          --------------------------------MANEISYDNRNIVEKYLK
H9GPE7_BCL2-01          ------------------------------MAHPGIRGYDNREIVLRYIH
A0A452I9V7_BCL2-01      -----------MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIH
W5N4F7_BCL2-01          -------------------------------MANNEAPYDTRNIVTKYIH
K7F5Y3_BCL2-02          ------------------------------MAHPGRRGYDNREIVLKYIH
A0A3Q2HRY3_BCL2-02      ------------------------------MAHAGRTGYDNREIVMKYIH
H0YUX3_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
K7F5Y3_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
F1LNV0_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
P49950_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
G1TW27_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5EB04_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2R8MY14_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
H2NWH5_BCL2-01          ------------------------------MAHAGTTGYDNREIVDEXIH
A0A096MPU7_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5PP81_BCL2-01      ------------------------------MAQAGRTGYDNREIVMKYIH
H0WKI0_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5UDI5_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
P10417_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
Q7TSN8_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
A0A3Q2HRY3_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
E2QWA1_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6G3I7_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
Q6R755_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
Q9JJV8_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
Q923R6_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
H0W1T3_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
G1LIC9_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
I3MVK9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      SVLAGPELVCQPCVGLVFTPERPVDISGPWWSEQRAAGRQPGTVCVHSNA
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          -------------------------------APPSPISGRGPRRHRDPSR
Q9Z1P3_MCL1-01          ----------------------ALLPGARVVARPPPVGAEDPDVTASAER
A5PJR2_MCL1-01          TVIGGSAG---------PSPPATLAPDARRVARPSPIGAEGPDVTATPTR
A0A452GA25_MCL1-01      TVIGGSAG---------PSPPATLAPDARRVARPSPIGAEGPDVTATPTR
G1L3L7_MCL1-01          AVIGGSAG---------ASPPX---------------GAEGPDVTATPPR
G1T2Q0_MCL1-01          AVIGGSPG---------ASPPAALAPDARRVARPAPIGAELPDVSATPAR
F7AVA6_MCL1-01          AVIGGSAG---------GSPQTTLAPDSLRVARPSPIGAEGPDVTAPSSR
A0A337S3J9_MCL1-01      AVIGGSAG---------ASPPATLAPDARRVARPSPIGAEGPDVTATPPK
A0A337S3J9_MCL1-03      AVIGGSAG---------ASPPATLAPDARRVARPSPIGAEGPDVTATPPK
Q7YRZ9_MCL1-01          AVIGGSAG---------ASPPATLAPDARRVARPSPIGAEGPDVTATPPK
F1PAP1_MCL1-01          AVIGGSAG---------ASPPTTLAPDARRVARPSPIGAEGPNVSATPPR
Q8HYS5_MCL1-01          AVIGGSAG---------ASPPTTLAPDARRVARPSPIGAEGPNVSATPPR
M3XZZ5_MCL1-01          AVIGGSAG---------ASTPATLAPDARRVARPSPIGAEGPNVTATPPR
A0A452RHX5_MCL1-01      AVIGGSAG---------ASPPATLAPDARRVARPSPIGAEGPDVTATPPR
H0XFB7_MCL1-01          EVIGGSPG---------ASSPASLTPDARRVARPPPIGAEVPDVTATPTR
F7GTF7_MCL1-01          AVTGGSAG---------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSR
A0A2K5CFH3_MCL1-01      AVIGGSAG---------ASPPAALVPDARRVVRPPPIGAEVPDVTATPSR
A0A2K6V5Y3_MCL1-01      AVIGGSAG---------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSR
A0A2K6KRW9_MCL1-01      TVIGESAG---------ASPPAALTPDARRVARPPPIGAEVPDVTGTPAR
A0A2K5XSB2_MCL1-01      TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTATPAR
A0A0D9RZP5_MCL1-01      TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTATPAR
I7G687_MCL1-01          TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTASPAR
A0A2K5LXU8_MCL1-01      TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTATPAR
A0A2I3GJZ3_MCL1-02      AVIGGSAG---------ASPPSVLTPDSRRVARPPPIGAEVSDVTATPAR
H2N5Y9_MCL1-01          AVIGGSAG---------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPAR
A0A2R9BPJ5_MCL1-01      AVIGGSAG---------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPAR
A0A2I3RTV4_MCL1-01      AVIGGSAG---------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPAR
A0A2I2YQH7_MCL1-01      AVIGGSAG---------ASPPSTLTPDSRRVARPPPIGAEVPDVTATPAR
A0A2K5C7L5_MCL1-01      VVIGGSAG---------ASPSAALTPDAR----------------GSCGR
A0A2K5I9I0_MCL1-02      TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTATPAR
A0A2K6GI15_MCL1-01      TVIGGSPG---------ASPPASLTPEARRVARPAPIGAEVPDVTATPER
A0A2I3GJZ3_MCL1-01      AVIGGSAG---------ASPPSVLTPDSRRVARPPPIGAEVSDVTATPAR
A0A2K5CFH3_MCL1-03      AVIGGSAG---------ASPPAALVPDARRVVRPPPIGAEVPDVTATPSR
A0A2K5R5E2_MCL1-03      AVIGGSVG---------ASPPAALTPDARRVVRPPPIGAEVPDVTATPSR
A0A2K5W0W9_MCL1-01      TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTASPAR
A0A2K6ECR0_MCL1-02      TVIGGSAG---------ASPPAALTPDARRVARPPPIGAEVPDVTASPAR
A0A2I3LFM0_MCL1-01      TVIGGTAG---------ASPPAALTPDARRVARPPPIGAEVPDVTATPAR
A0A2K6KRW9_MCL1-02      TVIGESAG---------ASPPAALTPDARRVARPPPIGAEVPDVTGTPAR
A0A2K6PPI3_MCL1-02      TVIGESAG---------ASPPAALTPDARRVARPPPIGAEVPDVTGTPAR
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          -------------------------------------------DVTAPPR
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          ----------------------------------------------MFGL
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        RFSLFLPGRLADPEGTAGWGWQQNPQDLPAQRFRKVNTQIFQRRSKVEQG
B6V6J0_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          ------------GWSAGASPQATLARDPGRVARPSPMGTEGPDGTAAPAR
H9GEA6_MCL1-02          -----------------PKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
H9GEA6_MCL1-01          -----------------PKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
A0A493U0E8_MCL1-01      -----LWKSEASSQGPARIDHFGSVPWNSEASPRGVVGTAHFGSVLWN--
A0A1L1RNM6_MCL1-01      IGSAGLWAAAGRAEAP-------RAPIGSGAAPHAPIGSAAARRAPPD--
A0A1L1RNM6_MCL1-02      IGSAGLWAAAGRAEAP-------RAPIGSGAAPHAPIGSAAARRAPPD--
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          EVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMP
F6ZMX1_MCL1-03          EVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMP
F6ZMX1_MCL1-02          EVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMP
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          ----------------------------------------GSGGATRPGG
A0A287DCH9_MCL1-02      -----------------------------------------PDVTATPAR
P97287_MCL1-01          ---------------------AALLPGARVVARPPPVGAEDPDVTASAER
A0A452GA25_MCL1-02      ------AG---------PSPPATLAPDARRVARPSPIGAEGPDVTATPTR
A0A287DCH9_MCL1-01      ---------------------AAQPPSARRVARPVPIGAEVPDVTATPAR
G3T756_MCL1-01          ------AG---------ASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPAR
A0A1S3F3I1_MCL1-01      AGIGGSAG---------ASPSTTLAPDARRVARPAPIGAEVPDVTGTPTK
G1L3L7_MCL1-02          AVIGGSAG---------ASPPAXXX--XXXXXXXXXXGAEGPDVTATPPR
A0A287BK44_MCL1-01      MVIGGSAG---------ASPPSTPAPDARRVARPSPIGAEGPDVTATPAR
A0A287BK44_MCL1-02      MVIGGSAG---------ASPPSTPAPDARRVARPSPIGAEGPDVTATPAR
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       H------------------------RTRRRGT------------------
I3KXG5_MCL1-01          --------------------------------------------------
H0ZCL9_BCL2A1-01        Y-------------------------------------------------
U3JTB2_BCL2A1-01        Y-------------------------------------------------
A0A218V8Z6_BCL2A1-      Y-------------------------------------------------
Q9W6F2_BCL2A1-01        Y-------------------------------------------------
A0A493SSZ7_BCL2A1-      Y-------------------------------------------------
G1N8C5_BCL2A1-01        Y-------------------------------------------------
A0A452J3N6_BCL2A1-      Y-------------------------------------------------
K7G130_BCL2A1-01        Y-------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        Y-------------------------------------------------
F6SFL4_BCL2A1-01        H-------------------------------------------------
G3WSP8_BCL2A1-01        H-------------------------------------------------
A0A2K5PYQ3_BCL2A1-      Y-------------------------------------------------
A0A2K5PYQ3_BCL2A1-      Y-------------------------------------------------
F6S8G3_BCL2A1-01        D-------------------------------------------------
O55178_BCL2A1-01        Y-------------------------------------------------
Q0P538_BCL2A1-01        Y-------------------------------------------------
G3V977_BCL2A1-01        Y-------------------------------------------------
Q925A9_BCL2A1-01        Y-------------------------------------------------
Q07440_BCL2A1-01        Y-------------------------------------------------
O55179_BCL2A1-01        Y-------------------------------------------------
O55177_BCL2A1-02        Y-------------------------------------------------
Q497M6_BCL2A1-01        Y-------------------------------------------------
Q8K164_BCL2A1-01        Y-------------------------------------------------
Q4FK02_BCL2A1-01        Y-------------------------------------------------
A0A452SIR9_BCL2A1-      H-------------------------------------------------
M3YVH4_BCL2A1-01        H-------------------------------------------------
U6CQS8_BCL2A1-01        H-------------------------------------------------
I3MCZ7_BCL2A1-01        H-------------------------------------------------
G3T8E6_BCL2A1-01        Y-------------------------------------------------
H0WZ23_BCL2A1-01        Y-------------------------------------------------
A0A2I3HBP6_BCL2A1-      Y-------------------------------------------------
A0A2K5D2I1_BCL2A1-      Y-------------------------------------------------
B4E1X9_BCL2A1-01        C-------------------------------------------------
A0A2I2YML2_BCL2A1-      Y-------------------------------------------------
A0A2R8ZJX9_BCL2A1-      Y-------------------------------------------------
A0A2I3HBP6_BCL2A1-      Y-------------------------------------------------
A0A2K6PHF2_BCL2A1-      Y-------------------------------------------------
A0A2K6LV19_BCL2A1-      Y-------------------------------------------------
A0A2K5TMD1_BCL2A1-      Y-------------------------------------------------
A0A2K5KAA3_BCL2A1-      Y-------------------------------------------------
A0A2K6DS18_BCL2A1-      Y-------------------------------------------------
A0A096NMX5_BCL2A1-      Y-------------------------------------------------
A0A2K6AD27_BCL2A1-      Y-------------------------------------------------
A0A2K6TLJ5_BCL2A1-      Y-------------------------------------------------
F7HXW0_BCL2A1-01        Y-------------------------------------------------
A0A2K6TLJ5_BCL2A1-      Y-------------------------------------------------
A0A2K6EKG1_BCL2A1-      Y-------------------------------------------------
A0A452EK63_BCL2A1-      Y-------------------------------------------------
W5Q0N6_BCL2A1-01        Y-------------------------------------------------
L8IZT5_BCL2A1-01        Y-------------------------------------------------
Q3C2I0_BCL2A1-01        Y-------------------------------------------------
F7CP56_BCL2A1-04        Y-------------------------------------------------
C7F841_BCL2A1-01        Y-------------------------------------------------
A0A2K5D2I1_BCL2A1-      Y-------------------------------------------------
H2NNZ9_BCL2A1-01        Y-------------------------------------------------
A0A2I2YML2_BCL2A1-      Y-------------------------------------------------
A0A2K6LV19_BCL2A1-      Y-------------------------------------------------
A0A2K6PHF2_BCL2A1-      Y-------------------------------------------------
A0A2K5KHH8_BCL2A1-      Y-------------------------------------------------
A0A2K5KHH8_BCL2A1-      Y-------------------------------------------------
A0A2K5KAA3_BCL2A1-      Y-------------------------------------------------
A0A2K5TMD1_BCL2A1-      Y-------------------------------------------------
F7E8V5_BCL2A1-01        Y-------------------------------------------------
A0A2K6DS18_BCL2A1-      Y-------------------------------------------------
A0A2K6AD27_BCL2A1-      Y-------------------------------------------------
A0A096NMX5_BCL2A1-      Y-------------------------------------------------
A0A0D9RRC3_BCL2A1-      Y-------------------------------------------------
Q16548_BCL2A1-01        C-------------------------------------------------
A0A2R8ZJX9_BCL2A1-      Y-------------------------------------------------
W5MMB7_MCL1-01          Y------------------------CPNATTIHPGLASLG-----PCPGG
A0A3B3SG34_MCL1-01      H------------------------RPLHHGVLGKSILQC---LDSSARA
Q4SW32_MCL1-01          N------------------------VMFQNGVGDADLSSS----------
D2ITA0_MCL1-03          F------------------------NSPQNGGEERNMDFHSEGSHTTTEG
D2ITA0_MCL1-04          F------------------------NSPQNGGEERNMDFHSEGSHTTTEG
A0A3P9ILF6_MCL1-01      Y------------------------ITSNCGFTGHILGRA---------G
A0A3P9ILF6_MCL1-02      Y------------------------ITSNCGFTGHILGRA---------G
Q0KFR9_MCL1-01          M------------------------LHFQNGGSSYLADDARPLYYFQGAG
A0A3P8Y1W8_MCL1-02      M------------------------LNVQNGVVGSLYSGA-PLCYFSPTG
A0A3P8Y1W8_MCL1-01      M------------------------LNVQNGVVGSLYSGA-PLCYFSPTG
A0A3Q2XZL8_MCL1-01      P------------------------MRPQNGVAEGLLQCN--------SP
A0A3B4AFB7_MCL1-02      L------------------------FLPQNGLAEGDMHCG--------AA
A0A3B3VM25_MCL1-01      L------------------------IFSQNGVGDGQTHYD--------QG
A0A3Q0R633_MCL1-01      -----------------------------------SLPF-----------
A0A3Q0R633_MCL1-03      L------------------------FLPQNGVVDGTMHYG--------SG
A0A3B4T8L9_MCL1-02      C------------------------ICRQNGGLETWTD-G--------SG
A0A3B4T8L9_MCL1-01      C------------------------ICRQNGGLETWTD-G--------SG
A0A3Q1EQB9_MCL1-02      L------------------------IFPQNGVVEGPMHYG--------SG
A0A3B4ZKP6_MCL1-01      F------------------------ILPQNGVVEGQMHYG--------SG
A0A3Q1BKL8_MCL1-02      L------------------------IFPQNGVVEGPMHYG--------SG
A0A3Q1EQB9_MCL1-01      L------------------------IFPQNGVVEGPMHYG--------SG
A0A3Q1BKL8_MCL1-01      L------------------------IFPQNGVVEGPMHYG--------SG
A0A3P8RQX7_MCL1-01      L------------------------IFPQNGVVEGPMHYG--------SG
A0A3P8RQX7_MCL1-02      L------------------------IFPQNGVVEGPMHYG--------SG
A0A3Q3VP02_MCL1-01      N------------------------VLFQNGVVSGPTR------------
A0A3B5K5B3_MCL1-01      N------------------------VVFQNGVVDGAGH------------
A0A3B3IJ04_MCL1-01      Y------------------------ITSNCGFTGHILGSR--------AG
A0A3P9L1F3_MCL1-01      Y------------------------ITSNCGFTGHILGSR--------AG
A0A3B3IJ04_MCL1-02      Y------------------------ITSNCGFTGHILGSR--------AG
A0A3P9L1F3_MCL1-02      Y------------------------ITSNCGFTGHILGSR--------AG
A0A3B3CEX1_MCL1-02      Y------------------------ITPSCGCTALFGG----------AG
A0A3B3CEX1_MCL1-01      Y------------------------ITPSCGCTALFGG----------AG
A0A3Q3B4P5_MCL1-01      I------------------------FFLQNGVVDGLHR------------
A0A3Q3B4P5_MCL1-02      I------------------------FFLQNGVVDGLHR------------
A0A3Q2EDX8_MCL1-01      L------------------------ILPQNGVVDGQTHYS--------PE
A0A3Q2P7X9_MCL1-01      C------------------------LISQNGVGDGQPHYR--------PG
A0A3Q2P7X9_MCL1-02      C------------------------LISQNGVGDGQPHYR--------PG
A0A3B5PQ55_MCL1-02      L------------------------IFSQNGVGNGQTHYD--------QG
A0A3B5PQ55_MCL1-01      L------------------------IFSQNGVGNGQTHYD--------QG
A0A3P9Q4I8_MCL1-02      L------------------------IFSQNGVGNGQTHYD--------QG
A0A3P9Q4I8_MCL1-01      L------------------------IFSQNGVGNGQTHYD--------QG
A0A087X830_MCL1-01      L------------------------IFSQNGVGDGQTHYD--------QG
A0A3B3YCD0_MCL1-01      L------------------------IFSQNGVGDGQTHYD--------QG
I3JHR5_MCL1-01          Y------------------------LLPQNGVLEGPMHYG--------SG
A0A3Q4HLQ8_MCL1-01      Y------------------------LIPQNGVLEGPMHYG--------SG
A0A3P8NP63_MCL1-02      Y------------------------LIPQNGVLEGPMHYG--------SG
A0A3Q2VNL8_MCL1-01      Y------------------------LIPQNGVLEGPMHYG--------SG
A0A3P8NP63_MCL1-01      Y------------------------LIPQNGVLEGPMHYG--------SG
A0A3P9BVM3_MCL1-01      Y------------------------LIPQNGVLEGPMHYG--------SG
A0A3B4G4Z6_MCL1-01      Y------------------------LIPQNGVLEGPMHYG--------SG
A0A2U9CJ81_MCL1-01      L------------------------ILPQNGVVEGAMHYG--------SG
A0A3P8VKM5_MCL1-05      F------------------------IVPQNGVVNGTMHYG--------TG
A0A3P8VKM5_MCL1-04      F------------------------IVPQNGVVNGTMHYG--------TG
A0A3P8VKM5_MCL1-03      F------------------------IVPQNGVVNGTMHYG--------TG
A0A3Q3IZW0_MCL1-01      L------------------------ILPQNGVVEGSMHCG--------S-
A0A3Q1GX28_MCL1-02      L------------------------MLPQNGVVE----YS--------SG
A0A3Q1GX28_MCL1-01      L------------------------MLPQNGVVE----YS--------SG
A0A3B4XKA5_MCL1-01      C------------------------ICRQNGGLE-TWRDS--------SG
A0A3Q3GP42_MCL1-01      F------------------------MMPQNGVGKGQMHYG--------PE
A0A3Q3M6G2_MCL1-01      I------------------------VLPQDGVLEGPVHYD--------SR
A0A3Q3M6G2_MCL1-02      I------------------------VLPQDGVLEGPVHYD--------SR
A0A3B1IEV7_MCL1-01      I------------------------SLLCDGTSPVLYRTE--------KE
A0A3B4CGU9_MCL1-03      I------------------------SLFCNGAGRIPFNKG--------SE
A0A3B4CGU9_MCL1-02      ----------------------------AHGGVQINMAAH--------PG
Q8UWD6_MCL1-01          ---------------------------------MFAGRNN--------DN
A2BF68_MCL1-01          ---------------------------------MFAGRNN--------DN
Q568W5_MCL1-01          ---------------------------------MFAGRNN--------DN
A0A3B1K5R1_MCL1-01      -------------------------MMSPQDMCSYNKKTA----------
A0A3B4C6H5_MCL1-01      ---------------------------LFSFVWEFSRKWP--------WN
A0A3B4C6H5_MCL1-03      -------------------------MMMSPKEMYFDKKTV--------FP
Q9Z0F3_BCL2L10-01       F------------------------CAREPDT------------------
E1B9B3_BCL2L10-01       F------------------------CAREPGT------------------
A0A1U7QVA0_BCL2L10      F------------------------CAREPGD------------------
F1RZB9_BCL2L10-01       Y------------------------CAREPGT------------------
F1MV39_BCL2L10-01       F------------------------CAREPGT------------------
W5QIG4_BCL2L10-01       F------------------------CAREPGT------------------
Q99M66_BCL2L10-01       F------------------------CARAPNT------------------
F6ZPD4_BCL2L10-01       R------------------------RAREPAT------------------
A0A2K6F2Q2_BCL2L10      Y------------------------CTREPGA------------------
H0WZ06_BCL2L10-01       Y------------------------CARDPTA------------------
A0A1U7UZD8_BCL2L10      Y------------------------CARPPGS------------------
G1T264_BCL2L10-01       C------------------------CAREPGT------------------
A0A0D9RG38_BCL2L10      C------------------------CAREPGT------------------
A0A2K5RIU7_BCL2L10      Y------------------------CSREPGT------------------
A0A2K5F974_BCL2L10      Y------------------------CSQEPGT------------------
A0A2K6TIT7_BCL2L10      Y------------------------CSREPGT------------------
F7CT87_BCL2L10-01       Y------------------------CSREPGT------------------
A0A096NM44_BCL2L10      C------------------------CAREPGT------------------
A0A2K6R5T5_BCL2L10      C------------------------CAREPGT------------------
Q9HD36_BCL2L10-02       Y------------------------CAREPGT------------------
G1R3W6_BCL2L10-01       C------------------------CAREPGT------------------
A0A2K5K3B0_BCL2L10      C------------------------CAREPGT------------------
A0A2K6M5H5_BCL2L10      C------------------------CAREPGT------------------
A0A2K5TKG9_BCL2L10      C------------------------CAREPGT------------------
F7H6U5_BCL2L10-01       C------------------------CAREPGT------------------
A0A2K6B2D9_BCL2L10      C------------------------CAREPGT------------------
A0A2K5MMZ4_BCL2L10      C------------------------CAREPGT------------------
H2NN92_BCL2L10-01       C------------------------CAREPGT------------------
A0A2R9BCD9_BCL2L10      Y------------------------CAREPGT------------------
H2Q9G4_BCL2L10-01       Y------------------------CAREPGT------------------
G3QLU6_BCL2L10-01       Y------------------------CAREPGT------------------
A0A337RYG8_BCL2L10      Y------------------------CAREPGS------------------
G1LKR4_BCL2L10-01       Y------------------------CAREPGT------------------
A0A452QJG0_BCL2L10      Y------------------------CAREPGT------------------
R4JQR8_BCL2L1-01        D------------------------RLRKHGM-------------RWDNC
A0A346RRN1_BCL2L1-      D------------------------RLRKNGL-------------QWENC
A0A3Q4MN81_BCL2L10      F------------------------CCTSP-H------------------
A0A3B4ETX9_BCL2L10      F------------------------CCTSP-H------------------
D2IT42_BCL2L10-02       S------------------------CTAST-G------------------
A0A3Q0S9R1_BCL2L10      L------------------------CCTSP-H------------------
I3J363_BCL2L10-01       F------------------------CCTSP-H------------------
A0A3Q2UUN9_BCL2L10      F------------------------CCTSP-H------------------
A0A3P8PVZ8_BCL2L10      F------------------------CCTSP-H------------------
A0A3Q2UUN9_BCL2L10      F------------------------CCTSP-H------------------
A0A3P9BLI0_BCL2L10      F------------------------CCTSP-H------------------
A0A3Q2PJS5_BCL2L10      L------------------------RCSSP-H------------------
A0A3Q2GL87_BCL2L10      L------------------------RCSSP-L------------------
A0A3B5MJ12_BCL2L10      L------------------------RCSSP-H------------------
M4AUW7_BCL2L10-01       L------------------------RCSSP-H------------------
A0A096ME02_BCL2L10      L------------------------RCSSP-H------------------
A0A3B3TYN4_BCL2L10      L------------------------CCSSP-H------------------
A0A3B3YT99_BCL2L10      L------------------------RCSSP-H------------------
A0A3P9NE65_BCL2L10      L------------------------RCSNP-H------------------
A0A3P9IIZ2_BCL2L10      L------------------------SCRSP-L------------------
A0A3P9LM07_BCL2L10      L------------------------SCRSP-L------------------
H2MBQ3_BCL2L10-01       L------------------------SCRSP-L------------------
A0A3B4AAV4_BCL2L10      L------------------------CCSGP-Q------------------
A0A3Q3EZT5_BCL2L10      L------------------------CCTSP-R------------------
A0A3Q3EZT5_BCL2L10      L------------------------CCTSP-R------------------
A0A3Q3JQ78_BCL2L10      L------------------------CCTSS-R------------------
A0A3B4TIY6_BCL2L10      L------------------------CCTSP-Q------------------
A0A3B4WGF4_BCL2L10      L------------------------CCTSP-Q------------------
A0A3Q3KZW1_BCL2L10      L------------------------CCTSP-Q------------------
A0A3B5KD08_BCL2L10      L------------------------CSTSQ-C------------------
A0A3Q3VI28_BCL2L10      L------------------------CCTSQ-R------------------
A0A3Q1GM98_BCL2L10      L------------------------CCAGP-H------------------
A0A3Q1D2L0_BCL2L10      L------------------------CCASP-H------------------
A0A3P8RL82_BCL2L10      L------------------------CCASP-H------------------
A0A3B4ZFS0_BCL2L10      L------------------------CCTSP-H------------------
A0A3B3C5I4_BCL2L10      L------------------------SCRSPVL------------------
A0A3Q1IAB0_BCL2L10      L------------------------CCTSP-W------------------
A0A3P8W7K5_BCL2L10      L------------------------CCSSP-R------------------
H3AAS7_BCL2L2-02        Y------------------------KLGQKGY-----------------S
H3AAS7_BCL2L2-01        Y------------------------KLGQKGY-----------------S
G1Q051_BCL2L2-01        Y------------------------KLRQKGY-----------------V
G3WPT1_BCL2L2-01        Y------------------------KLRQKGY-----------------A
A0A287D9B3_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A482LX62_BCL2L2-      Y------------------------KLRQKGY-----------------V
W5QDH4_BCL2L2-02        Y------------------------KLRQKGY-----------------V
Q7TS60_BCL2L2-01        Y------------------------KLRQKGY-----------------V
G1LMC3_BCL2L2-01        Y------------------------KLRQKGY-----------------V
M3Y5X5_BCL2L2-01        Y------------------------KLRQKGY-----------------V
G1P3J2_BCL2L2-01        Y------------------------KLRQKGY-----------------V
G3WPT1_BCL2L2-02        Y------------------------KLRQKGY-----------------A
G1TV33_BCL2L2-01        Y------------------------KLRQKGY-----------------V
P70345_BCL2L2-01        Y------------------------KLRQKGY-----------------V
O88996_BCL2L2-01        Y------------------------KLRQKGY-----------------V
A0A3Q9B4M8_BCL2L2-      Y------------------------KMRQKGY-----------------V
H0XR82_BCL2L2-01        Y------------------------KLRQKGY-----------------V
A0A250YBR2_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A250YBR2_BCL2L2-      Y------------------------KLRQKGY-----------------V
L8HP19_BCL2L2-02        Y------------------------KLRQKGY-----------------V
L8HP19_BCL2L2-01        Y------------------------KLRQKGY-----------------V
Q1RMX3_BCL2L2-01        Y------------------------KLRQKGY-----------------V
A0A452ECF0_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A286XQQ9_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K5RUN8_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K5MZX9_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A0D9RU30_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K5HEJ9_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A1S3FYD8_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2I2UAE3_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2I2YPX6_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A287D9B3_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K5V0Q3_BCL2L2-      Y------------------------KLRQKGY-----------------V
F7G4L5_BCL2L2-01        Y------------------------KLRQKGY-----------------V
A0A2K6EA59_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K6AI25_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A1U7RC37_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2I3GEA7_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2R9A2Q3_BCL2L2-      Y------------------------KLRQKGY-----------------V
H2Q805_BCL2L2-01        Y------------------------KLRQKGY-----------------V
A0A096NX09_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K6GWM6_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K6ME72_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K6RW35_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K6RW35_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A2K6TM77_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A287ATE4_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A1U7UJF2_BCL2L2-      Y------------------------KLRQKGY-----------------V
A0A452SHI1_BCL2L2-      Y------------------------KLRQKGY-----------------V
Q05KI8_BCL2L2-01        Y------------------------KLRQKGY-----------------V
Q568V1_MCL1-01          QGVQTPTLKTCV-------------EDELDGY-------------IEEEE
Q1L8X3_MCL1-01          QGVQTPTLKTCV-------------EDELDGY-------------IEEEE
Q9I9N3_MCL1-01          QGVQTPTLKTCV-------------EDELDGY-------------TEEEE
A0A286XUI2_BCL2A1-      L------------------------REPAAGC------------------
A0A452U285_BCL2A1-      H------------------------RPSPAGA------------------
A0A452U285_BCL2A1-      H------------------------RPSPAGA------------------
A0A3B3R4U0_MCL1-01      N------------------------GVKQNGFYSFVSA-------SLPVA
F7CP56_BCL2A1-03        E------------------------RIAPDVD-------------TYKEI
Q2TAP5_BCL2L1-01        K------------------------KLSQNEA-------------CRKFS
Q91828_BCL2L1-01        K------------------------KLSQNEA-------------CRKFS
I7GKS6_BCL2L1-01        -------------------------MWKRTGL------------------
A0A2K5EBP4_BCL2L1-      -------------------------MWKRTGL------------------
A0A2K5Q6R6_BCL2L1-      -------------------------MWKRTGL------------------
A0A2K6UWY8_BCL2L1-      -------------------------MWKRTGL------------------
A0A3P8V8T6_MCL1-01      -------------------------DFTTKST-----------------Q
A0A3P8YNB4_BCL2-01      H------------------------KLLKRGY-------------AWDF-
A0A3P8WUE9_BCL2-01      H------------------------KLAKRGY-------------VWEH-
A0A3B4A3G8_BCL2-01      H------------------------KLSKRGF-------------AWGFH
A0A3Q3G1D7_BCL2-01      H------------------------KLSKRGY-------------EWGF-
A0A3Q2XQX2_BCL2-02      H------------------------KLSKRGY-------------AWGF-
A0A3Q2XQX2_BCL2-01      H------------------------KLSKRGY-------------AWGF-
A0A3Q3B0R2_BCL2-01      H------------------------KLSKRGY-------------AWGS-
A0A3Q2PN77_BCL2-01      H------------------------KLSKRGY-------------AWRF-
A0A3P9J8Y9_BCL2-01      H------------------------KLSKRGY-------------VCGL-
A0A3Q0S5Z7_BCL2-01      H------------------------KLSKRGY-------------AWGF-
A0A3P8QVM8_BCL2-01      H------------------------KLSKRGF-------------VWGF-
A0A3P9DIG5_BCL2-01      H------------------------KLSKRGF-------------VWGF-
A0A3Q2UYW8_BCL2-01      H------------------------KLSKRGF-------------VWGF-
A0A3B4G3K4_BCL2-01      H------------------------KLSKRGF-------------VWGF-
A0A2U9BJ09_BCL2-01      H------------------------KLSKRGY-------------VWGF-
A0A3Q1I5N1_BCL2-01      H------------------------KLSKRGY-------------AWGF-
A0A3Q3K1K1_BCL2-01      H------------------------KLSKRGY-------------VWGF-
A0A3Q3MEY1_BCL2-01      H------------------------KLSKRGY-------------VWGF-
A0A1X9JZA1_BCL2-01      H------------------------KLSKQGY-------------EWGF-
A0A4D6FTA2_BCL2-01      H------------------------KLSKQGY-------------VWGF-
A0A3Q1FLK7_BCL2-01      H------------------------KLSKRGY-------------VWGF-
A0A3Q1B8C3_BCL2-01      H------------------------KLSKRGY-------------VWGF-
A0A3P8S9L3_BCL2-01      H------------------------KLSKRGY-------------VWGF-
A0A3B5BBQ0_BCL2-01      H------------------------KLSKRGY-------------AWGF-
A0A3B4TX71_BCL2-01      H------------------------KLSKQGY-------------VWGF-
A0A3B4YAG2_BCL2-01      H------------------------KLSKRGY-------------VWGF-
Q5XGJ4_BCL2L2-01        Y------------------------KLCQRSL------------------
F7G6M3_BCL2L2-01        Y------------------------KLRQKGF------------------
A0A2K5CWY6_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K5CWY6_BCL2L2-      Y------------------------KLRQKGY------------------
G3TMU7_BCL2L2-01        Y------------------------KLRQKGY------------------
G1TW27_BCL2-02          Y------------------------KLSQRGY-------------EWD--
E2RS00_BCL2A1-02        FLWPTPESDEEEGAGPVVHTEIPPASTCRPES-----------------H
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
H9GHK7_BCL2L1-01        Y------------------------KLSQRGH-------------SWHEI
Q07816_BCL2L1-04        Y------------------------KLSQRGH-------------CWSEL
A0A493TIA6_BCL2L1-      Y------------------------KLSQKGY-------------SWSQL
Q07816_BCL2L1-03        Y------------------------KLSQRGH-------------CWSEL
Q07816_BCL2L1-02        Y------------------------KLSQRGH-------------CWSEL
Q07816_BCL2L1-01        Y------------------------KLSQRGH-------------CWSEL
G1N5N5_BCL2L1-01        Y------------------------KLSQKGH-------------CWSEL
A0A452ILL8_BCL2L1-      Y------------------------KLSQRGY-------------SWSRF
A0A452ILL8_BCL2L1-      Y------------------------KLSQRGY-------------SWSRF
K7F655_BCL2L1-01        Y------------------------KLSQRGH-------------SWSWF
A0A452E1B1_BCL2L1-      Y------------------------KFFQKGY-------------SWSQF
W5PSA5_BCL2L1-01        Y------------------------KFFQKGY-------------SWSQF
P53563_BCL2L1-02        Y------------------------KLSQKGY-------------SWSQF
P53563_BCL2L1-03        Y------------------------KLSQKGY-------------SWSQF
A0A287CZ07_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A3Q2H0F6_BCL2L1-      Y------------------------KLSQKGY-------------NWSQF
F6WA14_BCL2L1-01        Y------------------------KLSQKGY-------------NWSQF
G3WKX6_BCL2L1-01        Y------------------------KLSQKGY-------------NWSQF
M3XA94_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
M3XA94_BCL2L1-02        Y------------------------KLSQKGY-------------SWSQF
H0X6V2_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
G3SPN0_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
M3XA94_BCL2L1-03        Y------------------------KLSQKGY-------------SWSQF
G1RER8_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A1S2ZQT6_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
Q64373_BCL2L1-09        Y------------------------KLSQKGY-------------SWSQF
Q64373_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
P53563_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
O77737_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
Q9MYW4_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A3Q2H0F6_BCL2L1-      Y------------------------KLSQKGY-------------NWSQF
L8J061_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
Q05KJ0_BCL2L1-02        Y------------------------KLSQKGY-------------SWSQF
Q05KJ0_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
E2IV76_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A2K6G3C5_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
B2Z3Z4_BCL2L1-01        Y------------------------KFSQKGY-------------SWSQF
G3HEA7_BCL2L1-02        Y------------------------KLSQKGY-------------SWSQF
G3HEA7_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A1U7T4L4_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
M3Z2H9_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A1U7QU73_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A0D9RJZ8_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A286Y5D6_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A250YD48_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A1L5BWY3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
I3MUP5_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
I3MUP5_BCL2L1-02        Y------------------------KLSQKGY-------------SWSQF
I3MUP5_BCL2L1-03        Y------------------------KLSQKGY-------------SWSQF
G1P9D2_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A2K5EBP4_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
E2IV75_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
F7IT34_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
Q76LT7_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A2K5Q6R6_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K5Q6R6_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K5M8B1_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K5H963_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
Q8SQ42_BCL2L1-01        Y------------------------KLSQKGY-------------SWSRF
A0A2K5VPG2_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K5YR37_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2R8Z9D7_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A096NV05_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2J8VIH3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K6QFA2_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K6QFA2_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A2K6UWY8_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
E2IV77_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A452SDS4_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A384D3U1_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A452FWV3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
Q9MZS7_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQF
A0A3B3TCS4_BCL2-01      H------------------------KLLKTGY---VWE-------FQAAG
A0A0U3DHY6_BCL2-01      N------------------------KLLKKGF---VWE-------FQAEN
A0A3P9AAB2_BCL2-01      D------------------------KLLKNGF---VWE-------FQTEN
F6YNL8_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-L
A0A218UQA0_BCL2-01      Y------------------------KLSQRGY---DWA-------AGE--
Q00709_BCL2-01          Y------------------------KLSQRGY---DWA-------AGE--
A0A493T1X3_BCL2-01      Y------------------------KLSQRGY---DWA-------AGE--
U3KEW4_BCL2-01          Y------------------------KLSQRGY---DWA-------AGE--
G3WZW9_BCL2-01          Y------------------------KLSQRGY---EWD-------AGN-L
A0A452R110_BCL2-02      -------------------------------------M-------PET-R
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      -------------------------------------M-------PET-R
M3YYK3_BCL2-01          Y------------------------KLSQRG-------------------
A0A2K6R2I5_BCL2-02      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2R9APW6_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
M3X1R9_BCL2-02          Y------------------------KLSQRGY---EWD-------AGD-A
G3SLZ1_BCL2-01          Y------------------------KLSQRGY---EWE-------AGE-A
Q75SV7_BCL2-01          Y------------------------KLSQRGY---EWD-------AGE-A
M3X1R9_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-A
Q8I008_BCL2-01          Y------------------------ELPQRGY---EWD-------AGD-A
A0A076FU27_BCL2-01      Y------------------------KLSQRGY---EWD-------ARA-A
A0A4P8GLJ2_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-A
F6R2C4_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-A
O02718_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-A
A0A076FZV9_BCL2-01      Y------------------------KLSQRGY---EWD-------AGA-A
A0A452EV13_BCL2-01      Y------------------------KLSQRGY---EWD-------AGA-A
A0A250YD83_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A9QXG9_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K5NZS5_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A0D9S017_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K6CIX3_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K5XRD4_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K6KHG1_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K6R2I5_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K5HK49_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
G3QES9_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-V
H2QEM8_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-V
A0A2I3GZF9_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K6UEL3_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
G3WZW9_BCL2-02          Y------------------------KLSQRGY---D--------------
G3SLZ1_BCL2-02          Y------------------------KLSQRGY---EWE-------AGE-A
A0A452T603_BCL2-01      Y------------------------KLSQRGY---D--------------
H3ANS8_BCL2L1-01        Q------------------------KLMQRGY-------------QWREV
A0A452FHY1_BCL2L1-      Y------------------------KLSQKGF-------------SW---
A0A452FHY1_BCL2L1-      Y------------------------KLSQKGF-------------SW---
A0A1S3EPX7_BCL2L1-      Y------------------------KLSQKGY-------------SWSQF
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQL
H0Z8G3_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQL
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQL
U3JSL7_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQL
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQL
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY-------------SWSQL
Q4U2V6_BCL2L1-01        Y------------------------KLSQKGY-------------SWSQL
X4ZGI8_BCL2-01          H------------------------KLSKKGY---EWK-----------F
A0A3B3E2W4_BCL2L1-      Y------------------------KMSSRDY---PVS-------LLK-P
A0A3B3I2Q5_BCL2L1-      Y------------------------KMSCRDY---PVS-------LLK-P
A0A3P9I2N4_BCL2L1-      Y------------------------KMSCRDY---PVS-------LLK-P
A0A3P9MKK4_BCL2L1-      Y------------------------KMSCRDY---PVS-------LLK-P
A0A3B5B4X7_BCL2L1-      Y------------------------KLSQRNY---PTS-------LLR-P
A0A3B4BFZ8_BCL2L1-      Y------------------------KLSQKNY---PSS-------LLM-S
A0A3Q3FUB6_BCL2L1-      Y------------------------KLSQRNY---PTY-------VLR-S
A0A3B5MGS2_BCL2L1-      Y------------------------KLSQRNY---SSS-------LLR-S
M4A558_BCL2L1-01        Y------------------------KLSQRNY---SSS-------LLR-S
A0A3P9QFB3_BCL2L1-      Y------------------------KLSQRNY---SSS-------LLR-S
A0A087YBW4_BCL2L1-      Y------------------------KLSQRNY---SSS-------LLR-S
A0A3B3VWI7_BCL2L1-      Y------------------------KLSQRNY---SSS-------LLR-S
A0A3B3XN57_BCL2L1-      Y------------------------KLSQRNY---SSS-------LLR-S
A0A3Q2C6K4_BCL2L1-      Y------------------------KLSQTNC---PNS-------LLR-S
A0A3Q2NRP4_BCL2L1-      Y------------------------KLSQTNC---PNS-------LLR-S
A0A0B4KJI5_BCL2L1-      Y------------------------KLSQRNY---PTA-------LLR-P
A0A3Q1JZ46_BCL2L1-      Y------------------------KLSQRNH---PAS-------LLR-P
A0A3Q1JZ46_BCL2L1-      Y------------------------KLSQRNH---PAS-------LLR-P
A0A3Q3NFM4_BCL2L1-      Y------------------------KLSQKNY---PTS-------LLR-P
A0A3Q3NFM4_BCL2L1-      Y------------------------KLSQKNY---PTS-------LLR-P
A0A3B4V9K8_BCL2L1-      Y------------------------KLSQSNC---PTS-------LLR-P
A0A3B4XS24_BCL2L1-      Y------------------------KLSQSNC---PTS-------LLR-P
C1BLI0_BCL2L1-01        Y------------------------KLSQRNY---PIS-------QLG-L
C0HAD8_BCL2L1-01        Y------------------------RLSQRNY---SCC-------QLG-L
A0A3B3ZMX9_BCL2L1-      Y------------------------KLSQRDC---PLG-------LED--
A0A3B5K6B9_BCL2L1-      Y------------------------KLSQRNY---PFN-------HNGLI
A0A3B5K6B9_BCL2L1-      Y------------------------KLSQRNY---PFN-------HNGLI
H3CH49_BCL2L1-01        Y------------------------KLSQRNY---PLS-------H---I
A0A3B3TFR4_BCL2L1-      Y------------------------KLAQKNY---SIA-------HII-Q
A0A3P8XYL5_BCL2L1-      Y------------------------KLSQRNY---PIN-------HTG-L
Q90Z98_BCL2L1-02        Y------------------------KLSQRNY---PCN-------HIG-L
Q90Z98_BCL2L1-01        Y------------------------KLSQRNY---PCN-------HIG-L
A0A059PJI5_BCL2L1-      Y------------------------KLSQKNY---PCD-------HIG-L
A0A3B4DTL9_BCL2L1-      Y------------------------KLSQRNY---PYN-------HIG-L
A0A3Q2FR43_BCL2L1-      F------------------------KLSQRNY---PVN-------HIM-L
B5XAY3_BCL2L1-01        Y------------------------KLSQRDY---PFN-------HME-L
W5MG74_BCL2L1-01        Y------------------------KLSQKNY---SWD-------QFS-L
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY---PLN-------HMG-L
A0A3Q3B3X5_BCL2L1-      Y------------------------KLSQRNY---PVN-------HII-L
A0A3B3IB64_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3P9JYH1_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3B3DHA1_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3Q0RTF8_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
I3IZK7_BCL2L1-01        Y------------------------KLSQRNY---PLN-------HIV-L
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY---PLN-------HMG-L
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY---PLN-------HMG-L
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY---PLN-------HMG-L
A0A0D6DR75_BCL2L1-      Y------------------------KLSEKNY---PLN-------HLG-L
A0A3Q3WIW8_BCL2L1-      Y------------------------KLSHRGC---PLN-------HMG-L
A0A219P0Y3_BCL2L1-      Y------------------------KLTQRNY---PLN-------HMG-L
A0A3Q3MX20_BCL2L1-      Y------------------------KLSQRNY---PLI-------YIE-L
A0A3Q3G2E1_BCL2L1-      Y------------------------KFSQRNY---PLN-------HME-L
A0A3Q3G2E1_BCL2L1-      Y------------------------KFSQRNY---PLN-------HME-L
A0A3Q3G2E1_BCL2L1-      Y------------------------KFSQRNY---PLN-------HME-L
A0A3Q1GZ93_BCL2L1-      Y------------------------KLSQRNY---PLN-------HLG-L
A0A3Q1GZ93_BCL2L1-      Y------------------------KLSQRNY---PLN-------HLG-L
A0A3Q1GZ93_BCL2L1-      Y------------------------KLSQRNY---PLN-------HLG-L
A0A3B4V3T1_BCL2L1-      H------------------------KLSQRNY---PLT-------HME-L
A0A3B4XU17_BCL2L1-      Y------------------------KLSQRNY---PLT-------HME-L
A0A3P9MKK4_BCL2L1-      Y------------------------KMSCRDYPVSLLK-------PTD-D
A0A3B3I2Q5_BCL2L1-      Y------------------------KMSCRDYPVSLLK-------PTD-D
A0A3P9I2N4_BCL2L1-      Y------------------------KMSCRDYPVSLLK-------PTD-D
A0A3B4AFB7_MCL1-01      N------------------------ELLNKNTREEDYE------------
B9ZYL7_BCL2-01          Y------------------------KLSQKGY---AWEEGRQQVSAEH-P
M3Y8D1_BCL2L10-01       Y--------------------------CARG-------------------
A0A3Q2Y539_MCL1-01      VGLVDAL------------------MLPPKAVVQGSMA-------SQL-Q
A0A3Q3BEB7_BCL2L1-      Y------------------------KLSQRNCSKSLLM-------PEV-A
A0A3P8VMA1_BCL2L1-      Y------------------------KLSQRNYPESLLM-------LRI-G
A0A345BSW9_BCL2L1-      Y------------------------KLSQRNYPCNHIG-------LTE-D
A0A286MU87_BCL2L1-      Y------------------------RLSQRNYSCCQLG-------LEG-A
A0A3P8XFS0_BCL2L1-      Y------------------------KLSQRNYSCCELE-------LEG-A
A0A3P8XFS0_BCL2L1-      Y------------------------KLSQRNYSCCELE-------LEG-A
A0A0F7L1T6_BCL2L1-      Y------------------------KLSQRNYPSSLLR-------PED-T
H2U5I3_BCL2L1-01        Y------------------------KLSQRNYPTSLLR-------PED-T
H2U5I3_BCL2L1-02        Y------------------------KLSQRNYPTSLLR-------PED-T
A0A3Q3J5K3_BCL2L1-      Y------------------------KLSQRNYSTSLLR-------PEN-A
A0A3Q1EVP6_BCL2L1-      Y------------------------KLSQRNYPMSLLR-------PED-A
A0A3Q1BQA0_BCL2L1-      D------------------------KLSQRNYPTSLLR-------PED-A
A0A3P8U812_BCL2L1-      Y------------------------KLSQRNYPTSLLR-------PED-A
E6ZFR0_BCL2L1-01        Y------------------------KLSQRNHPTSLLR-------PEN-A
G3P7B4_BCL2L1-01        Y------------------------KLSQKNHPTSLLR-------PED-A
A0A3Q3X5M5_BCL2L1-      Y------------------------KLTQKNYPTSLLR-------PED-T
A0A2U9BIG9_BCL2L1-      Y------------------------KLSQRNYPTSLLR-------PED-A
D2ITA2_BCL2L1-02        H------------------------KLSQRNYRPIPFQ-------PEG-A
A0A3B3ZMX9_BCL2L1-      Y------------------------KLSQRDC---PLQ-------HLG-L
G3NJY1_BCL2L1-01        Y------------------------KLSQRNL---PLN-------HIG-L
A0A2U9BY16_BCL2L1-      FGFHPQSLLWISADHGCLNRGKQGDSLAQRAF---TLT------------
A0A3Q3DUT7_BCL2L1-      Y------------------------KLSQKNY---PLN-------HIG-L
A0A3Q3DUT7_BCL2L1-      Y------------------------KLSQKNY---PLN-------HIG-L
A0A3Q3DUT7_BCL2L1-      Y------------------------KLSQKNY---PLN-------HIG-L
A0A3B1JJ42_BCL2L1-      Y------------------------KLSQRNY---PTN-------HIG-L
A0A3P8UWG7_BCL2L1-      Y------------------------KLSQRNF---PVH-------HLG-L
A0A3Q3IVF5_BCL2L1-      Y------------------------KLSQKNY---PLS-------HLG-L
A0A3Q1DHJ3_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3Q1DHJ3_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3Q1DHJ3_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3P8TL99_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3P8TL99_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3Q1FR00_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3B4Z3X2_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
A0A3B4Z3X2_BCL2L1-      Y------------------------KLSQRNY---PLN-------HMV-L
C3VIT1_BCL2L1-01        Y------------------------KLSQRNY---PLN-------HIV-L
A0A3P8P0F1_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3Q2X557_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3P9D632_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3P9D632_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3Q4N4B5_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3B4FNX1_BCL2L1-      Y------------------------KLSQRNY---PLN-------HIV-L
A0A3Q2QPL9_BCL2L1-      F------------------------KLSQRNY---PVN-------HIM-L
A0A3B5PQJ0_BCL2L1-      F------------------------KLSQRNY---PIQ-------HIL-P
A0A087X9B7_BCL2L1-      F------------------------KLSQRNY---PIQ-------HIL-P
A0A3B3TUS7_BCL2L1-      F------------------------KLSQRNY---PIQ-------HIL-P
A0A3B3WI27_BCL2L1-      F------------------------KLSQRNY---PIQ-------HIL-P
A0A3P9N9Y4_BCL2L1-      F------------------------KLSQRNY---PIQ-------HIL-P
A0A3B3QRZ2_BCL2L1-      Y------------------------KLSQRNY---N----------GH-F
Q564A4_BCL2-01          H------------------------KLSKRGY---VWK-------CQ---
H9GPE7_BCL2-01          Y------------------------KLSQKGY---DWV-------ASG-D
A0A452I9V7_BCL2-01      Y------------------------KLSQRGY---DWA-------ANE-N
W5N4F7_BCL2-01          H------------------------KLLKKGY---VWE-------SRV-S
K7F5Y3_BCL2-02          Y------------------------KLSQRGY---DWA-------ANE--
A0A3Q2HRY3_BCL2-02      Y------------------------KLSQRGY---EWD-------AGD-A
H0YUX3_BCL2-01          Y------------------------KLSQRGY---DWA-------AGE-D
K7F5Y3_BCL2-01          Y------------------------KLSQRGY---DWA-------ANE--
F1LNV0_BCL2-01          Y------------------------KLSQRGY---EWD-------TGD-E
P49950_BCL2-01          Y------------------------KLSQRGY---EWD-------TGD-E
G1TW27_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-A
A0A2K5EB04_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
A0A2R8MY14_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
H2NWH5_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-V
A0A096MPU7_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD--
A0A2K5PP81_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
H0WKI0_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-V
A0A2K5UDI5_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-V
P10417_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-A
Q7TSN8_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-A
A0A3Q2HRY3_BCL2-01      Y------------------------KLSQRGY---EWD-------AGD-A
E2QWA1_BCL2-02          Y------------------------KLSQRGY---EWD-------AGE-A
A0A2K6G3I7_BCL2-01      Y------------------------KLAQRGY---EWD-------AGD-A
Q6R755_BCL2-01          Y------------------------KLSQRGY---EWD-------VGD-V
Q9JJV8_BCL2-01          Y------------------------KLSQRGY---EWD-------VGD-V
Q923R6_BCL2-01          Y------------------------KLSQRGY---EWD-------VGD-V
H0W1T3_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-G
G1LIC9_BCL2-02          Y------------------------KLSQRGY---EWD-------AGD-A
I3MVK9_BCL2-01          Y------------------------KLSQRGY---EWD-------AGD-V
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      ARRTRATRTENTLARNMSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPNR
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          ------------------PSPQSELDEDEDYMDVQSDSRG----------
G1PZ39_MCL1-01          GGCLRPLAVRGCPRRWKAAAADAIMSPEEELDGYEPEPLG----------
Q9Z1P3_MCL1-01          RLLKSPGLLAVPPEEMAASAA-AIMSPEEELDGCEPEVLS----------
A5PJR2_MCL1-01          LLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLG----------
A0A452GA25_MCL1-01      LLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLG----------
G1L3L7_MCL1-01          LLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
G1T2Q0_MCL1-01          LLYLAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLA----------
F7AVA6_MCL1-01          LLFFAPTRCASPPEGMEAPAADAIMSPEEELDGYEPEPLG----------
A0A337S3J9_MCL1-01      LLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLG----------
A0A337S3J9_MCL1-03      LLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLG----------
Q7YRZ9_MCL1-01          LLFFAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
F1PAP1_MCL1-01          LLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
Q8HYS5_MCL1-01          LLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
M3XZZ5_MCL1-01          LLFFEPTHRASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
A0A452RHX5_MCL1-01      LLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
H0XFB7_MCL1-01          LLFFAPTLRAAPREEMEAPAADAIMSPEDELDGYEPEPLG----------
F7GTF7_MCL1-01          LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5CFH3_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K6V5Y3_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEDELDGYEPEPLG----------
A0A2K6KRW9_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5XSB2_MCL1-01      LFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A0D9RZP5_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
I7G687_MCL1-01          LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5LXU8_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2I3GJZ3_MCL1-02      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
H2N5Y9_MCL1-01          LFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2R9BPJ5_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2I3RTV4_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2I2YQH7_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5C7L5_MCL1-01      CWFFAPTRRAAPLEEMEAPAADAIMSPEEELDRYEPEPLG----------
A0A2K5I9I0_MCL1-02      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K6GI15_MCL1-01      LLFFAPTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLG----------
A0A2I3GJZ3_MCL1-01      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5CFH3_MCL1-03      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5R5E2_MCL1-03      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K5W0W9_MCL1-01      LLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K6ECR0_MCL1-02      LLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2I3LFM0_MCL1-01      PLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K6KRW9_MCL1-02      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A2K6PPI3_MCL1-02      LLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLG----------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          PFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG----------
W5QI41_MCL1-01          ----------GSRKPRPAPGPAPALTPPVRCRAQPPEAFAAFPIYGMQIK
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          KRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASA----------
B4DG83_MCL1-01          ---------------MEAPAADAIMSPEEELDGYEPEPLG----------
B4E3L8_MCL1-01          ---------------MEAPAADAIMSPEEELDGYEPEPLG----------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        PRLPDFRPGVTGQPTRRRSAWKPSAGPWESGRSKPTPESD----------
B6V6J0_MCL1-01          ---------------------------DPDMDTHRPQLNG----------
G3PJT0_MCL1-01          -------------------------------------NSA----------
H0XHA5_MCL1-01          -----------LPDQMEAQVADAVKSPEGEVASCEPEPLK----------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          WLFSPISRNC--PEELGALAADAIMSPGEELGRYEPEP------------
H9GEA6_MCL1-02          SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEE----------
H9GEA6_MCL1-01          SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEE----------
A0A493U0E8_MCL1-01      ----------------SEASPWG-WGGTDHFGAVFPEPSS----------
A0A1L1RNM6_MCL1-01      ----------------STSRPVALWSPEEELDGCEPESER----------
A0A1L1RNM6_MCL1-02      ----------------STSRPVALWSPEEELDGCEPESER----------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          SLF-APGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPG----------
F6ZMX1_MCL1-03          SLF-APGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPG----------
F6ZMX1_MCL1-02          SLF-APGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPG----------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      ------------------------MSPEEELDGYEPEPLG----------
B4DU51_MCL1-01          RLL---------ATEMEAPAADAIMSPEEELDGYEPEPLG----------
A0A287DCH9_MCL1-02      RLFFAPTYCVSPPEKMEAPAAA--MSPEEELDGYEPEPLG----------
P97287_MCL1-01          RLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIG----------
A0A452GA25_MCL1-02      LLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLG----------
A0A287DCH9_MCL1-01      RLFFAPTYCVSPPEKMEAPA--AAMSPEEELDGYEPEPLG----------
G3T756_MCL1-01          PTFFAPTRRASPPVEMEALAADAIMSPEEELDGYEPEPLG----------
A0A1S3F3I1_MCL1-01      RVFFAPTHRAPTPDEMEAAAAGAIMSPEEELDGYEPEPLG----------
G1L3L7_MCL1-02          LLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLG----------
A0A287BK44_MCL1-01      LLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLG----------
A0A287BK44_MCL1-02      LLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLG----------
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
W5MMB7_MCL1-01          SAARTAVLDPMLKADYAEDELDNYSAEPVATSAWIPKSPRSLPAGLKLG-
A0A3B3SG34_MCL1-01      ANTPCLESSGLWDDELDNCTD----EVDV------CPCSTRLAKRDSEK-
Q4SW32_MCL1-01          ----QIPMGSPRDAFNGN-------VGDS------PKRPSKLTVVKPKV-
D2ITA0_MCL1-03          ALPLMATFKS---------------GDER------KPRPTELG----RG-
D2ITA0_MCL1-04          ALPLMATFKS---------------GDER------KPRPTELG----RG-
A0A3P9ILF6_MCL1-01      EMSARVPLPSTLASRVANPD-----PSDQ------FKRPQDLEYSARRF-
A0A3P9ILF6_MCL1-02      EMSARVPLPSTLASRVANPD-----PSDQ------FKRPQDLEYSARRF-
Q0KFR9_MCL1-01          AICAGASPKSK--VDLGNG------TGDT------PPRPTTLGVNVVKS-
A0A3P8Y1W8_MCL1-02      PLCPAASSKSKMDVDLGNG------TADT------PVRPTKLEVNMTKP-
A0A3P8Y1W8_MCL1-01      PLCPAASSKSKMDVDLGNG------TADT------PVRPTKLEVNMTKP-
A0A3Q2XZL8_MCL1-01      PVAAASTSPPQLHRAVATLGAVNCNSGAA------KPRPSALEILCKGG-
A0A3B4AFB7_MCL1-02      DSSAQMPRPATMDTRKGNTA-----SSGS------P-HPRPTALVMKNE-
A0A3B3VM25_MCL1-01      LVVPEVAMGATVDSLHSP-------KDPY------KQRPTNLAVTASNG-
A0A3Q0R633_MCL1-01      ---------TSPDS------------NGT------PKRPNNLGVVSTNG-
A0A3Q0R633_MCL1-03      NSSPQDATGTPKDS------------NGT------PKRPNNLGVVSTNG-
A0A3B4T8L9_MCL1-02      DSSPEIAIGSTICSHNGNVV-----PNDN------SKRPKSLEVTSTNG-
A0A3B4T8L9_MCL1-01      DSSPEIAIGSTICSHNGNVV-----PNDN------SKRPKSLEVTSTNG-
A0A3Q1EQB9_MCL1-02      DSSPQISVASSIDPQNGNLG-----SSDT------PKRPKNLGV---NG-
A0A3B4ZKP6_MCL1-01      DPSAQIPMASPLDSHNGNVG-----SGAT------PKRPKNLGVSTTNG-
A0A3Q1BKL8_MCL1-02      DSSPQIAVASSIDSHNGNVG-----SNET------PKRPKNLGV---NG-
A0A3Q1EQB9_MCL1-01      DSSPQISVASSIDPQNGNLG-----SSDT------PKRPKNLGV---NG-
A0A3Q1BKL8_MCL1-01      DSSPQIAVASSIDSHNGNVG-----SNET------PKRPKNLGV---NG-
A0A3P8RQX7_MCL1-01      DSSPQIAVASSIDSHNGNVG-----SSET------PKRPKNLGV---NG-
A0A3P8RQX7_MCL1-02      DSSPQIAVASSIDSHNGNVG-----SSET------PKRPKNLGV---NG-
A0A3Q3VP02_MCL1-01      --SSQIGMGSCLDSHNGNVAL-----NDT------SKRPNLLVVNPTKE-
A0A3B5K5B3_MCL1-01      --SSPL----IPMASRGSLSG-----NDS------PKRPSKLSVIAPKV-
A0A3B3IJ04_MCL1-01      EMSARVPLPSTLASHVANPDP-----SDQ------LKRPQDLE-------
A0A3P9L1F3_MCL1-01      EMSARVPLPSTLASRVANPDP-----SDQ------LKRPQDLE-------
A0A3B3IJ04_MCL1-02      EMSARVPLPSTLASHVANPDP-----SDQ------LKRPQDLE-------
A0A3P9L1F3_MCL1-02      EMSARVPLPSTLASRVANPDP-----SDQ------LKRPQDLE-------
A0A3B3CEX1_MCL1-02      ERSARVPLTSATASRGANPDP-----SEQ------MKRPQDLDMLGNKSP
A0A3B3CEX1_MCL1-01      ERSARVPLTSATASRGANPDP-----SEQ------MKRPQDLDMLGNKSP
A0A3Q3B4P5_MCL1-01      DTSPQVSIGASLGSENGSVAS-----CNS------SKRPKDLVMPPLKG-
A0A3Q3B4P5_MCL1-02      DTSPQVSIGASLGSENGSVAS-----CNS------SKRPKDLVMPPLKG-
A0A3Q2EDX8_MCL1-01      IAAPEIPMNSPMGSLHRN----------L------MKRPKDLQV-ATNG-
A0A3Q2P7X9_MCL1-01      LQLPEVEMSSSSEDLRWDC-------S---------KRPKNLRVMARNG-
A0A3Q2P7X9_MCL1-02      LQLPEVEMSSSSEDLRWDC-------S---------KRPKNLRVMARNG-
A0A3B5PQ55_MCL1-02      LGVPEVAMGSTVESLHSPK-------DPF------MKRPTNLGV---NG-
A0A3B5PQ55_MCL1-01      LGVPEVAMGSTVESLHSPK-------DPF------MKRPTNLGV---NG-
A0A3P9Q4I8_MCL1-02      LVVPEVAMGSRVESLHSPM-------DPF------KKRPTNLAVTASNG-
A0A3P9Q4I8_MCL1-01      LVVPEVAMGSRVESLHSPM-------DPF------KKRPTNLAVTASNG-
A0A087X830_MCL1-01      LVVPEVAMGATVDSLHSPK-------DPY------KKRPTNLAVSASNG-
A0A3B3YCD0_MCL1-01      LVVPEVAMGATVDSLHSPK-------DPY------KQRPTNLAVTASNG-
I3JHR5_MCL1-01          KSSPQNATGSSKDSSNGIVS------NGT------PKRPNNLGVTSTNG-
A0A3Q4HLQ8_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGT------PKRPDNLEVTSTNG-
A0A3P8NP63_MCL1-02      NSSPQNATGSSKDSSNGIVS------NGT------PKRPDNLEVTSTNG-
A0A3Q2VNL8_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGT------PKRPDNLEVTSTNG-
A0A3P8NP63_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGT------PKRPDNLEVTSTNG-
A0A3P9BVM3_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGT------PKRPDNLEVTSTNG-
A0A3B4G4Z6_MCL1-01      NSSPQNATGSSKDSSNGIVS------NGT------PKRPDNLEVTSTNG-
A0A2U9CJ81_MCL1-01      NSLPQIAVGSVIDSRGGNVGA-----GDA------PKRPKNLQVSATKA-
A0A3P8VKM5_MCL1-05      NSTP-IALASSLSTHNDSMSS----VTET------QRRPKDLQVNTANG-
A0A3P8VKM5_MCL1-04      NSTP-IALASSLSTHNDSMSS----VTET------QRRPKDLQVNTANG-
A0A3P8VKM5_MCL1-03      NSTP-IALASSLSTHNDSMSS----VTET------QRRPKDLQVNTANG-
A0A3Q3IZW0_MCL1-01      NTSPQFAVGSSIDSCKGNVGP-----NNT------LKRPKILDVSSTNG-
A0A3Q1GX28_MCL1-02      VNSPQITMSSSIDACNGN---------AA------LKRPKNLDVSSSNG-
A0A3Q1GX28_MCL1-01      VNSPQITMSSSIDACNGN---------AA------LKRPKNLDVSSSNG-
A0A3B4XKA5_MCL1-01      DSSPEIAIGSTLCCDNGNVVP-----NDN------SKRPKSLEVTSTNG-
A0A3Q3GP42_MCL1-01      ASSPQIAMGSSLASQNGNVGS-----NET------TKRPKALVVNSGN--
A0A3Q3M6G2_MCL1-01      DPSTQF----TLDSRNGN-GG-----TAN------PKRPKNLEVSSTNG-
A0A3Q3M6G2_MCL1-02      DPSTQF----TLDSRNGN-GG-----TAN------PKRPKNLEVSSTNG-
A0A3B1IEV7_MCL1-01      EKLPRTERPERGLEG-----------------------------------
A0A3B4CGU9_MCL1-03      SQLDRPDRPDRGLEG-----------------------------------
A0A3B4CGU9_MCL1-02      GSICAPVLHGSSFGGPVTL-------------------------------
Q8UWD6_MCL1-01          GFWPC-------TGLQSKP-------------------------------
A2BF68_MCL1-01          GFWPC-------TGLQSKP-------------------------------
Q568W5_MCL1-01          GFWPC-------TGLQSKP-------------------------------
A0A3B1K5R1_MCL1-01      DIVPRVAVRGGGGGAGLSL-------------------------------
A0A3B4C6H5_MCL1-01      FLWEK---------------------------------------------
A0A3B4C6H5_MCL1-03      SLLAKRPFTLGISSQTRAP-------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
R4JQR8_BCL2L1-01        PTLDL---------------------------------------------
A0A346RRN1_BCL2L1-      PSLEV---------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        QQGAP---------------------------------------------
H3AAS7_BCL2L2-01        QQGAP---------------------------------------------
G1Q051_BCL2L2-01        CGAGP---------------------------------------------
G3WPT1_BCL2L2-01        CGTGP---------------------------------------------
A0A287D9B3_BCL2L2-      CGAGP---------------------------------------------
A0A482LX62_BCL2L2-      CGAGP---------------------------------------------
W5QDH4_BCL2L2-02        CGAGP---------------------------------------------
Q7TS60_BCL2L2-01        CGAGP---------------------------------------------
G1LMC3_BCL2L2-01        CGAGP---------------------------------------------
M3Y5X5_BCL2L2-01        CGAGP---------------------------------------------
G1P3J2_BCL2L2-01        CGAGP---------------------------------------------
G3WPT1_BCL2L2-02        CGTGP---------------------------------------------
G1TV33_BCL2L2-01        CGAGP---------------------------------------------
P70345_BCL2L2-01        CGAGP---------------------------------------------
O88996_BCL2L2-01        CGAGP---------------------------------------------
A0A3Q9B4M8_BCL2L2-      CGAGP---------------------------------------------
H0XR82_BCL2L2-01        CGAGP---------------------------------------------
A0A250YBR2_BCL2L2-      CGAGP---------------------------------------------
A0A250YBR2_BCL2L2-      CGAGP---------------------------------------------
L8HP19_BCL2L2-02        CGAGP---------------------------------------------
L8HP19_BCL2L2-01        CGAGP---------------------------------------------
Q1RMX3_BCL2L2-01        CGAGP---------------------------------------------
A0A452ECF0_BCL2L2-      CGAGP---------------------------------------------
A0A286XQQ9_BCL2L2-      CGAGP---------------------------------------------
A0A2K5RUN8_BCL2L2-      CGAGP---------------------------------------------
A0A2K5MZX9_BCL2L2-      CGAGP---------------------------------------------
A0A0D9RU30_BCL2L2-      CGAGP---------------------------------------------
A0A2K5HEJ9_BCL2L2-      CGAGP---------------------------------------------
A0A1S3FYD8_BCL2L2-      CGAGP---------------------------------------------
A0A2I2UAE3_BCL2L2-      CGAGP---------------------------------------------
A0A2I2YPX6_BCL2L2-      CGAGP---------------------------------------------
A0A287D9B3_BCL2L2-      CGAGP---------------------------------------------
A0A2K5V0Q3_BCL2L2-      CGAGP---------------------------------------------
F7G4L5_BCL2L2-01        CGAGP---------------------------------------------
A0A2K6EA59_BCL2L2-      CGAGP---------------------------------------------
A0A2K6AI25_BCL2L2-      CGAGP---------------------------------------------
A0A1U7RC37_BCL2L2-      CGAGP---------------------------------------------
A0A2I3GEA7_BCL2L2-      CGAGP---------------------------------------------
A0A2R9A2Q3_BCL2L2-      CGAGP---------------------------------------------
H2Q805_BCL2L2-01        CGAGP---------------------------------------------
A0A096NX09_BCL2L2-      CGAGP---------------------------------------------
A0A2K6GWM6_BCL2L2-      CGAGP---------------------------------------------
A0A2K6ME72_BCL2L2-      CGAGP---------------------------------------------
A0A2K6RW35_BCL2L2-      CGAGP---------------------------------------------
A0A2K6RW35_BCL2L2-      CGAGP---------------------------------------------
A0A2K6TM77_BCL2L2-      CGAGP---------------------------------------------
A0A287ATE4_BCL2L2-      CGAGP---------------------------------------------
A0A1U7UJF2_BCL2L2-      CGAGP---------------------------------------------
A0A452SHI1_BCL2L2-      CGAGP---------------------------------------------
Q05KI8_BCL2L2-01        CGAGP---------------------------------------------
Q568V1_MCL1-01          APLKRLRPGTNGLKGLQLDGRFVSTTDGS---------------------
Q1L8X3_MCL1-01          APLKRLRPGTNGLKGLQLDGRFVSATDGS---------------------
Q9I9N3_MCL1-01          APLKRLRPGTNGLKGLQLDGRFVSATDGS---------------------
A0A286XUI2_BCL2A1-      --------------CL----------------------------------
A0A452U285_BCL2A1-      --------------RLIWPXXXXXXXXXX---------------------
A0A452U285_BCL2A1-      --------------RLIWPXXXXXXXXXX---------------------
A0A3B3R4U0_MCL1-01      PLKAKSEEELDSLDEGERFHGAPKTERRD---------------------
F7CP56_BCL2A1-03        SYFVAEFITKNTGEWIRQNGGWVIAHSQY---------------------
Q2TAP5_BCL2L1-01        NNPQPNAISNGTSTSERPGEGATQGIVEE---------------------
Q91828_BCL2L1-01        NNPNPMPYLMEPSTSERPGEGATQGIVEE---------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3P8V8T6_MCL1-01      RLVES---------------------------------------------
A0A3P8YNB4_BCL2-01      -EDAE--EEDGANNGSMISPPPGLVRRIH---------------------
A0A3P8WUE9_BCL2-01      -DEDR--DGDAANNGSIVSRPPTLVHRCR---------------------
A0A3B4A3G8_BCL2-01      EDAED--EGDVANNGSIVASSPVLVNRRC---------------------
A0A3Q3G1D7_BCL2-01      -EDEQ--DEDAANNGSLVAPPPTLVRRCR---------------------
A0A3Q2XQX2_BCL2-02      -GAGE--ED-----------------------------------------
A0A3Q2XQX2_BCL2-01      -GAED--DAAAANNGLLVAPSPTLVLRCR---------------------
A0A3Q3B0R2_BCL2-01      -DRPRRVRDDAANNGSVASQSPTLVRRCR---------------------
A0A3Q2PN77_BCL2-01      -DGVR--DDDAAANGGLGDRSPTLVRRCR---------------------
A0A3P9J8Y9_BCL2-01      -NGGQ--RENAANNGSVGDHSPTPVRRRC---------------------
A0A3Q0S5Z7_BCL2-01      -DGVQ--DEDAANNGSINDPPPTLVRRCR---------------------
A0A3P8QVM8_BCL2-01      -RVVQ--EEDAANNGSITDPPPTLVHRCR---------------------
A0A3P9DIG5_BCL2-01      -RVVQ--EEDAANNGSITDPPPTLVHRCR---------------------
A0A3Q2UYW8_BCL2-01      -RVVQ--EEDAANNGSITDPPPTLVHRCR---------------------
A0A3B4G3K4_BCL2-01      -RVVQ--EEDAANNGSITDPPPTLVHRCR---------------------
A0A2U9BJ09_BCL2-01      -DDVR--DEDAADNGSIVAPPPTLVRRCH---------------------
A0A3Q1I5N1_BCL2-01      -HDAQ--DEDAANNGSAVPPPPTLVRRCR---------------------
A0A3Q3K1K1_BCL2-01      -HDVQ--DEDAANNGSIVAPPPTLVRRCR---------------------
A0A3Q3MEY1_BCL2-01      -HNVQ--DEDAANNGSVVAPPPTVVRRCR---------------------
A0A1X9JZA1_BCL2-01      -DAVR--NADAGNNGSIVAPPPSLVRRCR---------------------
A0A4D6FTA2_BCL2-01      -DDVR--DEDAANNGSIVAPPPTLVRRCR---------------------
A0A3Q1FLK7_BCL2-01      -DDVR--DEDAANNGSVVDPPPTLVRRCH---------------------
A0A3Q1B8C3_BCL2-01      -DDVR--DEDAANNGSVVDPPPTLVRRCH---------------------
A0A3P8S9L3_BCL2-01      -DDVR--DEDAANNGSVVDPPPTLVRRCH---------------------
A0A3B5BBQ0_BCL2-01      -DDVR--DEDAANNGSVVDPPPTLVRRCH---------------------
A0A3B4TX71_BCL2-01      -DDVR--DEDAANNGSIVAPPPTLVRRCR---------------------
A0A3B4YAG2_BCL2-01      -DDVR--DEDAANNGSIVAPPPTLVRRCR---------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
G1TW27_BCL2-02          -------------AGDAGAASAPGVFSSQ---------------------
E2RS00_BCL2A1-02        PEPRQ--PRPHRASGSSRGTRLPSRRAGG---------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      S----------------VRYGNPQWISGN---------------------
H9GHK7_BCL2L1-01        E-------MESGEEAMEPANETGNTLNGS---------------------
Q07816_BCL2L1-04        EEEDE--NRTD----TAAEAEMDSVLNGS---------------------
A0A493TIA6_BCL2L1-      EEEDE--NRTELAS----EA--AAVLNGS---------------------
Q07816_BCL2L1-03        EEEDE--NRTDTAA----EAEMDSVLNGS---------------------
Q07816_BCL2L1-02        EEEDE--NRTDTAA----EAEMDSVLNGS---------------------
Q07816_BCL2L1-01        EEEDE--NRTDTAA----EAEMDSVLNGS---------------------
G1N5N5_BCL2L1-01        EEEDE--NRTDTAA----EAEMDSVLNGS---------------------
A0A452ILL8_BCL2L1-      EGEDE--IRTDSAE----EAEMASVPNGS---------------------
A0A452ILL8_BCL2L1-      EGEDE--IRTDSAE----EAEMASVPNGS---------------------
K7F655_BCL2L1-01        EGEDE--IRTEAAE----EAEMASVPNGS---------------------
A0A452E1B1_BCL2L1-      SDMEE--NRTETLEGTESDMETPSAISGN---------------------
W5PSA5_BCL2L1-01        SDMEE--NRTETLEGTESDMETPSAISGN---------------------
P53563_BCL2L1-02        SDVEE--NRTEAPEETEPERETPSAINGN---------------------
P53563_BCL2L1-03        SDVEE--NRTEAPEETEPERETPSAINGN---------------------
A0A287CZ07_BCL2L1-      SDVEE--NRTEAPEGTESEVETPSAINGN---------------------
A0A3Q2H0F6_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
F6WA14_BCL2L1-01        ED--E--NRTEVLEGA----EIPSTVNGS---------------------
G3WKX6_BCL2L1-01        ED--E--NRTEASEGT----EIPSTVNGS---------------------
M3XA94_BCL2L1-01        SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
M3XA94_BCL2L1-02        SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
H0X6V2_BCL2L1-01        SDVEE--NRTEAPEGNESELETPSAINGN---------------------
G3SPN0_BCL2L1-01        SDVEE--NRTGASEGTESEMEIPSAINGN---------------------
Q2PFS6_BCL2L1-01        -------------------METPSAINGN---------------------
O35843_BCL2L1-01        SDVEE--NRTEAPEETEAERETPSAINGN---------------------
M3XA94_BCL2L1-03        SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
G1RER8_BCL2L1-01        SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A1S2ZQT6_BCL2L1-      SDVEE--NRTEASEGTESEMETPSAINGN---------------------
Q64373_BCL2L1-09        SDVEE--NRTEAPEETEAERETPSAINGN---------------------
Q64373_BCL2L1-01        SDVEE--NRTEAPEETEAERETPSAINGN---------------------
P53563_BCL2L1-01        SDVEE--NRTEAPEETEPERETPSAINGN---------------------
O77737_BCL2L1-01        TDVEE--NRTEAPEGTESEAETPSAINGN---------------------
Q9MYW4_BCL2L1-01        SDVEE--NRTEAPEGTGPEMETPSAINGN---------------------
A0A3Q2H0F6_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
L8J061_BCL2L1-01        SDVEE--NRTEAPEGTESDMETPSAINGN---------------------
Q05KJ0_BCL2L1-02        SDVEE--NRTEAPEGTESDMETPSAINGN---------------------
Q05KJ0_BCL2L1-01        SDVEE--NRTEAPEGTESDMETPSAINGN---------------------
E2IV76_BCL2L1-01        IDAEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K6G3C5_BCL2L1-      IDAEE--NRTEAPEATESEMETPSAINGN---------------------
B2Z3Z4_BCL2L1-01        SDVEE--NRTEAPEGTESERETPSAINGN---------------------
G3HEA7_BCL2L1-02        SDVEE--NRTEAPEGTESERETPSAINGN---------------------
G3HEA7_BCL2L1-01        SDVEE--NRTEAPEGTESERETPSAINGN---------------------
A0A1U7T4L4_BCL2L1-      SDVEE--NRTEASEGTESEMETPSAVNGN---------------------
M3Z2H9_BCL2L1-01        SDAEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A1U7QU73_BCL2L1-      SDVEE--NRTEAPEGAESERETPSAINGN---------------------
A0A0D9RJZ8_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A286Y5D6_BCL2L1-      SDVEE--NRTEGPEGTESEMETPSAINGN---------------------
A0A250YD48_BCL2L1-      SDVEE--NRTEAPEGIESEVETPSAINGN---------------------
A0A1L5BWY3_BCL2L1-      SDVEE--NRTEAPEGIESEVETPSAINGN---------------------
I3MUP5_BCL2L1-01        SDVEE--NRTEAPEGTESEVETPSAINGN---------------------
I3MUP5_BCL2L1-02        SDVEE--NRTEAPEGTESEVETPSAINGN---------------------
I3MUP5_BCL2L1-03        SDVEE--NRTEAPEGTESEVETPSAINGN---------------------
G1P9D2_BCL2L1-01        SDVEE--NRTEAPEGTESEVETPSAINGN---------------------
A0A2K5EBP4_BCL2L1-      SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
E2IV75_BCL2L1-01        SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
F7IT34_BCL2L1-01        SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
Q76LT7_BCL2L1-01        SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K5Q6R6_BCL2L1-      SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
A0A2K5Q6R6_BCL2L1-      SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
A0A2K5M8B1_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K5H963_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
Q8SQ42_BCL2L1-01        SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K5VPG2_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K5YR37_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2R8Z9D7_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A096NV05_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2J8VIH3_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K6QFA2_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K6QFA2_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A2K6UWY8_BCL2L1-      SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
E2IV77_BCL2L1-01        SDVEE--NRTEAPEGTDSEMETPSAINGN---------------------
A0A452SDS4_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A384D3U1_BCL2L1-      SDVEE--NRTEAPEGTESEMETPSAINGN---------------------
A0A452FWV3_BCL2L1-      SDVEE--NRTEAPEGTESDMETPSAINGN---------------------
Q9MZS7_BCL2L1-01        SDVEE--NRTEAPEGTESDMETPSAINGN---------------------
A0A3B3TCS4_BCL2-01      DTDSP--NNGSVDSPPGSQVLARRSQAAA---------------------
A0A0U3DHY6_BCL2-01      DSPNN--LFGDPSTPNTPEVFARRSQPTA---------------------
A0A3P9AAB2_BCL2-01      QSRNN--VFEDPSPPNSPELFARRLQPPA---------------------
F6YNL8_BCL2-01          RAPAS--PSLPPVVASAPAVGIFSTQPRN---------------------
A0A218UQA0_BCL2-01      --------------DRVSLPPDHSASAAA---------------------
Q00709_BCL2-01          --------------DRPPVPPAPAPAAAP---------------------
A0A493T1X3_BCL2-01      --------------DRAPAPTALAPAAAA---------------------
U3KEW4_BCL2-01          --------------HRAPLPPGLSAPAAA---------------------
G3WZW9_BCL2-01          RTPAS--PSLPPVVASAPAVGIFSNQPRH---------------------
A0A452R110_BCL2-02      APRPR---------GPPPRRASSPPSLGS---------------------
E2QWA1_BCL2-01          -------------------PFQFGGCPVS---------------------
G1LIC9_BCL2-01          ------------------------PHPAA---------------------
A0A452R110_BCL2-01      APRPR---------GPPPRRASSPPSLGS---------------------
M3YYK3_BCL2-01          ----------------RPVMKLVYLPTAP---------------------
A0A2K6R2I5_BCL2-02      GAATP---------GAAPAPGIFSSQPGH---------------------
A0A2R9APW6_BCL2-01      GAAP----------------------------------------------
M3X1R9_BCL2-02          GAAPP---------GAAPAPGIFSSQPGR---------------------
G3SLZ1_BCL2-01          SAAPP---------GAAPAPGVLSSPPAA---------------------
Q75SV7_BCL2-01          GAAPP---------GAAPAPGIFSSQPGR---------------------
M3X1R9_BCL2-01          GAAPP---------GAAPAPGIFSSQPGR---------------------
Q8I008_BCL2-01          GAAPP---------GAAPAPGIFSSQPGR---------------------
A0A076FU27_BCL2-01      GAAPP---------GAAPAPGILSSQPGR---------------------
A0A4P8GLJ2_BCL2-01      GAAPP---------GAAPAPGILSSQPGR---------------------
F6R2C4_BCL2-01          GAAPP---------GAAPAPGILSSQPGR---------------------
O02718_BCL2-01          GAAPP---------GAAPAPGILSSQPGR---------------------
A0A076FZV9_BCL2-01      GAAPP---------GAAPAPGILSSQPGR---------------------
A0A452EV13_BCL2-01      GAAPP---------GAAPAPGILSSQPGR---------------------
A0A250YD83_BCL2-01      GAAPP---------EATPAPGIFSFQPGS---------------------
A9QXG9_BCL2-01          GAAPP---------GAAPAPGIFSSQPGH---------------------
A0A2K5NZS5_BCL2-01      GAATP---------GVAPAPGIFSSQPGH---------------------
A0A0D9S017_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
A0A2K6CIX3_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
A0A2K5XRD4_BCL2-01      GAATP---------GVAPAPGIFSSQPGH---------------------
A0A2K6KHG1_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
A0A2K6R2I5_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
A0A2K5HK49_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
G3QES9_BCL2-01          GAVPP---------GAAPAPGIFSSQPGH---------------------
H2QEM8_BCL2-01          GAAPP---------GAAPAPGIFSSQPGH---------------------
A0A2I3GZF9_BCL2-01      GAAPP---------GAAPAPGIFSSQPGH---------------------
A0A2K6UEL3_BCL2-01      GAAPP---------GAAPAPGIFSSQPGH---------------------
G3WZW9_BCL2-02          -------------------V------------------------------
G3SLZ1_BCL2-02          DTRTS---------PLQADP------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
H3ANS8_BCL2L1-01        GEQDH--GGGGDRAREAQTPEEGAIPGMD---------------------
A0A452FHY1_BCL2L1-      -----------SLRRDKIRYGNPNAVNAN---------------------
A0A452FHY1_BCL2L1-      -----------SLRRDKIRYGNPNAVNAN---------------------
A0A1S3EPX7_BCL2L1-      SDVEE--SRTEDPEGTESEMETPSAINGN---------------------
A0A218USB3_BCL2L1-      EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
H0Z8G3_BCL2L1-01        EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
A0A218USB3_BCL2L1-      EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
U3JSL7_BCL2L1-01        EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
A0A218USB3_BCL2L1-      EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
A0A218USB3_BCL2L1-      EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
Q4U2V6_BCL2L1-01        EEEDE--NRT-DFAGEEDEMD--GVLNGS---------------------
X4ZGI8_BCL2-01          QSSGE------DDDTINTGVEDSSPSSDR---------------------
A0A3B3E2W4_BCL2L1-      TDDGG------QTAEDR---------------------------------
A0A3B3I2Q5_BCL2L1-      TDDGG------ETEEDH---------------------------------
A0A3P9I2N4_BCL2L1-      TDDGG------ETEEDH---------------------------------
A0A3P9MKK4_BCL2L1-      TDDGG------ETEEDH---------------------------------
A0A3B5B4X7_BCL2L1-      EDAAG------RTEGDKTN-------------------------------
A0A3B4BFZ8_BCL2L1-      DPARV------QCEGNKAA-------------------------------
A0A3Q3FUB6_BCL2L1-      EDAGE------RTEGDMEN-------------------------------
A0A3B5MGS2_BCL2L1-      EVAGG------RTNWEGDS-------------------------------
M4A558_BCL2L1-01        EVAGG------RTNWEGDS-------------------------------
A0A3P9QFB3_BCL2L1-      EADGA------RTNWDGDS-------------------------------
A0A087YBW4_BCL2L1-      EADGA------RTNWDGDS-------------------------------
A0A3B3VWI7_BCL2L1-      EADGA------RTNWDGDS-------------------------------
A0A3B3XN57_BCL2L1-      EADGA------RTNWDGDS-------------------------------
A0A3Q2C6K4_BCL2L1-      EVTGG------RTEGDKDA-------------------------------
A0A3Q2NRP4_BCL2L1-      EVAGD------RTEGDKDS-------------------------------
A0A0B4KJI5_BCL2L1-      DDAGG------RTEADKAN-------------------------------
A0A3Q1JZ46_BCL2L1-      DDTGG--------VGDRPN-------------------------------
A0A3Q1JZ46_BCL2L1-      DDTGG--------VGDRPN-------------------------------
A0A3Q3NFM4_BCL2L1-      EDAGG------RTEGDMTG-------------------------------
A0A3Q3NFM4_BCL2L1-      EDAGG------RTEGDMTG-------------------------------
A0A3B4V9K8_BCL2L1-      EDAGG------RTEGDKAN-------------------------------
A0A3B4XS24_BCL2L1-      EDAGG------RTEGDKAS-------------------------------
C1BLI0_BCL2L1-01        EDASE------RTNVDKTN-------------------------------
C0HAD8_BCL2L1-01        EGASG------RTEGDD---------------------------------
A0A3B3ZMX9_BCL2L1-      --------------GTEIDTERDRDL------------------------
A0A3B5K6B9_BCL2L1-      LEPPS------RTDGQFV--------------------------------
A0A3B5K6B9_BCL2L1-      LEPPS------RTDGQFV--------------------------------
H3CH49_BCL2L1-01        VEPSS------RTEGQFG--------------------------------
A0A3B3TFR4_BCL2L1-      DEADE------QTGGGEGEAAGA---------------------------
A0A3P8XYL5_BCL2L1-      TGAFD------RTEGGEVEEVAAV--------------------------
Q90Z98_BCL2L1-02        TEDTN------RTDGAEENGEGAAGA------------------------
Q90Z98_BCL2L1-01        TEDTN------RTDGAEENGEGAAGA------------------------
A0A059PJI5_BCL2L1-      TEEVN----------GQVAEENAVGAGES---------------------
A0A3B4DTL9_BCL2L1-      MEDTN------RTEGGQAAEENAEGA--A---------------------
A0A3Q2FR43_BCL2L1-      NEPPN------GTGAQGAEQDDERTP------------------------
B5XAY3_BCL2L1-01        TEAQN------RTEVGQVE--GGAAV------------------------
W5MG74_BCL2L1-01        E---G------RTGGAEAVGSGSPNA------------------------
A0A2U9BY16_BCL2L1-      NEPPN------RTDRGEAGLGEEQQT------------------------
A0A3Q3B3X5_BCL2L1-      SDPPN------RTDAGDAGLEDAEMT------------------------
A0A3B3IB64_BCL2L1-      NESPN------RTAAGEVG--EEQST------------------------
A0A3P9JYH1_BCL2L1-      NESPN------RTAAGEVG--EEQST------------------------
A0A3B3DHA1_BCL2L1-      NESPN------RTAAGEVG--EEQST------------------------
A0A3Q0RTF8_BCL2L1-      NEPSN------RTDGGAAGLDEEQRI------------------------
I3IZK7_BCL2L1-01        NEPLN------RTDGGAAGLDEEQRI------------------------
A0A2U9BY16_BCL2L1-      NEPPN------RTDRGEAGLGEEQQT------------------------
A0A2U9BY16_BCL2L1-      NEPPN------RTDRGEAGLGEEQQT------------------------
A0A2U9BY16_BCL2L1-      NEPPN------RTDRGEAGLGEEQQT------------------------
A0A0D6DR75_BCL2L1-      SEPPN------RTDGGEVESAEEQRI------------------------
A0A3Q3WIW8_BCL2L1-      IEPPN------RTEGGQAVSDEEQRV------------------------
A0A219P0Y3_BCL2L1-      IEPPN------RTDGGEAGLGEEQRV------------------------
A0A3Q3MX20_BCL2L1-      NEQQN------RTDGGEAESGEEQRI------------------------
A0A3Q3G2E1_BCL2L1-      LEPPN------RTDGAGAGSGEEQQV------------------------
A0A3Q3G2E1_BCL2L1-      LEPPN------RTDGAGAGSGEEQQV------------------------
A0A3Q3G2E1_BCL2L1-      LEPPN------RTDGAGAGSGEEQQV------------------------
A0A3Q1GZ93_BCL2L1-      NETPN------RTDGGEDGLSEEQRI------------------------
A0A3Q1GZ93_BCL2L1-      NETPN------RTDGGEDGLSEEQRI------------------------
A0A3Q1GZ93_BCL2L1-      NETPN------RTDGGEDGLSEEQRI------------------------
A0A3B4V3T1_BCL2L1-      NESPN------RTDGGEAGLVEEQRI------------------------
A0A3B4XU17_BCL2L1-      NESPN------RTDGGEAGLVEEQRI------------------------
A0A3P9MKK4_BCL2L1-      GGETE---------------EDHSAARNG---------------------
A0A3B3I2Q5_BCL2L1-      GGETE---------------EDHSDARNR---------------------
A0A3P9I2N4_BCL2L1-      GGETE---------------EDHSAARNG---------------------
A0A3B4AFB7_MCL1-01      NSEGS--LPCTPEFHSDSEMELSSYSAEH---------------------
B9ZYL7_BCL2-01          QASAA--ISNYSDDGEMPAASADSRGPPQ---------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      EVERR--SDNSDMDEGAQPLPELQTPPGQ---------------------
A0A3Q3BEB7_BCL2L1-      GERTE-----------------KASSAPS---------------------
A0A3P8VMA1_BCL2L1-      GEQRE---------------GEEVTTASS---------------------
A0A345BSW9_BCL2L1-      TNRTD---------------GAEENGEGA---------------------
A0A286MU87_BCL2L1-      SGRTD---------------GDEAIANGS---------------------
A0A3P8XFS0_BCL2L1-      SGRTE---------------GEEATANGS---------------------
A0A3P8XFS0_BCL2L1-      SGRTE---------------GEEATANGS---------------------
A0A0F7L1T6_BCL2L1-      DGRTE---------------GEKRSPAAS---------------------
H2U5I3_BCL2L1-01        DGRTE---------------GEKRSPGAS---------------------
H2U5I3_BCL2L1-02        DGRTE---------------GEKRSPGAS---------------------
A0A3Q3J5K3_BCL2L1-      GGRTE---------------GDRTNPATT---------------------
A0A3Q1EVP6_BCL2L1-      GGRTD---------------GDKASSASS---------------------
A0A3Q1BQA0_BCL2L1-      GGRTD---------------GDKANSASS---------------------
A0A3P8U812_BCL2L1-      EGRTD---------------GDKANSASS---------------------
E6ZFR0_BCL2L1-01        GERTE---------------GDKANSAAR---------------------
G3P7B4_BCL2L1-01        GGRTE---------------GDKANSASV---------------------
A0A3Q3X5M5_BCL2L1-      GGRTE---------------GDKASSAAR---------------------
A0A2U9BIG9_BCL2L1-      GGRTE---------------GDKANSAAS---------------------
D2ITA2_BCL2L1-02        GEGTD------EDKSNRIGNNGLRLNDGN---------------------
A0A3B3ZMX9_BCL2L1-      GDRST------QSDTEHLGLGDRGVDRAR---------------------
G3NJY1_BCL2L1-01        SEPPN------RTGG-----GVEAGAAGG---------------------
A0A2U9BY16_BCL2L1-      -----------QTDR-----GEAGLG-EE---------------------
A0A3Q3DUT7_BCL2L1-      RQALN------RTDG-----REEASGEEE---------------------
A0A3Q3DUT7_BCL2L1-      RQALN------RTDG-----REEASGEEE---------------------
A0A3Q3DUT7_BCL2L1-      RQALN------RTDG-----REEASGEEE---------------------
A0A3B1JJ42_BCL2L1-      MEETN------RTEG-----GQEAEG-NA---------------------
A0A3P8UWG7_BCL2L1-      GDSPN------RTDG-----EEAGLG-AE---------------------
A0A3Q3IVF5_BCL2L1-      NESPN------RTDG-----EEA---------------------------
A0A3Q1DHJ3_BCL2L1-      NEAPS------RTDG-----GEARLG-EE---------------------
A0A3Q1DHJ3_BCL2L1-      NEAPS------RTDG-----GEARLG-EE---------------------
A0A3Q1DHJ3_BCL2L1-      NEAPS------RTDG-----GEARLG-EE---------------------
A0A3P8TL99_BCL2L1-      NEAPS------RTDG-----GEARLG-EE---------------------
A0A3P8TL99_BCL2L1-      NEAPS------RTDG-----GEARLG-EE---------------------
A0A3Q1FR00_BCL2L1-      NEAPN------RTDG-----GEARLG-ED---------------------
A0A3B4Z3X2_BCL2L1-      NEAPN------RTDG-----GEARLA-EE---------------------
A0A3B4Z3X2_BCL2L1-      NEAPN------RTDG-----GEARLA-EE---------------------
C3VIT1_BCL2L1-01        NEPPN------RTGA-----GDGGLG-EE---------------------
A0A3P8P0F1_BCL2L1-      NEPSN------RTDG-----GAAGLD-EE---------------------
A0A3Q2X557_BCL2L1-      NEPSN------RTDG-----GAAGLD-EE---------------------
A0A3P9D632_BCL2L1-      NEPSN------RTDG-----GAAGLD-EE---------------------
A0A3P9D632_BCL2L1-      NEPSN------RTDG-----GAAGLD-EE---------------------
A0A3Q4N4B5_BCL2L1-      NEPSN------RTDG-----GAAGLD-EE---------------------
A0A3B4FNX1_BCL2L1-      NEPSN------RTDG-----GAAGLD-EE---------------------
A0A3Q2QPL9_BCL2L1-      NEPPS------DGGA-----RDAESD-EE---------------------
A0A3B5PQJ0_BCL2L1-      NEPPD------GTAA-----GDVGMD-DE---------------------
A0A087X9B7_BCL2L1-      NEPPD--STAAGDAA-----GDAGMD-DE---------------------
A0A3B3TUS7_BCL2L1-      NEPPD--STAAGDAA-----GDAGMD-DE---------------------
A0A3B3WI27_BCL2L1-      NEPPD--STAAGDAA-----GDAGMD-DE---------------------
A0A3P9N9Y4_BCL2L1-      NEPPD--STAARDAA-----GDGGMD-DE---------------------
A0A3B3QRZ2_BCL2L1-      GLPED--RGRTEGSGQADGREGVMVTATH---------------------
Q564A4_BCL2-01          --------------SSAEEDDTFNKAVEE---------------------
H9GPE7_BCL2-01          RGK-----------SASLSPELLNSDPVS---------------------
A0A452I9V7_BCL2-01      RGPVS---------PNLSPPTVTGTSSDH---------------------
W5N4F7_BCL2-01          GETDP--PNNGLVGPSASGPGLQARRLQA---------------------
K7F5Y3_BCL2-02          NRGPV---------SSSLSPPAAGTPSDH---------------------
A0A3Q2HRY3_BCL2-02      GAAPL---------GATPVPGIFSSQPGR---------------------
H0YUX3_BCL2-01          RASLP---------PDHSASAAAAIAAAA---------------------
K7F5Y3_BCL2-01          NRGPV---------SSSLSPPAAGTPSDH---------------------
F1LNV0_BCL2-01          DSAPL---------RAAPTPGIFSFQPES---------------------
P49950_BCL2-01          DSAPL---------RAAPTPGIFSFQPES---------------------
G1TW27_BCL2-01          --------------GAASAPGVFSSQP-----------------------
A0A2K5EB04_BCL2-01      GAAPP---------GAAPAPGIFSSQPGH---------------------
A0A2R8MY14_BCL2-01      GAAPP---------GAAPAEGIFSSQPGH---------------------
H2NWH5_BCL2-01          GAAPP---------GAATAPGIFSSQPGH---------------------
A0A096MPU7_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
A0A2K5PP81_BCL2-01      GAAPP---------GAAPAPGIFSSQPGH---------------------
H0WKI0_BCL2-01          GVAPP---------GAATAPGVFSSQPGR---------------------
A0A2K5UDI5_BCL2-01      GAATP---------GAAPAPGIFSSQPGH---------------------
P10417_BCL2-01          DAAPL---------GAAPTPGIFSFQPES---------------------
Q7TSN8_BCL2-01          DAAPL---------GAAPTPGIFSFQPES---------------------
A0A3Q2HRY3_BCL2-01      GAAPL---------GATPVPGIFSSQPGR---------------------
E2QWA1_BCL2-02          GAAPP---------GAAPAPGISASQX-X---------------------
A0A2K6G3I7_BCL2-01      GAAPP---------GAAPTPGIFSSQPGR---------------------
Q6R755_BCL2-01          DAAPL---------GAAPTPGIFSFQPES---------------------
Q9JJV8_BCL2-01          DAAPL---------GAAPTPGIFSFQPES---------------------
Q923R6_BCL2-01          DAAPL---------GAAPTPGIFSFQPES---------------------
H0W1T3_BCL2-01          SALGR---------NSPLGV------------------------------
G1LIC9_BCL2-02          APAA----------------------------------------------
I3MVK9_BCL2-01          GAASP---------GAAPGPGIFSSQPG----------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      ------------TDGGEARLGEDQRTETHANGTFNGTSPGTPPPSPR---
F6VJQ0_BCL2L10-01       -------------------------------------------------M
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          -----------------------------------MELPGDGCPQDG---
J7H260_MCL1-01          ---------------------------------------STSPPLTP--T
G1PZ39_MCL1-01          ------------KRPAVLPLVQLVGEASGG-PGAGGSLPSTPPPAEE---
Q9Z1P3_MCL1-01          ------------KRPAVLPLLERVSEAAKS-SGADGSLPSTPPPPEE---
A5PJR2_MCL1-01          ------------KRPAVRPLPLLVGEASNNSPGSDGSLPSTPPPAEE---
A0A452GA25_MCL1-01      ------------KRPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEE---
G1L3L7_MCL1-01          ------------KRPAVLPLLELVGEASGG-PCTDGSLPSTPPPAEE---
G1T2Q0_MCL1-01          ------------KRPAVLPLLDLVGEASKV-PSTDGSLPSTPPPAEE---
F7AVA6_MCL1-01          ------------KRPAVLPLLEFVREASSG-PCTDGSLPSTPPPAEE---
A0A337S3J9_MCL1-01      ------------KRPAVLPLLELVGEASSG-PGTDGSLPSTPPPAEE---
A0A337S3J9_MCL1-03      ------------KRPAVLPLLELVGEASSG-PGTDGSLPSTPPPAEE---
Q7YRZ9_MCL1-01          ------------KRPAVLPLLELVGEASSG-PGTDGSLPSTPPPAEE---
F1PAP1_MCL1-01          ------------KRPAVLPLLELVGEASSG-PGMDGSLPSTPPPAEE---
Q8HYS5_MCL1-01          ------------KRPAVLPLLELVGEASSG-PGMDGSLPSTPPPAEE---
M3XZZ5_MCL1-01          ------------KRPAVLPLLELVGEASSG-PCTDGSLPSTPPPAEE---
A0A452RHX5_MCL1-01      ------------KRPAVLPLLELVGEASGG-PCTDGSLPSTPPPAEE---
H0XFB7_MCL1-01          ------------KRPAVLPLLELVGEASNG-PSTDGSLPSTPPPAEE---
F7GTF7_MCL1-01          ------------KRPAVLPLLELVGEPANG-SSTDGSLPSTPPPAEE---
A0A2K5CFH3_MCL1-01      ------------KRPAVLPLLELVGEPGNG-SSTDGSLPSTPPPAEE---
A0A2K6V5Y3_MCL1-01      ------------KRPAVLPLLELVGEPGHG-SSTDGSLPSTPPPAEE---
A0A2K6KRW9_MCL1-01      ------------KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE---
A0A2K5XSB2_MCL1-01      ------------KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE---
A0A0D9RZP5_MCL1-01      ------------KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE---
I7G687_MCL1-01          ------------KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE---
A0A2K5LXU8_MCL1-01      ------------KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE---
A0A2I3GJZ3_MCL1-02      ------------KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE---
H2N5Y9_MCL1-01          ------------KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE---
A0A2R9BPJ5_MCL1-01      ------------KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE---
A0A2I3RTV4_MCL1-01      ------------KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE---
A0A2I2YQH7_MCL1-01      ------------KRPAVLPLLELVGESGND-TSTDGSLPSTPPPAEE---
A0A2K5C7L5_MCL1-01      ------------KRPAVLPLLELVEEPGND-SSTDGSLPSTPP-------
A0A2K5I9I0_MCL1-02      ------------KRPAVLPLLELVGES-NS-SSTDGSLPSTPPPAEE---
A0A2K6GI15_MCL1-01      ------------KRPAVLPLLELVGEASNG-SSTDGSLPSTPPPAEE---
A0A2I3GJZ3_MCL1-01      ------------KRPAVLPLLELVGESGNN-TSTDGSLPSTPPPAEE---
A0A2K5CFH3_MCL1-03      ------------KRPAVLPLLELVGEPGNG-SSTDGSLPSTPPPAEE---
A0A2K5R5E2_MCL1-03      ------------KRPAVLPLLELVGEPGNG-SSTDGSLPSTPPPAEE---
A0A2K5W0W9_MCL1-01      ------------KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE---
A0A2K6ECR0_MCL1-02      ------------KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE---
A0A2I3LFM0_MCL1-01      ------------KRPAVLPLLELVGESGNS-PSTDGSLPSTPPPAEE---
A0A2K6KRW9_MCL1-02      ------------KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE---
A0A2K6PPI3_MCL1-02      ------------KRPAVLPLLELVGESGNS-SSTDGSLPSTPPPAEE---
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          ------------KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDED
W5QI41_MCL1-01          RQQQWFKMFGFKRRPAVRPLPLMVGEASNNSPGSDGSLPSTPPPSEE---
F1MQX4_MCL1-01          --------------------------------------GMLPIFSEE---
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          ------------RRE--------IGGGEAGAV-IGGSAGASPPSTLT---
B4DG83_MCL1-01          ------------KRPAVLPLLELVGESGNNTS-TDGSLPSTPPPAEE---
B4E3L8_MCL1-01          ------------KRPAVLPLLELVGESGNNTS-TDGSLPSTPPPAEE---
H3AR18_MCL1-02          --------------------------------------------EDG--D
E2RS00_BCL2A1-01        ------------EEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRA--S
B6V6J0_MCL1-01          ------------LGFNNGGSLPCSQEDELDEDMDNGSQGSTSPPDSP--V
G3PJT0_MCL1-01          ------------NGYPSKPQREDSEDTDNDSLPCTPESDSETDVSDS--P
H0XHA5_MCL1-01          ------------KQPEGLPLLEFVGE------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          ------------KQPAVLPLLQLVGEA--SEGPAGGSLPSTPPPAEE--E
H9GEA6_MCL1-02          ------------EAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDH----
H9GEA6_MCL1-01          ------------EAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDH----
A0A493U0E8_MCL1-01      ------------G----------------IFSRPARTNPLGSAP------
A0A1L1RNM6_MCL1-01      ------------G--------------------PGGDSLPGTPPELP--D
A0A1L1RNM6_MCL1-02      ------------G--------------------PGGDSLPGTPPELP--D
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          ------------KRPSRLAVLEIARE---GGDSPNGSLPSTPPPAEE--D
F6ZMX1_MCL1-03          ------------KRPSRLAVLEIARE---GGDSPNGSLPSTPPPAEE--D
F6ZMX1_MCL1-02          ------------KRPSRLAVLEIARE---GGDSPNGSLPSTPPPAEE--D
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      ------------KRPAVLPLLGLVGEAG-KSPSADGSLPSTPPPAEE--E
B4DU51_MCL1-01          ------------KRPAVLPLLELVGESG-NNTSTDGSLPLTPPPAEE--E
A0A287DCH9_MCL1-02      ------------KRPAVLPLLELVGEAA-KSPGADGSLPSTPPPAEE--E
P97287_MCL1-01          ------------KRPAVLPLLERVSEAA-KSSGADGSLPSTPPPPEE--E
A0A452GA25_MCL1-02      ------------KRPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEE--E
A0A287DCH9_MCL1-01      ------------KRPAVLPLLELVGEAA-KSPGADGSLPSTPPPAEE--E
G3T756_MCL1-01          ------------KRPAVFPRLGLVGEAS-NGPGTDGSLPSTPPLAEE--E
A0A1S3F3I1_MCL1-01      ------------KRPAVLPLLELVGEAS-KSSRTDGSLPSTPPPAEE--E
G1L3L7_MCL1-02          ------------KRPAVLPLLELVGEAS-GGPCTDGSLPSTPPPAEE--E
A0A287BK44_MCL1-01      ------------KRPAVLPLLGLVEEAS-SGPGTDGSLPSTPPPAEE--E
A0A287BK44_MCL1-02      ------------KRPAVLPLLGLVEEAS-SGPGTDGSLPSTPPPAEE--E
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       ---------------------------------APQQPST----------
I3KXG5_MCL1-01          ------------------------------GLSQPQRKET----------
H0ZCL9_BCL2A1-01        ----------------------------VLQESHLGPAQT----------
U3JTB2_BCL2A1-01        ----------------------------VLQESHLGPAQT----------
A0A218V8Z6_BCL2A1-      ----------------------------VLQESHLGPAQT----------
Q9W6F2_BCL2A1-01        ----------------------------VLQESHLGPAQT----------
A0A493SSZ7_BCL2A1-      ----------------------------VLQESHLGPAQT----------
G1N8C5_BCL2A1-01        ----------------------------VLQESRLGPAQT----------
A0A452J3N6_BCL2A1-      ----------------------------VLQEPQLGPAPS----------
K7G130_BCL2A1-01        ----------------------------ILQEPELGPAPS----------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        ----------------------------VLQIPQPGSGPS----------
F6SFL4_BCL2A1-01        ----------------------------VQQTPPLGSCLN----------
G3WSP8_BCL2A1-01        ----------------------------VQQMPRLGSCLH----------
A0A2K5PYQ3_BCL2A1-      ----------------------------VLQIPQSGTGPS----------
A0A2K5PYQ3_BCL2A1-      ----------------------------VLQIPQSGTGPS----------
F6S8G3_BCL2A1-01        ----------------------------VLQTPRLGTVPS----------
O55178_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
Q0P538_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
G3V977_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
Q925A9_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
Q07440_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
O55179_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
O55177_BCL2A1-02        ----------------------------VLQVPAFESAPS----------
Q497M6_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
Q8K164_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
Q4FK02_BCL2A1-01        ----------------------------VLQVPAFESAPS----------
A0A452SIR9_BCL2A1-      ----------------------------VLQIPQPGSAPS----------
M3YVH4_BCL2A1-01        ----------------------------VLQIPQPSPAAS----------
U6CQS8_BCL2A1-01        ----------------------------VLQIPQPGPAAS----------
I3MCZ7_BCL2A1-01        ----------------------------VLQVPQRGSSPS----------
G3T8E6_BCL2A1-01        ----------------------------VLQIPQPAAGSS----------
H0WZ23_BCL2A1-01        ----------------------------VLQIQQCGSGPS----------
A0A2I3HBP6_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5D2I1_BCL2A1-      ----------------------------VLQIPQSGTGPS----------
B4E1X9_BCL2A1-01        ----------------------------VLQIPQPGSGPS----------
A0A2I2YML2_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2R8ZJX9_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2I3HBP6_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6PHF2_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6LV19_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5TMD1_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5KAA3_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6DS18_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A096NMX5_BCL2A1-      ----------------------------VLQIPQPGLGPS----------
A0A2K6AD27_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6TLJ5_BCL2A1-      ----------------------------VLQIPQSGTGPS----------
F7HXW0_BCL2A1-01        ----------------------------VLQIPQSGMGPS----------
A0A2K6TLJ5_BCL2A1-      ----------------------------VLQIPQSGTGPS----------
A0A2K6EKG1_BCL2A1-      ----------------------------VLRVPQPGSGPS----------
A0A452EK63_BCL2A1-      ----------------------------VLQIQQPGSKPS----------
W5Q0N6_BCL2A1-01        ----------------------------VLQIQQPGSKPS----------
L8IZT5_BCL2A1-01        ----------------------------VLQIQQPGSKPS----------
Q3C2I0_BCL2A1-01        ----------------------------VLQIQQPGSKPS----------
F7CP56_BCL2A1-04        ----------------------------VLQIPQPGSGPS----------
C7F841_BCL2A1-01        ----------------------------VLQIPQPGSGPS----------
A0A2K5D2I1_BCL2A1-      ----------------------------VLQIPQSGTGPS----------
H2NNZ9_BCL2A1-01        ----------------------------VLQIPQPGSGPS----------
A0A2I2YML2_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6LV19_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6PHF2_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5KHH8_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5KHH8_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5KAA3_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K5TMD1_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
F7E8V5_BCL2A1-01        ----------------------------VLQIPQPGSGPS----------
A0A2K6DS18_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A2K6AD27_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
A0A096NMX5_BCL2A1-      ----------------------------VLQIPQPGLGPS----------
A0A0D9RRC3_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
Q16548_BCL2A1-01        ----------------------------VLQIPQPGSGPS----------
A0A2R8ZJX9_BCL2A1-      ----------------------------VLQIPQPGSGPS----------
W5MMB7_MCL1-01          GHFPESG-------------HADGSLPSTPDTPLDCGSVP----------
A0A3B3SG34_MCL1-01      EPCRGSRLP---GST-----NAVGSLPTSPDGDLPAYGPI----------
Q4SW32_MCL1-01          CLSKTIQED-----------SEDGSLPCTPESHSGDVLDV----------
D2ITA0_MCL1-03          RLVNKSQDD---QEG-------NGSLPSTPELQSEVDTD-----------
D2ITA0_MCL1-04          RLVNKSQDD---QEG-------NGSLPSTPELQSEVDTD-----------
A0A3P9ILF6_MCL1-01      HDV-----------------DDDGSLPNTPEL--ECEASV----------
A0A3P9ILF6_MCL1-02      HDV-----------------DDDGSLPNTPEL--ECEASV----------
Q0KFR9_MCL1-01          NGLDNHLSD---RSN-----N-DDSLPCTPQMASECGPEL----------
A0A3P8Y1W8_MCL1-02      NVLDSRLSD---LAD-----DSDDSLPCTPLMVTECSAGL----------
A0A3P8Y1W8_MCL1-01      NVLDSRLSD---LAD-----DSDDSLPCTPLMVTECSAGL----------
A0A3Q2XZL8_MCL1-01      LATMNHRNN---SDDDFDVESSDDSPPSTPDSQDSLVAD-----------
A0A3B4AFB7_MCL1-02      LLNKNTREE---DYE-----NSEGSLPCTPEFHSDSEMEL----------
A0A3B3VM25_MCL1-01      YVAKSLQES---SD--------EGSLPCTPA-QQDSETVA----------
A0A3Q0R633_MCL1-01      YAPKNI------TDD-----VEDGSLPSTPEFHSDSES------------
A0A3Q0R633_MCL1-03      YAPKNI------TDD-----VEDGSLPSTPEFHSDSES------------
A0A3B4T8L9_MCL1-02      YATKASRED---SD------VDDGSLPCTPEIQSDGETDV----------
A0A3B4T8L9_MCL1-01      YATKASRED---SD------VDDGSLPCTPEIQSDGETDV----------
A0A3Q1EQB9_MCL1-02      YAPKSLRQD---SDS-----MEDGSLPCTPELQSDSETDV----------
A0A3B4ZKP6_MCL1-01      FAGKGLRQV---SDS-----LEDSSLPCTPELQSDSETDV----------
A0A3Q1BKL8_MCL1-02      YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV----------
A0A3Q1EQB9_MCL1-01      YAPKSLRQD---SDS-----MEDGSLPCTPELQSDSETDV----------
A0A3Q1BKL8_MCL1-01      YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV----------
A0A3P8RQX7_MCL1-01      YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV----------
A0A3P8RQX7_MCL1-02      YASKNLRQD---SDS-----MEEGSLPCTPELQSDSETDV----------
A0A3Q3VP02_MCL1-01      YMGKPIRKDS--TDT-----DDDGSLPYTPDMSPDSELNV----------
A0A3B5K5B3_MCL1-01      CVAKAIQEDS--QDT-----DHRSA-PCTPEMNSVNGLDV----------
A0A3B3IJ04_MCL1-01      YSARRF------HDV-----DDDGSLPNTPELECE--ASV----------
A0A3P9L1F3_MCL1-01      YSARRF------HDV-----DDDGSLPNTPELECE--ASV----------
A0A3B3IJ04_MCL1-02      YSARRF------HDV-----DDDGSLPNTPELECE--ASV----------
A0A3P9L1F3_MCL1-02      YSARRF------HDV-----DDDGSLPNTPELECE--ASV----------
A0A3B3CEX1_MCL1-02      YAARRF------HD------DDGGSLPNTPELECD--NSV----------
A0A3B3CEX1_MCL1-01      YAARRF------HD------DDGGSLPNTPELECD--NSV----------
A0A3Q3B4P5_MCL1-01      YQDKRFQEL-----G-----DDHGSLPSTPEVDGNPDVPG----------
A0A3Q3B4P5_MCL1-02      YQDKRFQEL-----G-----DDHGSLPSTPEVDGNPDVPG----------
A0A3Q2EDX8_MCL1-01      YVGKNLSDN---SAD------DGGSLPCTPEMPTDSHPAT----------
A0A3Q2P7X9_MCL1-01      FAVKSIQEN---RDD--------GSLPSTPEMQADSEAAG----------
A0A3Q2P7X9_MCL1-02      FAVKSIQEN---RDD--------GSLPSTPEMQADSEAAG----------
A0A3B5PQ55_MCL1-02      YVAKSLPTS---SDD-----SDEGSLPCTPAQHPDSEKDA----------
A0A3B5PQ55_MCL1-01      YVAKSLPTS---SDD-----SDEGSLPCTPAQHPDSEKDA----------
A0A3P9Q4I8_MCL1-02      YVAKSLPES---SDD-----SDEGSLPCTPAQQ-DGETDA----------
A0A3P9Q4I8_MCL1-01      YVAKSLPES---SDD-----SDEGSLPCTPAQQ-DGETDA----------
A0A087X830_MCL1-01      YVAKSLQKS---SDD-----SDEGSLPCTPAQQ-DSETDA----------
A0A3B3YCD0_MCL1-01      YVAKSLQKS---SDD-----SDEGSLPCTPAQQ-DSETDA----------
I3JHR5_MCL1-01          YTTKAI------RDR-----EEDGSLPSTPEYHLD---------------
A0A3Q4HLQ8_MCL1-01      YTTKAI------RDR-----EEDGSLPSTPEFHSD---------------
A0A3P8NP63_MCL1-02      YKTKAI------RDR-----EEDGSLPSTPEFHSD---------------
A0A3Q2VNL8_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFHSD---------------
A0A3P8NP63_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFHSD---------------
A0A3P9BVM3_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFHSD---------------
A0A3B4G4Z6_MCL1-01      YKTKAI------RDR-----EEDGSLPSTPEFHSD---------------
A0A2U9CJ81_MCL1-01      YAAKSCREDGGGGGD-----VGGGSLPSTPESDGE--HDV----------
A0A3P8VKM5_MCL1-05      HARKSH-------CE-----VDEGSEPCTPEPHSE--AEL----------
A0A3P8VKM5_MCL1-04      HARKSH-------CE-----VDEGSEPCTPEPHSE--AEL----------
A0A3P8VKM5_MCL1-03      HARKSH-------CE-----VDEGSEPCTPEPHSE--AEL----------
A0A3Q3IZW0_MCL1-01      YGTKTL-VD---VSD-----IDNGSLPCSPVLQPDNEIEV----------
A0A3Q1GX28_MCL1-02      YATKNIGAN---SDD-----IEDGSLPCTPELMSDSEVDV----------
A0A3Q1GX28_MCL1-01      YATKNIGAN---SDD-----IEDGSLPCTPELMSDSEVDV----------
A0A3B4XKA5_MCL1-01      YATKASRED----SD-----VDDGSLPCTPEMQSDGETDV----------
A0A3Q3GP42_MCL1-01      -------------DD-----IEDGSLPCTPEPDSE--TEV----------
A0A3Q3M6G2_MCL1-01      YATKSIVAD---TDD-----IEDGSLPCTPELQSD--SEA----------
A0A3Q3M6G2_MCL1-02      YATKSIVAD---TDD-----IEDGSLPCTPELQSD--SEA----------
A0A3B1IEV7_MCL1-01      ---LQSAKG----VS-----MGGGSLPDSPLADVDFIQDF----------
A0A3B4CGU9_MCL1-03      ---LQAAPGPASKAA-----MAGGSLPESPESD-DFVPDF----------
A0A3B4CGU9_MCL1-02      IYLIHGGQGGSSSSS-----AQTGS-PAAPELT-HVQVNSISISSTKEQT
Q8UWD6_MCL1-01          LVIPELKAHNQFAVD-----SLQGSVPSSPSDETGDYPP-----------
A2BF68_MCL1-01          LVIPELKAHNQFAVD-----SLQGSVPSSPSDETGDYPP-----------
Q568W5_MCL1-01          LVIPELKAHNQFAVD-----SLQGSVPSSPSDETGDYPP-----------
A0A3B1K5R1_MCL1-01      GLAADIRPTRPGVDD--------GSVPSSPLSDCGEMAVG----------
A0A3B4C6H5_MCL1-01      LIAA--------VTD--------GSLPTSPASDCEELDSD----------
A0A3B4C6H5_MCL1-03      RIAA--------VTD--------GSLPTSPASDCEELDSD----------
Q9Z0F3_BCL2L10-01       ---------------------------------PEPPPTS----------
E1B9B3_BCL2L10-01       ---------------------------------PAPAPST----------
A0A1U7QVA0_BCL2L10      ---------------------------------PEPPPTS----------
F1RZB9_BCL2L10-01       ---------------------------------AARQPSS----------
F1MV39_BCL2L10-01       ---------------------------------PAPAPST----------
W5QIG4_BCL2L10-01       ---------------------------------PAPAPST----------
Q99M66_BCL2L10-01       ---------------------------------PEPLPTS----------
F6ZPD4_BCL2L10-01       ---------------------------------P----------------
A0A2K6F2Q2_BCL2L10      ---------------------------------PGLPPSS----------
H0WZ06_BCL2L10-01       ---------------------------------PEPTPSS----------
A0A1U7UZD8_BCL2L10      ---------------------------------PEPRPSS----------
G1T264_BCL2L10-01       ---------------------------------PEPQPST----------
A0A0D9RG38_BCL2L10      ---------------------------------PEPRPST----------
A0A2K5RIU7_BCL2L10      ---------------------------------PESPPAT----------
A0A2K5F974_BCL2L10      ---------------------------------PESPPST----------
A0A2K6TIT7_BCL2L10      ---------------------------------PESPPAT----------
F7CT87_BCL2L10-01       ---------------------------------PESPPST----------
A0A096NM44_BCL2L10      ---------------------------------PEPRPST----------
A0A2K6R5T5_BCL2L10      ---------------------------------PEPRPST----------
Q9HD36_BCL2L10-02       ---------------------------------PEPAPST----------
G1R3W6_BCL2L10-01       ---------------------------------PEPTPST----------
A0A2K5K3B0_BCL2L10      ---------------------------------PEPRPST----------
A0A2K6M5H5_BCL2L10      ---------------------------------PEPRPST----------
A0A2K5TKG9_BCL2L10      ---------------------------------PEPRPST----------
F7H6U5_BCL2L10-01       ---------------------------------PEPRPST----------
A0A2K6B2D9_BCL2L10      ---------------------------------PEPRPST----------
A0A2K5MMZ4_BCL2L10      ---------------------------------PEPRPST----------
H2NN92_BCL2L10-01       ---------------------------------PEPTPPT----------
A0A2R9BCD9_BCL2L10      ---------------------------------PEPTPST----------
H2Q9G4_BCL2L10-01       ---------------------------------PEPTPST----------
G3QLU6_BCL2L10-01       ---------------------------------PEPTPST----------
A0A337RYG8_BCL2L10      ---------------------------------PARTPST----------
G1LKR4_BCL2L10-01       ---------------------------------PARAPST----------
A0A452QJG0_BCL2L10      ---------------------------------PARAPST----------
R4JQR8_BCL2L1-01        -------------------------------------PPS----------
A0A346RRN1_BCL2L1-      -------------------------------------PPS----------
A0A3Q4MN81_BCL2L10      ---------------------------------QAPPPPS----------
A0A3B4ETX9_BCL2L10      ---------------------------------QAPPPPS----------
D2IT42_BCL2L10-02       ---------------------------------TAPPPPS----------
A0A3Q0S9R1_BCL2L10      ---------------------------------QVPPPPS----------
I3J363_BCL2L10-01       ---------------------------------QAPPPPS----------
A0A3Q2UUN9_BCL2L10      ---------------------------------QAPPPPS----------
A0A3P8PVZ8_BCL2L10      ---------------------------------QAPPPPS----------
A0A3Q2UUN9_BCL2L10      ---------------------------------QAPPPPS----------
A0A3P9BLI0_BCL2L10      ---------------------------------QAPPPPS----------
A0A3Q2PJS5_BCL2L10      ---------------------------------PAPPPPS----------
A0A3Q2GL87_BCL2L10      ---------------------------------PAPPPPS----------
A0A3B5MJ12_BCL2L10      ---------------------------------PAPPPPS----------
M4AUW7_BCL2L10-01       ---------------------------------PAPPPPS----------
A0A096ME02_BCL2L10      ---------------------------------PAPPPPS----------
A0A3B3TYN4_BCL2L10      ---------------------------------PAPPPPS----------
A0A3B3YT99_BCL2L10      ---------------------------------PAPPPPS----------
A0A3P9NE65_BCL2L10      ---------------------------------PAPPPPS----------
A0A3P9IIZ2_BCL2L10      ---------------------------------QAPPPPS----------
A0A3P9LM07_BCL2L10      ---------------------------------QAPPPPS----------
H2MBQ3_BCL2L10-01       ---------------------------------QAPPPPS----------
A0A3B4AAV4_BCL2L10      ---------------------------------AAPPPPS----------
A0A3Q3EZT5_BCL2L10      ---------------------------------PAPPPPS----------
A0A3Q3EZT5_BCL2L10      ---------------------------------PAPPPPS----------
A0A3Q3JQ78_BCL2L10      ---------------------------------PAPPPPS----------
A0A3B4TIY6_BCL2L10      ---------------------------------PAPPPPS----------
A0A3B4WGF4_BCL2L10      ---------------------------------PAPPPPS----------
A0A3Q3KZW1_BCL2L10      ---------------------------------SVPPPPS----------
A0A3B5KD08_BCL2L10      ---------------------------------PAPPPPS----------
A0A3Q3VI28_BCL2L10      ---------------------------------PAPPPPS----------
A0A3Q1GM98_BCL2L10      ---------------------------------QAPPPPS----------
A0A3Q1D2L0_BCL2L10      ---------------------------------QAPPPPS----------
A0A3P8RL82_BCL2L10      ---------------------------------QAPPPPS----------
A0A3B4ZFS0_BCL2L10      ---------------------------------SAPPPPS----------
A0A3B3C5I4_BCL2L10      ---------------------------------QAPPPPS----------
A0A3Q1IAB0_BCL2L10      ---------------------------------PAPPPPS----------
A0A3P8W7K5_BCL2L10      ---------------------------------PAPPPPS----------
H3AAS7_BCL2L2-02        ---------------------------------TD-PPAN----------
H3AAS7_BCL2L2-01        ---------------------------------TD-PPAN----------
G1Q051_BCL2L2-01        ---------------------------------GEGPAAD----------
G3WPT1_BCL2L2-01        ---------------------------------GEGPTNE----------
A0A287D9B3_BCL2L2-      ---------------------------------GEGPAAD----------
A0A482LX62_BCL2L2-      ---------------------------------GEGPAAD----------
W5QDH4_BCL2L2-02        ---------------------------------GEGPAAD----------
Q7TS60_BCL2L2-01        ---------------------------------GEGPAAD----------
G1LMC3_BCL2L2-01        ---------------------------------GEGPAAD----------
M3Y5X5_BCL2L2-01        ---------------------------------GEGPAAD----------
G1P3J2_BCL2L2-01        ---------------------------------GEGPAAD----------
G3WPT1_BCL2L2-02        ---------------------------------GEGPTNE----------
G1TV33_BCL2L2-01        ---------------------------------GEGPAAN----------
P70345_BCL2L2-01        ---------------------------------GEGPAAD----------
O88996_BCL2L2-01        ---------------------------------GEGPAAD----------
A0A3Q9B4M8_BCL2L2-      ---------------------------------GEGPAAD----------
H0XR82_BCL2L2-01        ---------------------------------GEGPATD----------
A0A250YBR2_BCL2L2-      ---------------------------------GEGPAAD----------
A0A250YBR2_BCL2L2-      ---------------------------------GEGPAAD----------
L8HP19_BCL2L2-02        ---------------------------------GEGPAAD----------
L8HP19_BCL2L2-01        ---------------------------------GEGPAAD----------
Q1RMX3_BCL2L2-01        ---------------------------------GEGPAAD----------
A0A452ECF0_BCL2L2-      ---------------------------------GEGPAAD----------
A0A286XQQ9_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K5RUN8_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K5MZX9_BCL2L2-      ---------------------------------GEGPAAD----------
A0A0D9RU30_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K5HEJ9_BCL2L2-      ---------------------------------GEGPAAD----------
A0A1S3FYD8_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2I2UAE3_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2I2YPX6_BCL2L2-      ---------------------------------GEGPAAD----------
A0A287D9B3_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K5V0Q3_BCL2L2-      ---------------------------------GEGPAAD----------
F7G4L5_BCL2L2-01        ---------------------------------GEGPAAD----------
A0A2K6EA59_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K6AI25_BCL2L2-      ---------------------------------GEGPAAD----------
A0A1U7RC37_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2I3GEA7_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2R9A2Q3_BCL2L2-      ---------------------------------GEGPAAD----------
H2Q805_BCL2L2-01        ---------------------------------GEGPAAD----------
A0A096NX09_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K6GWM6_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K6ME72_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K6RW35_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K6RW35_BCL2L2-      ---------------------------------GEGPAAD----------
A0A2K6TM77_BCL2L2-      ---------------------------------GEGPAAD----------
A0A287ATE4_BCL2L2-      ---------------------------------GEGPAAD----------
A0A1U7UJF2_BCL2L2-      ---------------------------------GEGPAAD----------
A0A452SHI1_BCL2L2-      ---------------------------------GEGPAAD----------
Q05KI8_BCL2L2-01        ---------------------------------GEGPAAD----------
Q568V1_MCL1-01          LPTTPDPEELDYAEL-----ERDTRQLLLDFYRTHTGMCPVDRKLH----
Q1L8X3_MCL1-01          LPTTPDPEELDYAEL-----ERDTRQLLLDFYRTHTGMCPVDRKLH----
Q9I9N3_MCL1-01          LPTTPDPEELDYAEL-----ERDTRQLLLDFYRTHTGMCPVDRKLH----
A0A286XUI2_BCL2A1-      -PPRMIDLEFRYTQA-----LAQDYLLHVLQVPQCETSPS----------
A0A452U285_BCL2A1-      GGWKMTDCEFGYTLT-----LAQDYVKHVLQIPQPGSAPS----------
A0A452U285_BCL2A1-      GGWKMTDCEFGYTLT-----LAQDYVKHVLQIPQPGSAPS----------
A0A3B3R4U0_MCL1-01      CEHH--------LRA-----SGNEDGSLPSTPGTPPDCGKMLTFPNRGLS
F7CP56_BCL2A1-03        QKSKRISIFLSMQDE-----IETEE-------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      GASK--A---------------GQGSVPHISK-WLSQPDP-HA-------
A0A3P8WUE9_BCL2-01      GAST-GP---------------GNDGIPNLCK-RPPAPEA-HA-------
A0A3B4A3G8_BCL2-01      RAER---------------------------L-CSAPSDP-HA-------
A0A3Q3G1D7_BCL2-01      EASS-GP---------------DRESIPHLCK-RPPQSDPAYA-------
A0A3Q2XQX2_BCL2-02      -------------------------------D-RSHGSDP-LA-------
A0A3Q2XQX2_BCL2-01      EASS-GP---------------ERDCAP---K-RSHGSDP-LA-------
A0A3Q3B0R2_BCL2-01      GARG-APGGAGTAPP-----DAESDPDPVLCG-RISPHEP-LA-------
A0A3Q2PN77_BCL2-01      DAAAPGQ---------------DSDGDPRRVRGRLSQSDP-HA-------
A0A3P9J8Y9_BCL2-01      DAGT-GP---------------DEESSPRLIR-ALSRADP-LA-------
A0A3Q0S5Z7_BCL2-01      EPSN-GP---------------DGESNTHLCR-RLPQSDP-HA-------
A0A3P8QVM8_BCL2-01      EAST-GP---------------DGESNTHLCR-RLPQSDP-HA-------
A0A3P9DIG5_BCL2-01      EAST-GP---------------DGESNTHLCR-RLPQSDP-HA-------
A0A3Q2UYW8_BCL2-01      EAST-GP---------------DGESNTHLCR-RLPQSDP-HA-------
A0A3B4G3K4_BCL2-01      EAST-GP---------------DGESNTHLCR-RLPQSDP-HA-------
A0A2U9BJ09_BCL2-01      GAST-GP---------------DDESHPDLCR-RPPQSEP-RA-------
A0A3Q1I5N1_BCL2-01      EAST-GP---------------DSDSIPQHCR-RLPPSDP-HA-------
A0A3Q3K1K1_BCL2-01      EAST-GP---------------DSESTPHRCK-RPPQSDM-HA-------
A0A3Q3MEY1_BCL2-01      DAST-GP---------------DSESIPQLCR-GLPQSDP-QA-------
A0A1X9JZA1_BCL2-01      GAST-GP---------------DSESIPHLCT-RLPQSDP-HA-------
A0A4D6FTA2_BCL2-01      EAST-GP---------------DTESIPHLCK-RLPQSDP-HA-------
A0A3Q1FLK7_BCL2-01      EAST-GP---------------DNESDPHLCR-RLPQSDP-HA-------
A0A3Q1B8C3_BCL2-01      EAST-GP---------------DNESDPHLCR-RLPQSDP-HA-------
A0A3P8S9L3_BCL2-01      EAST-GP---------------DNESDPHLCR-RLPQSDP-HA-------
A0A3B5BBQ0_BCL2-01      EAST-GP---------------DNESDPHLCR-RLPQSDP-HA-------
A0A3B4TX71_BCL2-01      EANT-GP---------------DNDSSPNLCR-RLSQSDP-HA-------
A0A3B4YAG2_BCL2-01      EANT-GP---------------DNDSSPNLCR-RLSQSDP-HA-------
Q5XGJ4_BCL2L2-01        ------VP----EPA--------GAASC----------------------
F7G6M3_BCL2L2-01        ------AC----GAG-----PGEGPPAQ----------------------
A0A2K5CWY6_BCL2L2-      ------VC----GAG-----PGEGPAAD----------------------
A0A2K5CWY6_BCL2L2-      ------VC----GAG-----PGEGPAAD----------------------
G3TMU7_BCL2L2-01        ------VC----GAG-----PGEGPAAD----------------------
G1TW27_BCL2-02          PAPA-----------------------------APRDPAA-RTSPPPPPA
E2RS00_BCL2A1-02        PRMT--DCEFGYTLA-----LAQDYVRHVLQIPQPGPAPS-RASR-----
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      PSWH--LA----DSP-----TVNGATGHSRSL-DARKMIP-MT-------
H9GHK7_BCL2L1-01        PSWH--PS----PSH-----VINGASEHPELLEEEEEENP-RV-------
Q07816_BCL2L1-04        PSWH--PP----AGH-----VVNGATVHRSSL-EVHEIVR-AS-------
A0A493TIA6_BCL2L1-      PSWH--PP----AGQ-----VVNGAAVHRSSL-EVHELVQ-SA-------
Q07816_BCL2L1-03        PSWH--PP----AGH-----VVNGATVHRSSL-EVHEIVR-AS-------
Q07816_BCL2L1-02        PSWH--PP----AGH-----VVNGATVHRSSL-EVHEIVR-AS-------
Q07816_BCL2L1-01        PSWH--PP----AGH-----VVNGATVHRSSL-EVHEIVR-AS-------
G1N5N5_BCL2L1-01        PSWH--PP----AGH-----VVNGAAVHRSSL-EVHEIVR-AS-------
A0A452ILL8_BCL2L1-      PSWH--PG----ASH-----IVNGAAGHSNSL-EAHERVP-AT-------
A0A452ILL8_BCL2L1-      PSWH--PG----ASH-----IVNGAAGHSNSL-EAHERVP-AT-------
K7F655_BCL2L1-01        PSWH--PG----ASH-----VVNGAAGHSNSL-EAHERVP-AA-------
A0A452E1B1_BCL2L1-      PSWH--LA----DSS-----VVNGATGHSRSL-DAGKMIP-TA-------
W5PSA5_BCL2L1-01        PSWH--LA----DSP-----VVNGATGHSRSL-DTGKMIP-MA-------
P53563_BCL2L1-02        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
P53563_BCL2L1-03        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A287CZ07_BCL2L1-      PSWH--LA----DSP-----AINGATGHSSSL-DAREVIP-MA-------
A0A3Q2H0F6_BCL2L1-      PSWH--LA----DSP-----TGNGATGHSSSL-DAREVIP-MA-------
F6WA14_BCL2L1-01        PSWH--PA----DSR-----AVSGATGHSSSL-DAHETIP-VA-------
G3WKX6_BCL2L1-01        PSWH--PA----DSR-----AVSGATGHSSSL-DAHETIP-VA-------
M3XA94_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
M3XA94_BCL2L1-02        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
H0X6V2_BCL2L1-01        PSWH--LA----DSP-----TVNGATGHSSSL-DAREVIP-MA-------
G3SPN0_BCL2L1-01        PSRH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
Q2PFS6_BCL2L1-01        PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
O35843_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
M3XA94_BCL2L1-03        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
G1RER8_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A1S2ZQT6_BCL2L1-      PSWH--LA----DSP-----ALNGATGHSSSL-DAREVIP-MA-------
Q64373_BCL2L1-09        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
Q64373_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
P53563_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
O77737_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
Q9MYW4_BCL2L1-01        PAWH--PA----DSP-----AVNGATGHSSSL-DAREVIP-MT-------
A0A3Q2H0F6_BCL2L1-      PSWH--LA----DSP-----TGNGATGHSSSL-DAREVIP-MA-------
L8J061_BCL2L1-01        ASWH--LA----DSP-----AVNGATGHSRSS-DAREVIP-MA-------
Q05KJ0_BCL2L1-02        ASWH--LA----DSP-----AVNGATGHSRSS-DAREVIP-MA-------
Q05KJ0_BCL2L1-01        ASWH--LA----DSP-----AVNGATGHSRSS-DAREVIP-MA-------
E2IV76_BCL2L1-01        PSWH--LA----DSP-----PANGATGHSSSL-DAREVIP-MA-------
A0A2K6G3C5_BCL2L1-      PSWH--LA----DSP-----PANGATGHSSSL-DAREVIP-MA-------
B2Z3Z4_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
G3HEA7_BCL2L1-02        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
G3HEA7_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A1U7T4L4_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
M3Z2H9_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A1U7QU73_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A0D9RJZ8_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A286Y5D6_BCL2L1-      PSWH--LT----DSP-----TVNGATGHSSSL-DAREVIP-MA-------
A0A250YD48_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MT-------
A0A1L5BWY3_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MT-------
I3MUP5_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
I3MUP5_BCL2L1-02        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
I3MUP5_BCL2L1-03        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
G1P9D2_BCL2L1-01        PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5EBP4_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
E2IV75_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
F7IT34_BCL2L1-01        PSWH--LA----DSP-----VVNGATGHSSSL-DAREVIP-MA-------
Q76LT7_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5Q6R6_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5Q6R6_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5M8B1_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5H963_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
Q8SQ42_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5VPG2_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K5YR37_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2R8Z9D7_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A096NV05_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2J8VIH3_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K6QFA2_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K6QFA2_BCL2L1-      PSWH--LV----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A2K6UWY8_BCL2L1-      PAWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
E2IV77_BCL2L1-01        PAWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A452SDS4_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A384D3U1_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSSSL-DAREVIP-MA-------
A0A452FWV3_BCL2L1-      PSWH--LA----DSP-----AVNGATGHSRSL-DAREVIP-MA-------
Q9MZS7_BCL2L1-01        PSWH--LA----DSP-----AVNGATGHSRSL-DAREVIP-MA-------
A0A3B3TCS4_BCL2-01      AGGE--------DAS-----PVRSR-------------TP-RFDPHA---
A0A0U3DHY6_BCL2-01      AVED--------TDS-----PFQNR-------------SP-QPDPHV---
A0A3P9AAB2_BCL2-01      AGED--------NDP-----QFANR-------------IP-QPDPHA---
F6YNL8_BCL2-01          TPLP--AA----A-------------------------------------
A0A218UQA0_BCL2-01      AIAA--AG------T-----SDHTGLVSPHPEPPGSATAS-HT-------
Q00709_BCL2-01          AAVA--AA----GAS-----SHH------RPEPPGSAAAS-EV-------
A0A493T1X3_BCL2-01      VAAA--GT----PSR-----HRPAGLLSPHPEPPGSAAAS-EA-------
U3KEW4_BCL2-01          AVAA--AA----GTS-----SDHTGPVSPHPEPPGSAAAS-PA-------
G3WZW9_BCL2-01          TPLP--AA----PQD-----LATSTTAAARNSPLPPPPAV-AAATV----
A0A452R110_BCL2-02      PPRP--PG----PR---------------RLPPPAAPAAA-AA-------
E2QWA1_BCL2-01          FSGP------------------------ELASPPPPPGPP-AAAAAAAFP
G1LIC9_BCL2-01          SPRP--FV----RR---------------WQVAP--PSAA-AA-------
A0A452R110_BCL2-01      PPRP--PG----PR---------------RLPPPAAPAAA-AA-------
M3YYK3_BCL2-01          PPPP--LS----RHR-----------RPQLTSPATALAAA-A--------
A0A2K6R2I5_BCL2-02      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          TPAP------------------------ARTSPPPPPVAP-AAAAAAA--
G3SLZ1_BCL2-01          PRGP--D---------------------TRTSPLQADP------------
Q75SV7_BCL2-01          APAP------------------------ARTSPPPPPAAP-AAAAAAAAD
M3X1R9_BCL2-01          TPAP------------------------ARTSPPPPPVAP-AAAAAAA--
Q8I008_BCL2-01          TPAP------------------------ARTSPPPPPVAP---AAAAA--
A0A076FU27_BCL2-01      TPAP------------------------SRTSPPPPPAA-----------
A0A4P8GLJ2_BCL2-01      TPAP------------------------SRTSPPPPPAA-----------
F6R2C4_BCL2-01          TPAP------------------------SRTSPPPPPAA-----------
O02718_BCL2-01          TPAP------------------------SRTSPPPPPAA-----------
A0A076FZV9_BCL2-01      TPAP------------------------SRTSPPPPPAA-----------
A0A452EV13_BCL2-01      APAP------------------------SRTSPPPPPAA-----------
A0A250YD83_BCL2-01      NPLP--AA----PRD-----------RAARTTSLPPPVAP-AA-------
A9QXG9_BCL2-01          TPHP--AA----SRD-----------PVARTSPLQTPAAP-GA-------
A0A2K5NZS5_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A0D9S017_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A2K6CIX3_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A2K5XRD4_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A2K6KHG1_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A2K6R2I5_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
A0A2K5HK49_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-AA-------
G3QES9_BCL2-01          TPHP--AA----SRD-----------RVARTSPLQTPAAP-GA-------
H2QEM8_BCL2-01          TPHP--AA----SRD-----------PVARTSPLQTPAAP-GA-------
A0A2I3GZF9_BCL2-01      TPHP--AA----SRD-----------PVARTSPLPTPAAP-GA-------
A0A2K6UEL3_BCL2-01      TPGP--AA----PRD-----------PVARTXXXXXXXXX-XX-------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
H3ANS8_BCL2L1-01        PPNG--SH----PHA-----GLNGAVNGLPAGSSSRLEAQ-AVSGPE---
A0A452FHY1_BCL2L1-      PSWH--LA----HSP-----AVNGA-----TGHTE------ESGPVA---
A0A452FHY1_BCL2L1-      PSWH--LA----HSP-----AVNGA-----TGHTE------ESGPVA---
A0A1S3EPX7_BCL2L1-      PSWH-LAD----SPA-----VVNGA-----TGHSSSSEAR-EVIPMA---
A0A218USB3_BCL2L1-      PSWH--AA----TSH-----IVNGA-----TVHQSSLEVH-EIRRAA---
H0Z8G3_BCL2L1-01        PSWH--AA----TSH-----IVNGA-----TVHQNSLEVH-EIRRAA---
A0A218USB3_BCL2L1-      PSWH--AA----TSH-----IVNGA-----TVHQSSLEVH-EIRRAA---
U3JSL7_BCL2L1-01        PSWH--AP----TSH-----IVNGA-----SVHQSSLEVH-EIRRAA---
A0A218USB3_BCL2L1-      PSWH--AA----TSH-----IVNGA-----TVHQSSLEVH-EIRRAA---
A0A218USB3_BCL2L1-      PSWH--AA----TSH-----IVNGA-----TVHQSSLEVH-EIRRAA---
Q4U2V6_BCL2L1-01        PSWH--AA----TSH-----IVNGA-----TVHQSSLEVH-EIRRAA---
X4ZGI8_BCL2-01          RLQA--PS----AGG-----GNNSE-----CLIANR--VT-RSDPYS---
A0A3B3E2W4_BCL2L1-      ---S--AT----CNG-----TLVNS--------EDGQLKK-SCPCCA---
A0A3B3I2Q5_BCL2L1-      ---S--DA----RNR-----RLVSS--------EDGRLRR-SCPCCA---
A0A3P9I2N4_BCL2L1-      ---S--AA----RNG-----RQVSS--------EDGQLRR-SCPCCA---
A0A3P9MKK4_BCL2L1-      ---S--AA----RNG-----RPVSS--------EDCQLRR-SCPCCA---
A0A3B5B4X7_BCL2L1-      ---S--AA----SNG-----LLVNS--------------------RG---
A0A3B4BFZ8_BCL2L1-      ---N--VP-----NG-----MLTNR------N-GNRQTLA-SLPPDD---
A0A3Q3FUB6_BCL2L1-      ---S--AA----SNG-----FLVNS------RNRAGQSVM-SSSPHT---
A0A3B5MGS2_BCL2L1-      ---R--VP----RNG-----PLVNS--------WAGHPGK-PRGPPA---
M4A558_BCL2L1-01        ---R--VP----SNG-----RLVNS--------RAGPPGK-PRGPMA---
A0A3P9QFB3_BCL2L1-      ---R--GP----SNG-----PLVNS--------RAGSRGK-SQGPP----
A0A087YBW4_BCL2L1-      ---R--GP----SNG-----PLVNS--------WAGSPGK-SRDPPT---
A0A3B3VWI7_BCL2L1-      ---R--GP----SNG-----PLVNS--------WAGSPGK-SRDPPT---
A0A3B3XN57_BCL2L1-      ---R--GP----SNG-----PLVNS--------WAGSPGK-SQDPPT---
A0A3Q2C6K4_BCL2L1-      ---S--AS----SNG-----PLFNS--------RPSPPGK-PRAPHG---
A0A3Q2NRP4_BCL2L1-      ---P--AS----SNG-----PLVSS--------WAGSPWQ-PWAPHG---
A0A0B4KJI5_BCL2L1-      ---S--AA----TNG-----LLANS------SNGGGQPGA-D--------
A0A3Q1JZ46_BCL2L1-      ---S--AA----ANG-----LPVS---------RSGELGN-SSPPCK---
A0A3Q1JZ46_BCL2L1-      ---S--AA----ANG-----LPVS---------RSGELGN-SSPPCK---
A0A3Q3NFM4_BCL2L1-      ---A--AA----TNG-----LLVNS------RYVSGRPGM-SSSPHG---
A0A3Q3NFM4_BCL2L1-      ---A--AA----TNG-----LLVNS------RYVSGRPGM-SSSPHG---
A0A3B4V9K8_BCL2L1-      ---S--AA----SNG-----LLVNS------SDRCGQPGT-SSPPHG---
A0A3B4XS24_BCL2L1-      ---S--AA----SNG-----LLVNS------SDRCGQPGT-SSPPHG---
C1BLI0_BCL2L1-01        ---V--SP----VNG-----SVEND------RNCIGSLGI-SSSPQG---
C0HAD8_BCL2L1-01        ------AI----ANG-----SVGNS------RS---NLAK-PSSPQG---
A0A3B3ZMX9_BCL2L1-      ---L--GL----GDR-----SVDRN-------------ST-PSLRLR---
A0A3B5K6B9_BCL2L1-      ---T--TQ----FNG-----TFNGA--------SPG--TP-PATSLA---
A0A3B5K6B9_BCL2L1-      ---T--TQ----FNG-----TFNGA--------SPG--TP-PATSLA---
H3CH49_BCL2L1-01        ---T--TQ----SNG-----TFNGA--------SPG--TP-PAPSQH---
A0A3B3TFR4_BCL2L1-      ---V--AH----ANG-----SVSSG-----NSVGQG--AP-LEGATP---
A0A3P8XYL5_BCL2L1-      ---T--MH----PNG-----TMNGT-------SPGT--PT-QQSPPSSPR
Q90Z98_BCL2L1-02        ---T--TL----VNG-----TMNRT-----NASSTG--TP-PQSPASSPQ
Q90Z98_BCL2L1-01        ---T--TL----VNG-----TMNRT-----NASSTG--TP-PQSPASSPQ
A0A059PJI5_BCL2L1-      ETPT--AV----VNG-----TLNGT-------GSAG--TP-PRSPTLSPQ
A0A3B4DTL9_BCL2L1-      VTPT--AV----VNG-----SVNGT-------SHG----P-AGSPTSSPQ
A0A3Q2FR43_BCL2L1-      ---E--TH----ANG-----TFNGT--------SPG--SP---------R
B5XAY3_BCL2L1-01        ---L--TY----VNG-----TSPGT--------PPPRQSP-PSSPRR---
W5MG74_BCL2L1-01        ---E--ER----TNG-----AANGG--------GGP--VS-RQPPQG---
A0A2U9BY16_BCL2L1-      ---A--PH----ANG-----TLNGV--------NPG--TP-PESPLR--L
A0A3Q3B3X5_BCL2L1-      ---E--TH----ANG-----TFNGT--------SPG--TP-PASPLR--Q
A0A3B3IB64_BCL2L1-      ---E--TH----ANG-----TFNGT--------TPG--TP-PLSPLR--E
A0A3P9JYH1_BCL2L1-      ---E--TH----ANG-----TFNGT--------TPG--TP-PLSPLR--E
A0A3B3DHA1_BCL2L1-      ---E--TH----ANG-----TFNGT--------SPG--TP-PLSPLR--Q
A0A3Q0RTF8_BCL2L1-      ---D--TH----ANG-----TFNGT--------SPG--TP-PASPQR--Q
I3IZK7_BCL2L1-01        ---D--TH----ANG-----TFNGT--------SPG--TP-PASPQR--Q
A0A2U9BY16_BCL2L1-      ---A--PH----ANG-----TLNGV--------NPG--TP-PESPLR--L
A0A2U9BY16_BCL2L1-      ---A--PH----ANG-----TLNGV--------NPG--TP-PESPLR--L
A0A2U9BY16_BCL2L1-      ---A--PH----ANG-----TLNGV--------NPG--TP-PESPLR--L
A0A0D6DR75_BCL2L1-      ---A--TH----ANG-----TFNGR--------SPG--TP-PASPLR--Q
A0A3Q3WIW8_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TP-PRSPLR---
A0A219P0Y3_BCL2L1-      ---A--TH----ANG-----TFNGM--------SPG--TP-PASPLR--Q
A0A3Q3MX20_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TP-PASPLR--Q
A0A3Q3G2E1_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TP-PASPHRQQQ
A0A3Q3G2E1_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TP-PASPHRQQQ
A0A3Q3G2E1_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TP-PASPHRQQQ
A0A3Q1GZ93_BCL2L1-      ---A--TH----ANG-----TFNGR--------SPG--TP-PASPLR--Q
A0A3Q1GZ93_BCL2L1-      ---A--TH----ANG-----TFNGR--------SPG--TP-PASPLR--Q
A0A3Q1GZ93_BCL2L1-      ---A--TH----ANG-----TFNGR--------SPG--TP-PASPLR--Q
A0A3B4V3T1_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TR-AESPQR--Q
A0A3B4XU17_BCL2L1-      ---A--TH----ANG-----TFNGT--------SPG--TR-PESPQR--Q
A0A3P9MKK4_BCL2L1-      RPVS--SEDCQLRRS-----CPCCA-----S-------------------
A0A3B3I2Q5_BCL2L1-      RLVS--SEDGRLRRS-----CPCCA-----S-------------------
A0A3P9I2N4_BCL2L1-      RQVS--SEDGQLRRS-----CPCCA-----S-------------------
A0A3B4AFB7_MCL1-01      EVLE--SD----TRQ-----LLSDF-----FKLFTG--IS-QPKWKQR--
B9ZYL7_BCL2-01          SSLA--SA-ASSDEE-----TPSNT-----PITFVG--NA-PAVPRRSAS
M3Y8D1_BCL2L10-01       ----------------------------------PG--TP-ARSPST---
A0A3Q2Y539_MCL1-01      GVLD--TE----TRR-----LIGRF-----LRDFTG--LS-TAAWIQS--
A0A3Q3BEB7_BCL2L1-      NGLL--VN----SRD-----GQS----------------------GKKIW
A0A3P8VMA1_BCL2L1-      NGVP--QT----PSA-----VLQ---------------------------
A0A345BSW9_BCL2L1-      AGTT--TL----VNG-----SMN---------RTPP--QS-PATSPQHQT
A0A286MU87_BCL2L1-      VGNY--R------NS-----RSN---------LAKP--SS-P--------
A0A3P8XFS0_BCL2L1-      VGNG--R------NS-----RRN---------LGKP--ST-P--------
A0A3P8XFS0_BCL2L1-      VGNG--R------NS-----RRN---------LGKP--ST-P--------
A0A0F7L1T6_BCL2L1-      NGLL--VR----SRN-----RGG-----------AS--PS-A--------
H2U5I3_BCL2L1-01        NGLL--VR----SRN-----RGG-----------AS--PS-A--------
H2U5I3_BCL2L1-02        NGLL--VR----SRN-----RGG-----------AS--PS-A--------
A0A3Q3J5K3_BCL2L1-      NGLG----------------------------------------------
A0A3Q1EVP6_BCL2L1-      NGLL--VN------N-----RDG---------------------------
A0A3Q1BQA0_BCL2L1-      NGLL--VN------S-----RGG---------------------------
A0A3P8U812_BCL2L1-      NGLL--VN------S-----RGG---------------------------
E6ZFR0_BCL2L1-01        NGLL--AS----KNT-----SGQ---------PGTS--SS-S--------
G3P7B4_BCL2L1-01        PGRG--SS----AGQ-----PGM---------SSPP--PP-P--------
A0A3Q3X5M5_BCL2L1-      NGLL--VN----SSS-----RGG-----------LS--PS-T--------
A0A2U9BIG9_BCL2L1-      NGLL--VD----GGN-----RCGQL-----GTDPLP--PD-G--------
D2ITA2_BCL2L1-02        GNGQ--LA----PSP-----TPQGT-----E-------------------
A0A3B3ZMX9_BCL2L1-      LQRE--TE----VDS-----TELRL-----DSASDS--AP-VHSPAPLLD
G3NJY1_BCL2L1-01        QRGA--TH----SNG-----TFNGT-----S---PG--TP-PASPLLQQR
A0A2U9BY16_BCL2L1-      QQTA--PH----ANG-----TLNGV-----N---PG--TP-PESPLRLQR
A0A3Q3DUT7_BCL2L1-      QRVQ--TP----ANG-----TTNGT-----S--------P-PASPLREAA
A0A3Q3DUT7_BCL2L1-      QRVQ--TP----ANG-----TTNGT-----S--------P-PASPLREAA
A0A3Q3DUT7_BCL2L1-      QRVQ--TP----ANG-----TTNGT-----S--------P-PASPLREAA
A0A3B1JJ42_BCL2L1-      EAAG--VTPTAVVNG-----SVNGT-----SHGAAG--SP-TSSPQRRAN
A0A3P8UWG7_BCL2L1-      QRTS--TH----ANG-----TVNGT-----S---SG--TP-PASPLRQQH
A0A3Q3IVF5_BCL2L1-      ------TH----ANG-----TFNGT-----S---PG--TP-PASPLRQQQ
A0A3Q1DHJ3_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3Q1DHJ3_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3Q1DHJ3_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3P8TL99_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3P8TL99_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3Q1FR00_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3B4Z3X2_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
A0A3B4Z3X2_BCL2L1-      QRTE--TH----ANG-----TFNGT-----S---PG--TP-PPSPRRLAS
C3VIT1_BCL2L1-01        QSTE--TH----ANG-----TFTGT-----S---PG--TP-PVSPLRQQP
A0A3P8P0F1_BCL2L1-      QRID--TH----ANG-----TFNGT-----S---PG--TP-PASPQRRQQ
A0A3Q2X557_BCL2L1-      QRID--TH----ANG-----TFNGT-----S---PG--TP-PASPQRRQQ
A0A3P9D632_BCL2L1-      QRID--TH----ANG-----TFNGT-----S---PG--TP-PASPQRRQQ
A0A3P9D632_BCL2L1-      QRID--TH----ANG-----TFNGT-----S---PG--TP-PASPQRRQQ
A0A3Q4N4B5_BCL2L1-      QRID--TH----ANG-----TFNGT-----S---PG--TP-PASPQRRQQ
A0A3B4FNX1_BCL2L1-      QRID--TH----ANG-----TFNGT-----S---PG--TP-PASPQRRQQ
A0A3Q2QPL9_BCL2L1-      QTAE--TH----ANG-----TVNGT-----S---SG--SP-RRRQQQPAS
A0A3B5PQJ0_BCL2L1-      QTLE--TH----ANG-----TFNGT-----S---PG--SP-RR--HQAAS
A0A087X9B7_BCL2L1-      QTLE--TH----ANG-----TFNGT-----S---PG--SP-RR--QQAAS
A0A3B3TUS7_BCL2L1-      QTLE--TH----ANG-----TFNGT-----S---PG--SP-RR--QQAAS
A0A3B3WI27_BCL2L1-      QTLE--TH----ANG-----TFNGT-----S---PG--SP-RR--QQAAS
A0A3P9N9Y4_BCL2L1-      QTLE--TH----ANG-----TFNGT-----S---PG--SP-RR--QQAAS
A0A3B3QRZ2_BCL2L1-      VNGS--VI----AGG-----TSSQV-----S---PV--PE-Q--------
Q564A4_BCL2-01          SSPN--SD----RRL-----QAPSA-----G---GG--NN-SECLIARVT
H9GPE7_BCL2-01          TNAP--RE----EPD-----------------------------------
A0A452I9V7_BCL2-01      AGLM--SL----PPE-----PPGSA-----A---AS--NV-P--------
W5N4F7_BCL2-01          AGAE--RG----AVP-----VPRRT-----P---PP--DP-H--------
K7F5Y3_BCL2-02          AGLV--SL----PPE-----PPGSA-----A---AS--NV-P--------
A0A3Q2HRY3_BCL2-02      TPAP------------------ART-----S---PL--LP-P---AAPAG
H0YUX3_BCL2-01          IAAA--GT----SDH-----TGLVS-----P---HP--EP-PGSATASHT
K7F5Y3_BCL2-01          AGLV--SL----PPE-----PPGSA-----A---AS--NV-P--------
F1LNV0_BCL2-01          NRTP--AV----HRD-----TAART-----S---PL--RP-L------VA
P49950_BCL2-01          NRTP--AV----HRD-----TAART-----S---PL--RP-L------VA
G1TW27_BCL2-01          --AP--AA----PRD-----PAART-----S---PP--PP-P-------A
A0A2K5EB04_BCL2-01      TPGP--AA----PRD-----PVSRT-----S---PP--PP-P--AAPAAA
A0A2R8MY14_BCL2-01      TPGP--AA----PRD-----PVART-----S---PP--PP-P--AAPAAA
H2NWH5_BCL2-01          TPHP--AA----SRD-----P-ART-----S---PL--PT-P---AAPGA
A0A096MPU7_BCL2-01      TPHP--AA----SRD-----PVART-----S---PL--PT-P---AAPAA
A0A2K5PP81_BCL2-01      TPGP--AA----PRD-----PVART-----S---PP--SP-P--AAPAAA
H0WKI0_BCL2-01          TPTP--AA----PRD-----PAART-----S---PP--AA-P----AAAA
A0A2K5UDI5_BCL2-01      TPHP--AA----SRD-----PVART-----S---PL--PT-PAAPAAAAA
P10417_BCL2-01          NPMP--AV----HRD-----MAART-----S---PL--RP-L------VA
Q7TSN8_BCL2-01          NPMP--AV----HRD-----MAART-----S---PL--RP-L------VA
A0A3Q2HRY3_BCL2-01      TPAP--A------RT-----SPLLP-----P---A----A-P------AG
E2QWA1_BCL2-02          XXXX--XX----XXX-----XXXXX-----X---X----X-X------XX
A0A2K6G3I7_BCL2-01      NPPP--AA----PRD-----PAART-----S---P----P-P------AA
Q6R755_BCL2-01          NPTP--AV----HRD-----MAART-----S---PL--RP-I------VA
Q9JJV8_BCL2-01          NPTP--AV----HRD-----MAART-----S---PL--RP-I------VA
Q923R6_BCL2-01          NPTP--AV----HRD-----MAART-----S---PL--RP-I------VA
H0W1T3_BCL2-01          ------------PRD-----PAART-----S---PP--PP-L---AGLAV
G1LIC9_BCL2-02          ------------------------------------------------AA
I3MVK9_BCL2-01          ------------SHT-----PAART-----S---PP--PP-P---AAPAA
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------RLASTATMDA--
F6VJQ0_BCL2L10-01       DYKCALREETARLVTDYL--------------------------------
A0A2K5DMS4_MCL1-01      -----------------------------------------ATGAKDT--
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          -DMAEFRKETLKLLRSYL---------------------CEVAGCEST--
J7H260_MCL1-01          CSPDPLHTETRALLHTFF--------------------REWAGDAKQ---
G1PZ39_MCL1-01          -EEDELFRQSLEIISRY---------------------REQATGAKDA--
Q9Z1P3_MCL1-01          -EDDELYHQSLEIISRYL--------------------REQATGSKDA--
A5PJR2_MCL1-01          -EEDELYRQSLEIISQYL--------------------REQATGAKDA--
A0A452GA25_MCL1-01      -EEDELYRQSLEIISQYL--------------------LEQATGAKDA--
G1L3L7_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDA--
G1T2Q0_MCL1-01          -EEDELYRQSLEIIARYL--------------------REQATGAKDA--
F7AVA6_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGTKDT--
A0A337S3J9_MCL1-01      -EEDELFRQSLEIISRYL--------------------REQATGAKDA--
A0A337S3J9_MCL1-03      -EEDELFRQSLEIISRYL--------------------REQATGAKDA--
Q7YRZ9_MCL1-01          -EEDELFRQSLEIISRYL--------------------REQATGAKDA--
F1PAP1_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDA--
Q8HYS5_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDA--
M3XZZ5_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDA--
A0A452RHX5_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDA--
H0XFB7_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDA--
F7GTF7_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5CFH3_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K6V5Y3_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K6KRW9_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5XSB2_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A0D9RZP5_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
I7G687_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5LXU8_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2I3GJZ3_MCL1-02      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
H2N5Y9_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2R9BPJ5_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2I3RTV4_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2I2YQH7_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5C7L5_MCL1-01      --------TSLEIISRYL--------------------REQATGAKDT--
A0A2K5I9I0_MCL1-02      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K6GI15_MCL1-01      -EDDELYRQSLEIISRYL--------------------REQATGAKDA--
A0A2I3GJZ3_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5CFH3_MCL1-03      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5R5E2_MCL1-03      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K5W0W9_MCL1-01      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K6ECR0_MCL1-02      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2I3LFM0_MCL1-01      -EEDELYRQSLEIISWYL--------------------REQATGAKDT--
A0A2K6KRW9_MCL1-02      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
A0A2K6PPI3_MCL1-02      -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          EEEDELYGQSLELITRYL--------------------REQAVGTKDT--
W5QI41_MCL1-01          -EEDELYRQSLEIISQYL--------------------LEQATGTKDA--
F1MQX4_MCL1-01          -EEDELYWQSLEIISRYL--------------------REQATGAKDV--
A0A287BK44_MCL1-03      ----MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGAKDA--
B4DLY8_MCL1-01          -PDSR---------------------------------RVARPPPKDT--
B4DG83_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
B4E3L8_MCL1-01          -EEDELYRQSLEIISRYL--------------------REQATGAKDT--
H3AR18_MCL1-02          GDMAEFRKETLKLLRSYL--------------------CEVAGCESTE--
E2RS00_BCL2A1-01        GSSRGTRLPSRRAGGPRM--------------------TDCEFGYTLA--
B6V6J0_MCL1-01          CPKDGLYMDTQQLILAFY--------------------RVYSGEESGE--
G3PJT0_MCL1-01          AGAAALESDTRQLLGRFL--------------------REFTGLSKTQWN
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6TM77_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K5RUN8_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6GWM6_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
W5QDH4_BCL2L2-01        ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6ME72_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6RW35_BCL2L2-      ---------VADFLGYKL--------------------RQKGYVCGAG--
A0A287ATE4_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2R8M4C0_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGTG--
A0A452UF16_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K5MZX9_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K5HEJ9_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K5V0Q3_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
F7G4L5_BCL2L2-02        ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6EA59_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6AI25_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A1U7RC37_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2I3GEA7_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2R9A2Q3_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
H2Q805_BCL2L2-02        ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A096NX09_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A287ATE4_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A4D6NWN1_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A1U7UJF2_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A452UF16_BCL2L2-      ---------VADFVGYKL--------------------RQKGYVCGAG--
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          EEL-----SLLEMIPQHL--------------------RE-RAGARDQ--
H9GEA6_MCL1-02          -----LRKTTLEVVGRYL--------------------REAADEAGSKGT
H9GEA6_MCL1-01          -----LRKTTLEVVGRYL--------------------REAADEAGSKGT
A0A493U0E8_MCL1-01      ----RGRGGDLTILGWFH--------------------PTQKRAPEPAGR
A0A1L1RNM6_MCL1-01      LIPDELRQESLELILRYL--------------------REAAGEAEPGVK
A0A1L1RNM6_MCL1-02      LIPDELRQESLELILRYL--------------------REAAGEAEPGVK
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          EEEDELYGQSLELISRYL--------------------REQAVGTKEA--
F6ZMX1_MCL1-03          EEEDELYGQSLELISRYL--------------------REQAVGTKEA--
F6ZMX1_MCL1-02          EEEDELYGQSLELISRYL--------------------REQAVGTKEA--
G1T2Q0_MCL1-02          -----------------------------------------ATGAKDA--
F1PAP1_MCL1-02          -----------------------------------------ATGAKDA--
A0A337S3J9_MCL1-04      -----------------------------------------ATGAKDA--
F7AVA6_MCL1-02          -----------------------------------------ATGTKDT--
A0A2K6GI15_MCL1-03      -----------------------------------------ATGAKDA--
C8YZ26_MCL1-01          -----------------------------------------ATGAKDT--
F7GTF7_MCL1-02          -----------------------------------------ATGAKDT--
A0A2K5R5E2_MCL1-04      -----------------------------------------ATGAKDT--
A0A2K6V5Y3_MCL1-03      -----------------------------------------ATGAKDT--
A0A2K5LXU8_MCL1-03      -----------------------------------------ATGAKDT--
A0A2K5I9I0_MCL1-03      -----------------------------------------ATGAKDT--
A0A2I2YQH7_MCL1-03      -----------------------------------------ATGAKDT--
Q07820_MCL1-04          -----------------------------------------ATGAKDT--
A0A2K5W0W9_MCL1-03      -----------------------------------------ATGAKDT--
A0A2K6ECR0_MCL1-03      -----------------------------------------ATGAKDT--
A0A2K5XSB2_MCL1-03      -----------------------------------------ATGAKDT--
A0A2R9BPJ5_MCL1-03      -----------------------------------------ATGAKDT--
A0A2I3RTV4_MCL1-03      -----------------------------------------ATGAKDT--
A0A2I3LFM0_MCL1-03      -----------------------------------------ATGAKDT--
A0A2K6PPI3_MCL1-03      -----------------------------------------ATGAKDT--
A0A286Y1M5_MCL1-01      EEEDALYRQSLEIISRYL--------------------REQAAGAKDS--
B4DU51_MCL1-01          EDE--LYRQSLEIISRYL--------------------REQATGAKDT--
A0A287DCH9_MCL1-02      DDE--LYRQSLEIISRYL--------------------REQATGSKDA--
P97287_MCL1-01          EDD--LYRQSLEIISRYL--------------------REQATGSKDS--
A0A452GA25_MCL1-02      EDE--LYRQSLEIISQYL--------------------LEQATGAKDA--
A0A287DCH9_MCL1-01      DDE--LYRQSLEIISRYL--------------------REQATGSKDA--
G3T756_MCL1-01          EDE--LYRQSLEIISRYL--------------------QEQATGAKDT--
A0A1S3F3I1_MCL1-01      DDE--LYRQSLEIICRYL--------------------REQATGAKDA--
G1L3L7_MCL1-02          EDE--LYRQSLEIISRYL--------------------REQATGAKDA--
A0A287BK44_MCL1-01      EDE--LYRQSLEIISRYL--------------------REQATGAKDA--
A0A287BK44_MCL1-02      EDE--LYRQSLEIISRYL--------------------REQATGAKDA--
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
W5MMB7_MCL1-01          -------------EFLSEAHG-QLNAETRELIGTFLQMYTGL--------
A0A3B3SG34_MCL1-01      -------------CGFSRSAVEMLDQETSELITTFFAEYTGL--------
Q4SW32_MCL1-01          -------------SGRPAGDEAALDSDTRQLVSRLMADVTGI--------
D2ITA0_MCL1-03          ---------------SQAGEE-VLDNDTKRIIRIFLRDYAGA--------
D2ITA0_MCL1-04          ---------------SQAGEE-VLDNDTKRIIRIFLRDYAGA--------
A0A3P9ILF6_MCL1-01      -------------SGDNSGID-ALNEDTTEFLTNFFRNFVGI--------
A0A3P9ILF6_MCL1-02      -------------SGDNSGID-ALNEDTTEFLTNFFRNFVGI--------
Q0KFR9_MCL1-01          -------------SNCPSGDE-VLEHDTRQLIENFLGDYTGL--------
A0A3P8Y1W8_MCL1-02      -------------SHCPSGNE-VLDNDTRQLIENLLRDYTGL--------
A0A3P8Y1W8_MCL1-01      -------------SHCPSGNE-VLDNDTRQLIENLLRDYTGL--------
A0A3Q2XZL8_MCL1-01      -----------------GRND-VVDAETKGLIRRFLTDFTGL--------
A0A3B4AFB7_MCL1-02      -------------SSYSAEHE-VLESDTRQLLSDFFKLFTGI--------
A0A3B3VM25_MCL1-01      -------------SAVRASNQ-VLDNDTMELIGSFLRNFTGL--------
A0A3Q0R633_MCL1-01      -------------------DE-ALERETKSLITSFFRDFTGL--------
A0A3Q0R633_MCL1-03      -------------------DE-ALERETKSLITSFFRDFTGL--------
A0A3B4T8L9_MCL1-02      -------------PSCPAGDE-VLEDDTRQLISQSMKSFTGR--------
A0A3B4T8L9_MCL1-01      -------------PSCPAGDE-VLEDDTRQLISQSMKSFTGR--------
A0A3Q1EQB9_MCL1-02      -------------SSCPTGDE-LLENDTRQLIRRFLRDFTGL--------
A0A3B4ZKP6_MCL1-01      -------------SSCPAGDE-VLENDTRQLISSFLKDFTGL--------
A0A3Q1BKL8_MCL1-02      -------------SSCPAGDE-LLENDTRQLLRRFLRDFTGL--------
A0A3Q1EQB9_MCL1-01      -------------SSCPTGDE-LLENDTRQLIRRFLRDFTGL--------
A0A3Q1BKL8_MCL1-01      -------------SSCPAGDE-LLENDTRQLLRRFLRDFTGL--------
A0A3P8RQX7_MCL1-01      -------------SSCPAGDE-LLENDTRQLLRRFLRDFTGL--------
A0A3P8RQX7_MCL1-02      -------------SSCPAGDE-LLENDTRQLLRRFLRDFTGL--------
A0A3Q3VP02_MCL1-01      -------------SGCLAGDE-LLEKDTRQLISRVLMELSGH--------
A0A3B5K5B3_MCL1-01      -------------SGRPAEDEAALDNDTRQLLSCFMADFCGI--------
A0A3B3IJ04_MCL1-01      -------------SGDNSGID-ALNEDTTEFLTNFFRNFVGI--------
A0A3P9L1F3_MCL1-01      -------------SGDNSGID-ALNEDTTEFLTNFFRNFVGI--------
A0A3B3IJ04_MCL1-02      -------------SGDNSGID-ALNEDTTEFLTNFFRNFVGI--------
A0A3P9L1F3_MCL1-02      -------------SGDNSGID-ALNEDTTEFLTNFFRNFVGI--------
A0A3B3CEX1_MCL1-02      -------------LVPND--P-PINQDTTEFLTNFFRNYVGL--------
A0A3B3CEX1_MCL1-01      -------------LVPND--P-PINQDTTEFLTNFFRNYVGL--------
A0A3Q3B4P5_MCL1-01      ----------------GAEDE-VLENDTKHLISRFLQEFTGL--------
A0A3Q3B4P5_MCL1-02      ----------------GAEDE-VLENDTKHLISRFLQEFTGL--------
A0A3Q2EDX8_MCL1-01      -------------PGGHAGDE-ALDNDTKELISSFLRDFTGL--------
A0A3Q2P7X9_MCL1-01      -------------CGSHAGQE-ALDSDTTELISGFLRDFTGL--------
A0A3Q2P7X9_MCL1-02      -------------CGSHAGQE-ALDSDTTELISGFLRDFTGL--------
A0A3B5PQ55_MCL1-02      -------------TAVGASNQ-VLDNDTTELISSFLRDFTGL--------
A0A3B5PQ55_MCL1-01      -------------TAVGASNQ-VLDNDTTELISSFLRDFTGL--------
A0A3P9Q4I8_MCL1-02      -------------SAVRASNQ-VLDNDTTELISSFLRNFTGL--------
A0A3P9Q4I8_MCL1-01      -------------SAVRASNQ-VLDNDTTELISSFLRNFTGL--------
A0A087X830_MCL1-01      -------------SAVRASNQ-VLDNDTMELISSFLRNFTGL--------
A0A3B3YCD0_MCL1-01      -------------SAVRASNQ-VLDNDTMELISSFLRHFTGL--------
I3JHR5_MCL1-01          ----------------GESDE-ELERETKLLIHSFLGDFTGL--------
A0A3Q4HLQ8_MCL1-01      ----------------SESDE-QLERETKLLIHSFLGDFTGL--------
A0A3P8NP63_MCL1-02      ----------------SESDE-QLERETKLLIHSFLGDFIGL--------
A0A3Q2VNL8_MCL1-01      ----------------SESDE-QLERETKLLIHSFLGDFTGL--------
A0A3P8NP63_MCL1-01      ----------------SESDE-QLERETKLLIHSFLGDFIGL--------
A0A3P9BVM3_MCL1-01      ----------------SESDE-QLERETKLLIHSFLGDFIGL--------
A0A3B4G4Z6_MCL1-01      ----------------SESDE-QLERETKLLIHSFLGDFTGL--------
A0A2U9CJ81_MCL1-01      -------------SGCPAADE-ALDSFTRELISQFLRDYVAR--------
A0A3P8VKM5_MCL1-05      -------------DVSQAGDE-VLDTDTKELIFQFYRDFTTH--------
A0A3P8VKM5_MCL1-04      -------------DVSQAGDE-VLDTDTKELIFQFYRDFTTH--------
A0A3P8VKM5_MCL1-03      -------------DVSQAGDE-VLDTDTKELIFQFYRDFTTH--------
A0A3Q3IZW0_MCL1-01      -------------SSSPAEYE-VLENDTRLLICHFLRDYTGL--------
A0A3Q1GX28_MCL1-02      -------------SSCPAGDE-VLENDTRQLLSQFLQDFSGL--------
A0A3Q1GX28_MCL1-01      -------------SSCPAGDE-VLENDTRQLLSQFLQDFSGL--------
A0A3B4XKA5_MCL1-01      -------------PSCPAG-E-VLESDTSQLISQSMKSFTGR--------
A0A3Q3GP42_MCL1-01      -------------SSCPTGGE-VLESDTRQLISAFLREHTGL--------
A0A3Q3M6G2_MCL1-01      -------------PSCPAGDE-VLENDTRQLICQYLKDVSGL--------
A0A3Q3M6G2_MCL1-02      -------------PSCPAGDE-VLENDTRQLICQYLKDVSGL--------
A0A3B1IEV7_MCL1-01      ---------------SCRCPG-ALEAETRRLMVEFYRGYLG---------
A0A3B4CGU9_MCL1-03      ------------------GGS-ALVEETRRLIGGFYRGYIG---------
A0A3B4CGU9_MCL1-02      TISLCDGEVTVLIKPKPKGRV-RLEEETLCIIGDFYQGY-----------
Q8UWD6_MCL1-01          --------------------T-ALDMDTREIIDTFLKIFTGL--------
A2BF68_MCL1-01          --------------------T-ALDMDTREIIDTFLKIFTGL--------
Q568W5_MCL1-01          --------------------T-ALDMDTREIIDTFLIIFTGL--------
A0A3B1K5R1_MCL1-01      ---------------NCKQYE-TLDGDTREIISDFLRNFCGL--------
A0A3B4C6H5_MCL1-01      ---------------QFKESE-TLDRDTSEIVIDFLQNFTGL--------
A0A3B4C6H5_MCL1-03      ---------------QFKESE-TLDRDTSEIVIDFLQNFTGL--------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      QETHELIGTFLRTYSGLPASASRH--------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
G1TW27_BCL2-02          AAGPALSPVPP---------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
F6YNL8_BCL2-01          AAGPTVSPVPP---------------------------------------
A0A218UQA0_BCL2-01      PPAEGLRPAPQ---------------------------------------
Q00709_BCL2-01          PPAEGLRPAPP---------------------------------------
A0A493T1X3_BCL2-01      PPGEGLRPAPP---------------------------------------
U3KEW4_BCL2-01          PPAEGLRPAPQ---------------------------------------
G3WZW9_BCL2-01          AAGPAVSPVPP---------------------------------------
A0A452R110_BCL2-02      AAGPALSPVPP---------------------------------------
E2QWA1_BCL2-01          PRAPXXSPVPP---------------------------------------
G1LIC9_BCL2-01          AAGPALSPVPP---------------------------------------
A0A452R110_BCL2-01      AAGPALSPVPP---------------------------------------
M3YYK3_BCL2-01          AAGPALSPVPP---------------------------------------
A0A2K6R2I5_BCL2-02      AAGPALSPVPP---------------------------------------
A0A2R9APW6_BCL2-01      -----LSPVPP---------------------------------------
M3X1R9_BCL2-02          AAGPALSPVPP---------------------------------------
G3SLZ1_BCL2-01          AAQPALSPVPP---------------------------------------
Q75SV7_BCL2-01          AAGPAPSPVPP---------------------------------------
M3X1R9_BCL2-01          AAGPALSPVPP---------------------------------------
Q8I008_BCL2-01          AAGPALSPVPP---------------------------------------
A0A076FU27_BCL2-01      AAGPAPSPVPP---------------------------------------
A0A4P8GLJ2_BCL2-01      AAGPAPSPVPP---------------------------------------
F6R2C4_BCL2-01          AAGPAPSPVPP---------------------------------------
O02718_BCL2-01          AAGPAPSPVPP---------------------------------------
A0A076FZV9_BCL2-01      AAGPAPSPVPP---------------------------------------
A0A452EV13_BCL2-01      AAGPAPSPVPP---------------------------------------
A0A250YD83_BCL2-01      RAGPALSPVPP---------------------------------------
A9QXG9_BCL2-01          AAGPALSPVPP---------------------------------------
A0A2K5NZS5_BCL2-01      AAGPALSPVPP---------------------------------------
A0A0D9S017_BCL2-01      AAGPALSPVPP---------------------------------------
A0A2K6CIX3_BCL2-01      AAGPALSPVPP---------------------------------------
A0A2K5XRD4_BCL2-01      AAGPALSPVPP---------------------------------------
A0A2K6KHG1_BCL2-01      AAGPALSPVPP---------------------------------------
A0A2K6R2I5_BCL2-01      AAGPALSPVPP---------------------------------------
A0A2K5HK49_BCL2-01      AAGPALSPVPP---------------------------------------
G3QES9_BCL2-01          AAGPALSPVPP---------------------------------------
H2QEM8_BCL2-01          AAGPALSPVPP---------------------------------------
A0A2I3GZF9_BCL2-01      AAGPALSPVPP---------------------------------------
A0A2K6UEL3_BCL2-01      XXXXXXSPVPP---------------------------------------
G3WZW9_BCL2-02          AAGPAVSPVPP---------------------------------------
G3SLZ1_BCL2-02          AAQPALSPVPP---------------------------------------
A0A452T603_BCL2-01      -------PVPP---------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A3B3E2W4_BCL2L1-      -------SMD----------------------------------------
A0A3B3I2Q5_BCL2L1-      -------SMD----------------------------------------
A0A3P9I2N4_BCL2L1-      -------SMD----------------------------------------
A0A3P9MKK4_BCL2L1-      -------SMD----------------------------------------
A0A3B5B4X7_BCL2L1-      -------GIE----------------------------------------
A0A3B4BFZ8_BCL2L1-      -------HLD----------------------------------------
A0A3Q3FUB6_BCL2L1-      -------DIE----------------------------------------
A0A3B5MGS2_BCL2L1-      -------GVE----------------------------------------
M4A558_BCL2L1-01        -------GVE----------------------------------------
A0A3P9QFB3_BCL2L1-      --------VE----------------------------------------
A0A087YBW4_BCL2L1-      -------GVK----------------------------------------
A0A3B3VWI7_BCL2L1-      -------GVK----------------------------------------
A0A3B3XN57_BCL2L1-      -------GVE----------------------------------------
A0A3Q2C6K4_BCL2L1-      -------SIE----------------------------------------
A0A3Q2NRP4_BCL2L1-      -------RAE----------------------------------------
A0A0B4KJI5_BCL2L1-      --------IE----------------------------------------
A0A3Q1JZ46_BCL2L1-      -------SME----------------------------------------
A0A3Q1JZ46_BCL2L1-      -------SME----------------------------------------
A0A3Q3NFM4_BCL2L1-      -------GVE----------------------------------------
A0A3Q3NFM4_BCL2L1-      -------GVE----------------------------------------
A0A3B4V9K8_BCL2L1-      -------GIE----------------------------------------
A0A3B4XS24_BCL2L1-      -------GIE----------------------------------------
C1BLI0_BCL2L1-01        -------GIE----------------------------------------
C0HAD8_BCL2L1-01        -------GME----------------------------------------
A0A3B3ZMX9_BCL2L1-      -----LDSAS----------------------------------------
A0A3B5K6B9_BCL2L1-      ------TSLD----------------------------------------
A0A3B5K6B9_BCL2L1-      ------TSLD----------------------------------------
H3CH49_BCL2L1-01        --QQSLTSLD----------------------------------------
A0A3B3TFR4_BCL2L1-      ------QGLE----------------------------------------
A0A3P8XYL5_BCL2L1-      RTV----GLD----------------------------------------
Q90Z98_BCL2L1-02        RQTNGSGGLD----------------------------------------
Q90Z98_BCL2L1-01        RQTNGSGGLD----------------------------------------
A0A059PJI5_BCL2L1-      RQVNGSASLE----------------------------------------
A0A3B4DTL9_BCL2L1-      RRSNGAGGLD----------------------------------------
A0A3Q2FR43_BCL2L1-      RQQASTAAME----------------------------------------
B5XAY3_BCL2L1-01        -----TAGLD----------------------------------------
W5MG74_BCL2L1-01        --------IE----------------------------------------
A0A2U9BY16_BCL2L1-      QRLPSSPSLD----------------------------------------
A0A3Q3B3X5_BCL2L1-      QPLPTTANMD----------------------------------------
A0A3B3IB64_BCL2L1-      QQLPSTTNMD----------------------------------------
A0A3P9JYH1_BCL2L1-      QQLPSTTNMD----------------------------------------
A0A3B3DHA1_BCL2L1-      QQLPSTTNMD----------------------------------------
A0A3Q0RTF8_BCL2L1-      QQPPSTTNLD----------------------------------------
I3IZK7_BCL2L1-01        QQPPSTTDLD----------------------------------------
A0A2U9BY16_BCL2L1-      QRLPSSPSLD----------------------------------------
A0A2U9BY16_BCL2L1-      QRLPSSPSLD----------------------------------------
A0A2U9BY16_BCL2L1-      QRLPSSPSLD----------------------------------------
A0A0D6DR75_BCL2L1-      QRLPSPTSLD----------------------------------------
A0A3Q3WIW8_BCL2L1-      -LQPSTTSLD----------------------------------------
A0A219P0Y3_BCL2L1-      QQLPSTTSLD----------------------------------------
A0A3Q3MX20_BCL2L1-      EHLQSTASLD----------------------------------------
A0A3Q3G2E1_BCL2L1-      QRLPATTNLD----------------------------------------
A0A3Q3G2E1_BCL2L1-      QRLPATTNLD----------------------------------------
A0A3Q3G2E1_BCL2L1-      QRLPATTNLD----------------------------------------
A0A3Q1GZ93_BCL2L1-      QRLPSTTSLD----------------------------------------
A0A3Q1GZ93_BCL2L1-      QRLPSTTSLD----------------------------------------
A0A3Q1GZ93_BCL2L1-      QRLPSTTSLD----------------------------------------
A0A3B4V3T1_BCL2L1-      QRLPSTTSLD----------------------------------------
A0A3B4XU17_BCL2L1-      QRLPSTTSLD----------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          AVSPLAELNVEPRDLNVNPDASRAADGDNNDADGGDEAVMQP--------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      PRRS----------------------------------DIE---------
A0A3P8VMA1_BCL2L1-      -HCS----------------------------------GAE---------
A0A345BSW9_BCL2L1-      NGSG----------------------------------GLD---------
A0A286MU87_BCL2L1-      --QG----------------------------------GME---------
A0A3P8XFS0_BCL2L1-      --QG----------------------------------CME---------
A0A3P8XFS0_BCL2L1-      --QG----------------------------------CME---------
A0A0F7L1T6_BCL2L1-      --GA----------------------------------GIE---------
H2U5I3_BCL2L1-01        --GA----------------------------------GIE---------
H2U5I3_BCL2L1-02        --GA----------------------------------GIE---------
A0A3Q3J5K3_BCL2L1-      ---------------------------------------IE---------
A0A3Q1EVP6_BCL2L1-      ---------------------------------------IE---------
A0A3Q1BQA0_BCL2L1-      ---------------------------------------IE---------
A0A3P8U812_BCL2L1-      ---------------------------------------IE---------
E6ZFR0_BCL2L1-01        --GA----------------------------------DIE---------
G3P7B4_BCL2L1-01        --SG----------------------------------DTE---------
A0A3Q3X5M5_BCL2L1-      --GA----------------------------------DME---------
A0A2U9BIG9_BCL2L1-      --G------------------------------------VG---------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        SPST----------------------------------AS----------
A0A2U9BY16_BCL2L1-      LPSS----------------------------------PS----------
A0A3Q3DUT7_BCL2L1-      S-------------------------------------------------
A0A3Q3DUT7_BCL2L1-      S-------------------------------------------------
A0A3Q3DUT7_BCL2L1-      S-------------------------------------------------
A0A3B1JJ42_BCL2L1-      GARG----------------------------------------------
A0A3P8UWG7_BCL2L1-      SASD----------------------------------TS----------
A0A3Q3IVF5_BCL2L1-      LPST----------------------------------AN----------
A0A3Q1DHJ3_BCL2L1-      TAT-----------------------------------------------
A0A3Q1DHJ3_BCL2L1-      TAT-----------------------------------------------
A0A3Q1DHJ3_BCL2L1-      TAT-----------------------------------------------
A0A3P8TL99_BCL2L1-      TAT-----------------------------------------------
A0A3P8TL99_BCL2L1-      TAT-----------------------------------------------
A0A3Q1FR00_BCL2L1-      TAT-----------------------------------------------
A0A3B4Z3X2_BCL2L1-      TAT-----------------------------------------------
A0A3B4Z3X2_BCL2L1-      TAT-----------------------------------------------
C3VIT1_BCL2L1-01        LPST----------------------------------TTTT--------
A0A3P8P0F1_BCL2L1-      QPPS----------------------------------TTD---------
A0A3Q2X557_BCL2L1-      QPPS----------------------------------TTD---------
A0A3P9D632_BCL2L1-      QPPS----------------------------------TTD---------
A0A3P9D632_BCL2L1-      QPPS----------------------------------TTD---------
A0A3Q4N4B5_BCL2L1-      QPPS----------------------------------TTD---------
A0A3B4FNX1_BCL2L1-      QPPS----------------------------------TTD---------
A0A3Q2QPL9_BCL2L1-      TAA-----------------------------------------------
A0A3B5PQJ0_BCL2L1-      AST-----------------------------------------------
A0A087X9B7_BCL2L1-      AAT-----------------------------------------------
A0A3B3TUS7_BCL2L1-      AAT-----------------------------------------------
A0A3B3WI27_BCL2L1-      AAT-----------------------------------------------
A0A3P9N9Y4_BCL2L1-      AST-----------------------------------------------
A0A3B3QRZ2_BCL2L1-      ---P----------------------------------LHSP--------
Q564A4_BCL2-01          RSDP----------------------------------HLR---------
H9GPE7_BCL2-01          -----------------------------------------P--------
A0A452I9V7_BCL2-01      -LGD----------------------------------GLRP--------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          -LGD----------------------------------GLRS--------
A0A3Q2HRY3_BCL2-02      AAGP----------------------------------ALSP--------
H0YUX3_BCL2-01          PPAE----------------------------------GLRP--------
K7F5Y3_BCL2-01          -LGD----------------------------------GLRS--------
F1LNV0_BCL2-01          TAGP----------------------------------ALSP--------
P49950_BCL2-01          NAGP----------------------------------ALSP--------
G1TW27_BCL2-01          AAGP----------------------------------ALSP--------
A0A2K5EB04_BCL2-01      ATGP----------------------------------ALSP--------
A0A2R8MY14_BCL2-01      ATGP----------------------------------TLSP--------
H2NWH5_BCL2-01          AVGP----------------------------------ALSP--------
A0A096MPU7_BCL2-01      AAGP----------------------------------ALSP--------
A0A2K5PP81_BCL2-01      ATGP----------------------------------ALSP--------
H0WKI0_BCL2-01          AAEP----------------------------------LLSP--------
A0A2K5UDI5_BCL2-01      AAGP----------------------------------ALSP--------
P10417_BCL2-01          TAGP----------------------------------ALSP--------
Q7TSN8_BCL2-01          TAGP----------------------------------ALSP--------
A0A3Q2HRY3_BCL2-01      AAGP----------------------------------ALSP--------
E2QWA1_BCL2-02          XXXX----------------------------------XXSP--------
A0A2K6G3I7_BCL2-01      AAGP----------------------------------APSP--------
Q6R755_BCL2-01          TTGP----------------------------------TLSP--------
Q9JJV8_BCL2-01          TTGP----------------------------------TLSP--------
Q923R6_BCL2-01          TTGP----------------------------------TLSP--------
H0W1T3_BCL2-01          AQGP----------------------------------ALSP--------
G1LIC9_BCL2-02          AAGP----------------------------------ALSP--------
I3MVK9_BCL2-01          AAGP----------------------------------VLSP--------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
F6VJQ0_BCL2L10-01       ---------------------------------EYCCRREGVQELPAPT-
A0A2K5DMS4_MCL1-01      ----------------------------------KPMGRSE----AANS-
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          ----------------------------------ETAFRFGLDQWSGGE-
J7H260_MCL1-01          ---------------------------------------ED----GDSP-
G1PZ39_MCL1-01          ----------------------------------KPLGGPA----ASSR-
Q9Z1P3_MCL1-01          ----------------------------------KPLGEAG----AAGR-
A5PJR2_MCL1-01          ----------------------------------KPLGGSG----TTSR-
A0A452GA25_MCL1-01      ----------------------------------KPLGGSG----ATSR-
G1L3L7_MCL1-01          ----------------------------------KPLGGSG----AASR-
G1T2Q0_MCL1-01          ----------------------------------KPMGRAG----SASR-
F7AVA6_MCL1-01          ----------------------------------KPMGGSG----AASR-
A0A337S3J9_MCL1-01      ----------------------------------KPLGGSG----AASR-
A0A337S3J9_MCL1-03      ----------------------------------KPLGGSG----AASR-
Q7YRZ9_MCL1-01          ----------------------------------KPLGGSG----AASR-
F1PAP1_MCL1-01          ----------------------------------KPLGGSR----AASR-
Q8HYS5_MCL1-01          ----------------------------------KPLGGSR----AASR-
M3XZZ5_MCL1-01          ----------------------------------KPLGGPG----AASR-
A0A452RHX5_MCL1-01      ----------------------------------KPLGGSG----AASR-
H0XFB7_MCL1-01          ----------------------------------KPMGRAG----AASR-
F7GTF7_MCL1-01          ----------------------------------KPMGRSG----AASR-
A0A2K5CFH3_MCL1-01      ----------------------------------KPMGRSG----AASR-
A0A2K6V5Y3_MCL1-01      ----------------------------------KPMGRSG----AASR-
A0A2K6KRW9_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2K5XSB2_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A0D9RZP5_MCL1-01      ----------------------------------KPMSRSG----ATSR-
I7G687_MCL1-01          ----------------------------------KPMGRSG----ATSR-
A0A2K5LXU8_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2I3GJZ3_MCL1-02      ----------------------------------KPMGRSG----ATSR-
H2N5Y9_MCL1-01          ----------------------------------KPLGRSG----ATCR-
A0A2R9BPJ5_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2I3RTV4_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2I2YQH7_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2K5C7L5_MCL1-01      ----------------------------------KPMDRSG----AASR-
A0A2K5I9I0_MCL1-02      ----------------------------------QPMGRSG----ATSR-
A0A2K6GI15_MCL1-01      ----------------------------------KPMGRSG----AASR-
A0A2I3GJZ3_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2K5CFH3_MCL1-03      ----------------------------------KPMGRSG----AASR-
A0A2K5R5E2_MCL1-03      ----------------------------------KPMGRSG----AASR-
A0A2K5W0W9_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2K6ECR0_MCL1-02      ----------------------------------KPMGRSG----ATSR-
A0A2I3LFM0_MCL1-01      ----------------------------------KPMGRSG----ATSR-
A0A2K6KRW9_MCL1-02      ----------------------------------KPMGRSG----ATSR-
A0A2K6PPI3_MCL1-02      ----------------------------------KPMGRSG----ATSR-
Q95KR3_MCL1-01          ---------------------------------------MF----GLQR-
A0A2K5EPX0_MCL1-02      ---------------------------------------SQ----SYNN-
A0A2K5EPX0_MCL1-01      ---------------------------------------NA----SCSR-
G3WBC5_MCL1-01          ----------------------------------KPL---------RSG-
W5QI41_MCL1-01          ----------------------------------KPLGGSG----ATSR-
F1MQX4_MCL1-01          ----------------------------------KPLGGSG----ATSR-
A0A287BK44_MCL1-03      ----------------------------------KPMGGSG----AASR-
B4DLY8_MCL1-01          ----------------------------------KPMGRSG----ATSR-
B4DG83_MCL1-01          ----------------------------------KPMGRSG----ATSR-
B4E3L8_MCL1-01          ----------------------------------KPMGRSG----ATSR-
H3AR18_MCL1-02          -------------------------------TAFRFGLDQW----SGGE-
E2RS00_BCL2A1-01        -------------------------LAQDYVRHVLQIPQPG----PAPS-
B6V6J0_MCL1-01          -------------------------------------LEAS----CLLQH
G3PJT0_MCL1-01          PS------------------------------------------------
H0XHA5_MCL1-01          -------------------------------------AGNG----PSTD-
A0A2I2YPX6_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K6TM77_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K5RUN8_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K6GWM6_BCL2L2-      -------------------------------------PGEG----PAAD-
W5QDH4_BCL2L2-01        -------------------------------------PGEG----PAAD-
A0A2K6ME72_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K6RW35_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A287ATE4_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2R8M4C0_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A452UF16_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K5MZX9_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K5HEJ9_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K5V0Q3_BCL2L2-      -------------------------------------PGEG----PAAD-
F7G4L5_BCL2L2-02        -------------------------------------PGEG----PAAD-
A0A2K6EA59_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K6AI25_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A1U7RC37_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2I3GEA7_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2R9A2Q3_BCL2L2-      -------------------------------------PGEG----PAAD-
H2Q805_BCL2L2-02        -------------------------------------PGEG----PAAD-
A0A096NX09_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A287ATE4_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A4D6NWN1_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A1U7UJF2_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A452UF16_BCL2L2-      -------------------------------------PGEG----PAAD-
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          ----------------------------------SQGPRVG----GVQR-
H9GEA6_MCL1-02          GPKFSFQ---------------------------GLLGRFG----SSPNE
H9GEA6_MCL1-01          GPKFSFQ---------------------------GLLGRFG----SSPNE
A0A493U0E8_MCL1-01      RDAAPPAAGCCTFKKCKRFRAGPHPFPHHPAGRDFWGFTTP----GQIF-
A0A1L1RNM6_MCL1-01      K-----------------------LFPGLLGGPGRPGRASS----AVME-
A0A1L1RNM6_MCL1-02      K-----------------------LFPGLLGGPGRPGRASS----AVME-
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          ----------------------------------KPL---------RSG-
F6ZMX1_MCL1-03          ----------------------------------KPL---------RSG-
F6ZMX1_MCL1-02          ----------------------------------KPL---------RSG-
G1T2Q0_MCL1-02          ----------------------------------KPMGRAG----SASR-
F1PAP1_MCL1-02          ----------------------------------KPLGGSR----AASR-
A0A337S3J9_MCL1-04      ----------------------------------KPLGGSG----AASR-
F7AVA6_MCL1-02          ----------------------------------KPMGGSG----AASR-
A0A2K6GI15_MCL1-03      ----------------------------------KPMGRSG----AASR-
C8YZ26_MCL1-01          ----------------------------------KPMGRSG----ATSR-
F7GTF7_MCL1-02          ----------------------------------KPMGRSG----AASR-
A0A2K5R5E2_MCL1-04      ----------------------------------KPMGRSG----AASR-
A0A2K6V5Y3_MCL1-03      ----------------------------------KPMGRSG----AASR-
A0A2K5LXU8_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2K5I9I0_MCL1-03      ----------------------------------QPMGRSG----ATSR-
A0A2I2YQH7_MCL1-03      ----------------------------------KPMGRSG----ATSR-
Q07820_MCL1-04          ----------------------------------KPMGRSG----ATSR-
A0A2K5W0W9_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2K6ECR0_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2K5XSB2_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2R9BPJ5_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2I3RTV4_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2I3LFM0_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A2K6PPI3_MCL1-03      ----------------------------------KPMGRSG----ATSR-
A0A286Y1M5_MCL1-01      ----------------------------------KPLGGVG----PTSR-
B4DU51_MCL1-01          ----------------------------------KPMGRSG----ATSR-
A0A287DCH9_MCL1-02      ----------------------------------KPLRGSG----AASR-
P97287_MCL1-01          ----------------------------------KPLGEAG----AAGR-
A0A452GA25_MCL1-02      ----------------------------------KPLGGSG----ATSR-
A0A287DCH9_MCL1-01      ----------------------------------KPLRGSG----AASR-
G3T756_MCL1-01          ----------------------------------KPMGGSG----AASR-
A0A1S3F3I1_MCL1-01      ----------------------------------KPLGGAG----AASR-
G1L3L7_MCL1-02          ----------------------------------KPLGGSG----AASR-
A0A287BK44_MCL1-01      ----------------------------------KPMGGSG----AASR-
A0A287BK44_MCL1-02      ----------------------------------KPMGGSG----AASR-
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
W5MMB7_MCL1-01          ---------------------------------------------PH--R
A0A3B3SG34_MCL1-01      ---------------------------------------------CAT-L
Q4SW32_MCL1-01          ---------------------------------------------SRA-Q
D2ITA0_MCL1-03          ---------------------------------------------SKAKR
D2ITA0_MCL1-04          ---------------------------------------------SKAKR
A0A3P9ILF6_MCL1-01      ---------------------------------------------SQY-P
A0A3P9ILF6_MCL1-02      ---------------------------------------------SQY-P
Q0KFR9_MCL1-01          ---------------------------------------------SQP-R
A0A3P8Y1W8_MCL1-02      ---------------------------------------------SQP-R
A0A3P8Y1W8_MCL1-01      ---------------------------------------------SQP-R
A0A3Q2XZL8_MCL1-01      ---------------------------------------------STA-S
A0A3B4AFB7_MCL1-02      ---------------------------------------------SQP-K
A0A3B3VM25_MCL1-01      ---------------------------------------------SKC-R
A0A3Q0R633_MCL1-01      ---------------------------------------------SQR-R
A0A3Q0R633_MCL1-03      ---------------------------------------------SQR-R
A0A3B4T8L9_MCL1-02      ---------------------------------------------SIP-R
A0A3B4T8L9_MCL1-01      ---------------------------------------------SIP-R
A0A3Q1EQB9_MCL1-02      ---------------------------------------------SKP-R
A0A3B4ZKP6_MCL1-01      ---------------------------------------------SKP-R
A0A3Q1BKL8_MCL1-02      ---------------------------------------------SKP-R
A0A3Q1EQB9_MCL1-01      ---------------------------------------------SKP-R
A0A3Q1BKL8_MCL1-01      ---------------------------------------------SKP-R
A0A3P8RQX7_MCL1-01      ---------------------------------------------SKP-R
A0A3P8RQX7_MCL1-02      ---------------------------------------------SKP-R
A0A3Q3VP02_MCL1-01      ---------------------------------------------GRA-R
A0A3B5K5B3_MCL1-01      ---------------------------------------------GSH-Q
A0A3B3IJ04_MCL1-01      ---------------------------------------------SQY-R
A0A3P9L1F3_MCL1-01      ---------------------------------------------SQY-R
A0A3B3IJ04_MCL1-02      ---------------------------------------------SQY-R
A0A3P9L1F3_MCL1-02      ---------------------------------------------SQY-R
A0A3B3CEX1_MCL1-02      ---------------------------------------------SQS-R
A0A3B3CEX1_MCL1-01      ---------------------------------------------SQS-R
A0A3Q3B4P5_MCL1-01      ---------------------------------------------SKR-Q
A0A3Q3B4P5_MCL1-02      ---------------------------------------------SKR-Q
A0A3Q2EDX8_MCL1-01      ---------------------------------------------PKQ-R
A0A3Q2P7X9_MCL1-01      ---------------------------------------------SGH-R
A0A3Q2P7X9_MCL1-02      ---------------------------------------------SGH-R
A0A3B5PQ55_MCL1-02      ---------------------------------------------SKC-R
A0A3B5PQ55_MCL1-01      ---------------------------------------------SKC-R
A0A3P9Q4I8_MCL1-02      ---------------------------------------------SKC-R
A0A3P9Q4I8_MCL1-01      ---------------------------------------------SKC-R
A0A087X830_MCL1-01      ---------------------------------------------SKC-R
A0A3B3YCD0_MCL1-01      ---------------------------------------------SKC-R
I3JHR5_MCL1-01          ---------------------------------------------SQP-Q
A0A3Q4HLQ8_MCL1-01      ---------------------------------------------SQP-Q
A0A3P8NP63_MCL1-02      ---------------------------------------------SQP-Q
A0A3Q2VNL8_MCL1-01      ---------------------------------------------SQP-Q
A0A3P8NP63_MCL1-01      ---------------------------------------------SQP-Q
A0A3P9BVM3_MCL1-01      ---------------------------------------------SQP-Q
A0A3B4G4Z6_MCL1-01      ---------------------------------------------SQP-Q
A0A2U9CJ81_MCL1-01      ---------------------------------------------TDP-R
A0A3P8VKM5_MCL1-05      ---------------------------------------------SPS-K
A0A3P8VKM5_MCL1-04      ---------------------------------------------SPS-K
A0A3P8VKM5_MCL1-03      ---------------------------------------------SPS-K
A0A3Q3IZW0_MCL1-01      ---------------------------------------------STH-R
A0A3Q1GX28_MCL1-02      ---------------------------------------------TKP-R
A0A3Q1GX28_MCL1-01      ---------------------------------------------TKP-R
A0A3B4XKA5_MCL1-01      ---------------------------------------------SIQ-R
A0A3Q3GP42_MCL1-01      ---------------------------------------------SKP-G
A0A3Q3M6G2_MCL1-01      ---------------------------------------------SKP-R
A0A3Q3M6G2_MCL1-02      ---------------------------------------------SKP-R
A0A3B1IEV7_MCL1-01      ----------------------------------------------QK-P
A0A3B4CGU9_MCL1-03      ----------------------------------------------QK-T
A0A3B4CGU9_MCL1-02      -----------------------------------------------R-S
Q8UWD6_MCL1-01          ---------------------------------------------PHS-K
A2BF68_MCL1-01          ---------------------------------------------PHS-K
Q568W5_MCL1-01          ---------------------------------------------PHS-K
A0A3B1K5R1_MCL1-01      ---------------------------------------------SRS-C
A0A3B4C6H5_MCL1-01      ---------------------------------------------SRS-C
A0A3B4C6H5_MCL1-03      ---------------------------------------------SRS-C
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
G1TW27_BCL2-02          --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
A0A3B5K6B9_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      ----------------------------------------------MD--
A0A3B3I2Q5_BCL2L1-      ----------------------------------------------MD--
A0A3P9I2N4_BCL2L1-      ----------------------------------------------MD--
A0A3B4AFB7_MCL1-01      --------------------------------------------------
B9ZYL7_BCL2-01          ---------------------------------------------VPS--
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
H2U5I3_BCL2L1-02        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      ----------------------------------------------LD--
G3NJY1_BCL2L1-01        ----------------------------------------------LD--
A0A2U9BY16_BCL2L1-      ----------------------------------------------LD--
A0A3Q3DUT7_BCL2L1-      ----------------------------------------------LD--
A0A3Q3DUT7_BCL2L1-      ----------------------------------------------LD--
A0A3Q3DUT7_BCL2L1-      ----------------------------------------------LD--
A0A3B1JJ42_BCL2L1-      ----------------------------------------------LD--
A0A3P8UWG7_BCL2L1-      ----------------------------------------------LD--
A0A3Q3IVF5_BCL2L1-      ----------------------------------------------LD--
A0A3Q1DHJ3_BCL2L1-      ----------------------------------------------MD--
A0A3Q1DHJ3_BCL2L1-      ----------------------------------------------MD--
A0A3Q1DHJ3_BCL2L1-      ----------------------------------------------MD--
A0A3P8TL99_BCL2L1-      ----------------------------------------------MD--
A0A3P8TL99_BCL2L1-      ----------------------------------------------MD--
A0A3Q1FR00_BCL2L1-      ----------------------------------------------MD--
A0A3B4Z3X2_BCL2L1-      ----------------------------------------------MD--
A0A3B4Z3X2_BCL2L1-      ----------------------------------------------MD--
C3VIT1_BCL2L1-01        ---------------------------------------------RLD--
A0A3P8P0F1_BCL2L1-      ----------------------------------------------LD--
A0A3Q2X557_BCL2L1-      ----------------------------------------------LD--
A0A3P9D632_BCL2L1-      ----------------------------------------------LD--
A0A3P9D632_BCL2L1-      ----------------------------------------------LD--
A0A3Q4N4B5_BCL2L1-      ----------------------------------------------LD--
A0A3B4FNX1_BCL2L1-      ----------------------------------------------LD--
A0A3Q2QPL9_BCL2L1-      ----------------------------------------------ME--
A0A3B5PQJ0_BCL2L1-      ----------------------------------------------MD--
A0A087X9B7_BCL2L1-      ----------------------------------------------MD--
A0A3B3TUS7_BCL2L1-      ----------------------------------------------MD--
A0A3B3WI27_BCL2L1-      ----------------------------------------------MD--
A0A3P9N9Y4_BCL2L1-      ----------------------------------------------MD--
A0A3B3QRZ2_BCL2L1-      ---------------------------------------------SPS-P
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          ---------------------------------------------VPQ--
A0A452I9V7_BCL2-01      ---------------------------------------------APQ--
W5N4F7_BCL2-01          -----------------------------------------------A--
K7F5Y3_BCL2-02          ---------------------------------------------APQ--
A0A3Q2HRY3_BCL2-02      ---------------------------------------------VPP--
H0YUX3_BCL2-01          ---------------------------------------------APQ--
K7F5Y3_BCL2-01          ---------------------------------------------APQ--
F1LNV0_BCL2-01          ---------------------------------------------VPP--
P49950_BCL2-01          ---------------------------------------------VPP--
G1TW27_BCL2-01          ---------------------------------------------VPP--
A0A2K5EB04_BCL2-01      ---------------------------------------------VPP--
A0A2R8MY14_BCL2-01      ---------------------------------------------VPP--
H2NWH5_BCL2-01          ---------------------------------------------VPP--
A0A096MPU7_BCL2-01      ---------------------------------------------VPP--
A0A2K5PP81_BCL2-01      ---------------------------------------------VPP--
H0WKI0_BCL2-01          ---------------------------------------------VPP--
A0A2K5UDI5_BCL2-01      ---------------------------------------------VPP--
P10417_BCL2-01          ---------------------------------------------VPP--
Q7TSN8_BCL2-01          ---------------------------------------------VPP--
A0A3Q2HRY3_BCL2-01      ---------------------------------------------VPP--
E2QWA1_BCL2-02          ---------------------------------------------VPP--
A0A2K6G3I7_BCL2-01      ---------------------------------------------VPP--
Q6R755_BCL2-01          ---------------------------------------------VPP--
Q9JJV8_BCL2-01          ---------------------------------------------VPP--
Q923R6_BCL2-01          ---------------------------------------------VPP--
H0W1T3_BCL2-01          ---------------------------------------------VPP--
G1LIC9_BCL2-02          ---------------------------------------------VPP--
I3MVK9_BCL2-01          ---------------------------------------------VPP--
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          -----------------------------V--------------------
A0A3Q1FR00_BCL2L1-      -----VKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
F6VJQ0_BCL2L10-01       ----PAAATLRLVSS--ELRQIYQ-----D---FFECAL-----NQLLDR
A0A2K5DMS4_MCL1-01      ----KALETLRGVGE--GVPRNHE-----M---ALQGML-----RNL-DN
U3KKY6_MCL1-01          --------------------KKNK-----K---NLPGML-----RKL-EI
G1MPY7_MCL1-01          ----------------------------------FSGML-----RKL-EI
K7FPN7_MCL1-01          ------------------------------------GML-----RKL-DI
H3AR18_MCL1-01          ----KPLDTLRRVGD--SIIDKHR-----I---AFNGMQ-----QKL-NI
J7H260_MCL1-01          ----KALPTMRRLGG--DINEKHR-----M---AFQGML-----QKL-SI
G1PZ39_MCL1-01          ----KALETLRRVGD--GVQRNHE-----M---AFQG-------------
Q9Z1P3_MCL1-01          ----RALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A5PJR2_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A452GA25_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
G1L3L7_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
G1T2Q0_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
F7AVA6_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A337S3J9_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A337S3J9_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
Q7YRZ9_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
F1PAP1_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
Q8HYS5_MCL1-01          ----KALETLQRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
M3XZZ5_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A452RHX5_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
H0XFB7_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
F7GTF7_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5CFH3_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K6V5Y3_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K6KRW9_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5XSB2_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A0D9RZP5_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
I7G687_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5LXU8_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2I3GJZ3_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
H2N5Y9_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2R9BPJ5_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2I3RTV4_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2I2YQH7_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5C7L5_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQ----------V---
A0A2K5I9I0_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K6GI15_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2I3GJZ3_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K5CFH3_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K5R5E2_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K5W0W9_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K6ECR0_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2I3LFM0_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K6KRW9_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
A0A2K6PPI3_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGWV-----CGV---
Q95KR3_MCL1-01          ----NAVIGLNLYCG--GAGLGPG-----SGSSAFQGML-----RKL-DI
A0A2K5EPX0_MCL1-02      ----LKIT-------------------------TC--ML-----RKL-DI
A0A2K5EPX0_MCL1-01      ----PACF-------------------------SSPGML-----RKL-DI
G3WBC5_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
W5QI41_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
F1MQX4_MCL1-01          ----KALETLHRVGD--GVQHNHE-----T---AFQGML-----QKL-DI
A0A287BK44_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
B4DLY8_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
B4DG83_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
B4E3L8_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
H3AR18_MCL1-02          ----KPLDTLRRVGD--SIIDKHR-----I---AFNGMQ-----QKL-NI
E2RS00_BCL2A1-01        ----RASRVLQDVAF--SVQGQVE-----K---NLKPCL-----DSFDVV
B6V6J0_MCL1-01          GVHHKALETLLRVGG--EIIEKHH-----M---AFTGML-----QRL-SI
G3PJT0_MCL1-01          ----RELTTMKRVVG--DVLEKHR-----Y---VFNGMV-----NKLSLD
H0XHA5_MCL1-01          -----TLPSTPPPAE--EEDELYW-----Q---SMEIIS-----RYLWEQ
A0A2I2YPX6_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6TM77_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5RUN8_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6GWM6_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
W5QDH4_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6ME72_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6RW35_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A287ATE4_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2R8M4C0_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A452UF16_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5MZX9_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5HEJ9_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5V0Q3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
F7G4L5_BCL2L2-02        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6EA59_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6AI25_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A1U7RC37_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2I3GEA7_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2R9A2Q3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
H2Q805_BCL2L2-02        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A096NX09_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A287ATE4_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A4D6NWN1_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A1U7UJF2_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A452UF16_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6F6N9_MCL1-01      -----------------GWAWLGL-----K---AFQGML-----QKL-DI
G1QAV8_MCL1-01          -----------RAAGCSGVRQ--E-----T---AFLGML------EL-DT
H9GEA6_MCL1-02          AEVARALETLRRVGE--SLREKHL-----L---AFQGML-----RKL-EI
H9GEA6_MCL1-01          AEVARALETLRRVGE--SLREKHL-----L---AFQGML-----RKL-EI
A0A493U0E8_MCL1-01      ----GVLARKPHSGEQGGVTVEDL-----G---RSLGML-----RKL-EI
A0A1L1RNM6_MCL1-01      ----KALETLRRVGD--GVMQKHE-----L---AFQGML-----RKL-EI
A0A1L1RNM6_MCL1-02      ----KALETLRRVGD--GVMQKHE-----L---AFQGML-----RKL-EI
G2HFR3_MCL1-01          --------------------------------------------MLL-DI
F6ZMX1_MCL1-01          ----KALETLRRVGD--GVQRNHE-----R---AFQGML-----RKL-DI
F6ZMX1_MCL1-03          ----KALETLRRVGD--GVQRNHE-----R---AFQGML-----RKL-DI
F6ZMX1_MCL1-02          ----KALETLRRVGD--GVQRNHE-----R---AFQGML-----RKL-DI
G1T2Q0_MCL1-02          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
F1PAP1_MCL1-02          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A337S3J9_MCL1-04      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
F7AVA6_MCL1-02          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K6GI15_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
C8YZ26_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RRL-DI
F7GTF7_MCL1-02          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5R5E2_MCL1-04      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K6V5Y3_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5LXU8_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5I9I0_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2I2YQH7_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
Q07820_MCL1-04          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5W0W9_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K6ECR0_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K5XSB2_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2R9BPJ5_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2I3RTV4_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2I3LFM0_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A2K6PPI3_MCL1-03      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A286Y1M5_MCL1-01      ----KALETLRRVGD--GVQRNHQ-----T---AFQGML-----RKL-DI
B4DU51_MCL1-01          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A287DCH9_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
P97287_MCL1-01          ----RALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A452GA25_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A287DCH9_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
G3T756_MCL1-01          ----KALETLRRVAD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A1S3F3I1_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
G1L3L7_MCL1-02          ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A287BK44_MCL1-01      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A0A287BK44_MCL1-02      ----KALETLRRVGD--GVQRNHE-----T---AFQGML-----RKL-DI
A2BF68_MCL1-02          ----MIL----------------------W---TLSGMI-----ARL-NL
G1QEX2_BCL2L10-01       ----PEATVMRSLAA--HSWLGTP-----H---SWSR-------------
I3KXG5_MCL1-01          ----KALKMMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL---
H0ZCL9_BCL2A1-01        ----RVAHVLRTMAS--SLQDQTE-----E---AVRPLL-----DRI-DI
U3JTB2_BCL2A1-01        ----RVAHVLRTMAS--SLQDQTE-----E---ALRPLL-----DRI-DI
A0A218V8Z6_BCL2A1-      ----RVAHVLRTMAS--SLQDQTE-----E---AVRPLL-----DRI-DI
Q9W6F2_BCL2A1-01        ----RVAHVLRNIAS--SLQDQTE-----E---ALRPFL-----DRI-DI
A0A493SSZ7_BCL2A1-      ----RVAHVLRNIAS--SLQDQTE-----E---ALRPFL-----DRI-DI
G1N8C5_BCL2A1-01        ----RVAHVLRNIAS--SLQDQTE-----E---ALRPFL-----DRI-DI
A0A452J3N6_BCL2A1-      ----RVAHVLRHAAS--FLQKENE-----E---SLKPCL-----DTF-DI
K7G130_BCL2A1-01        ----RVAHVLRNSAS--FLQKENE-----E---ILKPCL-----DTL-DI
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        ----KTSRVLQDIAF--SVQNEVE-----K---NLKPCL-----DNF-HV
F6SFL4_BCL2A1-01        ----KTSQILQKVAF--SVQQEVE-----K---DMETCL-----STL-DI
G3WSP8_BCL2A1-01        ----RTSQILQKVAF--SVQEEVE-----K---DMETFL-----STL-DI
A0A2K5PYQ3_BCL2A1-      ----KTSRVLQKVAF--SVQ---------------KPCL-----DNV-NI
A0A2K5PYQ3_BCL2A1-      ----KTSRVLQKVAF--SVQ---------------KPCL-----DNV-NI
F6S8G3_BCL2A1-01        ----RTSRALQNVMF--SVQGDVE-----K---ALKPCF-----DSL-DV
O55178_BCL2A1-01        ----QAFRVLQRVAF--SVQKEVG-----K---NLKSYL-----DDF-HV
Q0P538_BCL2A1-01        ----QAFRVLQRVAF--SVQKEVG-----K---NLKSYL-----DDF-HV
G3V977_BCL2A1-01        ----KTSRVLQRVAF--SVQKEVE-----K---NLKPYL-----DDF-HV
Q925A9_BCL2A1-01        ----KTSRVLQRVAF--SVQKEVE-----K---NLKPYL-----DDF-HV
Q07440_BCL2A1-01        ----QACRVLQRVAF--SVQKEVE-----K---NLKSYL-----DDF-HV
O55179_BCL2A1-01        ----QACRVLQRVAF--SVQKEVE-----K---NLKSYL-----DDF-HV
O55177_BCL2A1-02        ----QACRVLQRVAF--SVQKEVE-----K---NLKSYL-----DDF-HV
Q497M6_BCL2A1-01        ----KACRVLQRVAF--SVQKEVE-----K---NLKSYL-----DDF-HV
Q8K164_BCL2A1-01        ----QACRVLQRVAF--SVQKEVE-----K---NLKSYL-----DDF-HV
Q4FK02_BCL2A1-01        ----KACRVLQRVAF--SVQKEVE-----K---NLKSYL-----DDF-HV
A0A452SIR9_BCL2A1-      ----RASQVLRDVAS--SVQGEVE-----K---NLKPCL-----DSF-DV
M3YVH4_BCL2A1-01        ----RVSRVLRDVAS--SVQGEVE-----Q---NLRPCL-----DSF-DV
U6CQS8_BCL2A1-01        ----RVSRVLRDVAS--SVQREVE-----Q---NLKPCL-----DSF-DV
I3MCZ7_BCL2A1-01        ----KTSKVLQNVAF--SVQKEVE-----K---NLKPFL-----DNF-DV
G3T8E6_BCL2A1-01        ----KTSRVLQNVAF--SVQKEVE-----K---NLKPCL-----DNF-VV
H0WZ23_BCL2A1-01        ----KTSRVLQNVAF--SVQEEVE-----K---SLKPCL-----DNF-NV
A0A2I3HBP6_BCL2A1-      ----KTSRVLQNVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K5D2I1_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---SLKPCL-----DNV-NI
B4E1X9_BCL2A1-01        ----KTSRVLQNVAF--SVQKEVE-----K---NLKSCL-----DNV-NV
A0A2I2YML2_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKSCL-----DNV-NV
A0A2R8ZJX9_BCL2A1-      ----QTSRVLQNVAF--SVQKEVE-----K---NLKSCL-----DNV-NV
A0A2I3HBP6_BCL2A1-      ----KTSRVLQNVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6PHF2_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6LV19_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K5TMD1_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K5KAA3_BCL2A1-      ----KTSRVLQKVAF--SVQEEVE-----K---NLKPCL-----DNV-NV
A0A2K6DS18_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A096NMX5_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6AD27_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6TLJ5_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----E---SLKPCL-----DNV-HI
F7HXW0_BCL2A1-01        ----KTSRVLQQVAF--SVQKEVE-----K---SLKSCL-----DNV-DI
A0A2K6TLJ5_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----E---SLKPCL-----DNV-HI
A0A2K6EKG1_BCL2A1-      ----KTSRVLQNIAF--SVQNEVE-----K---NLKACL-----DNV-NV
A0A452EK63_BCL2A1-      ----KTSRVLQDVAS--SVQDEVE-----R---TLKQCL-----DKF-DV
W5Q0N6_BCL2A1-01        ----KTSRVLQDVAS--SVQDEVE-----R---TLKQCL-----DKF-DV
L8IZT5_BCL2A1-01        ----KISRVLQDVAS--SVQDEVE-----R---TLKQCL-----DKF-DV
Q3C2I0_BCL2A1-01        ----KTSRVLQDVAS--SVQDEVE-----R---TLKQCL-----DKF-DV
F7CP56_BCL2A1-04        ----KTSRVLQDIAF--SVQNEVE-----K---NLKPCL-----DNF-HV
C7F841_BCL2A1-01        ----KTSRVLRDVAF--SVQNEVE-----K---NLKPCL-----DNF-DV
A0A2K5D2I1_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---SLKPCL-----DNV-NI
H2NNZ9_BCL2A1-01        ----KASRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2I2YML2_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKSCL-----DNV-NV
A0A2K6LV19_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6PHF2_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K5KHH8_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K5KHH8_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K5KAA3_BCL2A1-      ----KTSRVLQKVAF--SVQEEVE-----K---NLKPCL-----DNV-NV
A0A2K5TMD1_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
F7E8V5_BCL2A1-01        ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6DS18_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A2K6AD27_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A096NMX5_BCL2A1-      ----KTSRVLQKVAF--SVQKEVE-----K---NLKPCL-----DNV-NV
A0A0D9RRC3_BCL2A1-      ----KTSRVLQKVAS--SVQKEVE-----K---NLKPCL-----DNV-NV
Q16548_BCL2A1-01        ----KTSRVLQNVAF--SVQKEVE-----K---NLKSCL-----DNV-NV
A0A2R8ZJX9_BCL2A1-      ----QTSRVLQNVAF--SVQKEVE-----K---NLKSCL-----DNV-NV
W5MMB7_MCL1-01          RSRGKALETLKRVVD--SVVAKHQ-----I---AYHGMI-----AKL-EL
A0A3B3SG34_MCL1-01      QRRNEALSTLKRVVA--TVVEKHK-----F---AYNGMI-----GKL-SL
Q4SW32_MCL1-01          WRESRALATTKRVVG--DLMEKHR-----Y---TYRGMI-----NKL-FM
D2ITA0_MCL1-03          TRQDEVQVTMRRVVD--GVLEKHQ-----Y---AYKGMI-----QKL-EL
D2ITA0_MCL1-04          TRQDEVQVTMRRVVD--GVLEKHQ-----Y---AYKGMI-----QKL-EL
A0A3P9ILF6_MCL1-01      HRDNKYMSTAKRVVN--DVLEKHK-----I---TYNGMI-----VRL-SL
A0A3P9ILF6_MCL1-02      HRDNKYMSTAKRVVN--DVLEKHK-----I---TYNGMI-----VRL-SL
Q0KFR9_MCL1-01          WTQSKPLTTMKRVVE--DVIAKHR-----Y---AYNGMV-----AKL-DL
A0A3P8Y1W8_MCL1-02      WKQNKSLVTMKRVVG--DVIAKHT-----Y---AYKGMI-----SKL-CL
A0A3P8Y1W8_MCL1-01      WKQNKSLVTMKRVVG--DVIAKHT-----Y---AYKGMI-----SKL-CL
A0A3Q2XZL8_MCL1-01      WNESKAHSTMKRVVA--KVLEKHK-----Y---KYNGII-----NKL-SL
A0A3B4AFB7_MCL1-02      WKQRPALSTMKGVVD--KLLEKHR-----Y---AYNGMI-----NKL-AL
A0A3B3VM25_MCL1-01      WSQNKALSTMKRVVE--DVLSKHR-----Y---AYNGML-----NRL-AL
A0A3Q0R633_MCL1-01      WKESEALKTMKRVVA--DVLEKHR-----Y---AYNGMV-----NKL-SL
A0A3Q0R633_MCL1-03      WKESEALKTMKRVVA--DVLEKHR-----Y---AYNGMV-----NKL-SL
A0A3B4T8L9_MCL1-02      WTEHRALQTMKRVVD--GVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3B4T8L9_MCL1-01      WTEHRALQTMKRVVD--GVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q1EQB9_MCL1-02      WNESKALSTMKRVVD--DVLDKHR-----Y---SYNGMI-----NKL-SL
A0A3B4ZKP6_MCL1-01      WNEGKALSTMKRVVE--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q1BKL8_MCL1-02      WNESKALSTMKRVVD--DVLDKHR-----Y---AYNGMI-----NKL-SL
A0A3Q1EQB9_MCL1-01      WNESKALSTMKRVVD--DVLDKHR-----Y---SYNGMI-----NKL-SL
A0A3Q1BKL8_MCL1-01      WNESKALSTMKRVVD--DVLDKHR-----Y---AYNGMI-----NKL-SL
A0A3P8RQX7_MCL1-01      WNESKALSTMKRVVD--DVLDKHR-----Y---AYNGMI-----NKL-SL
A0A3P8RQX7_MCL1-02      WNESKALSTMKRVVD--DVLDKHR-----Y---AYNGMI-----NKL-SL
A0A3Q3VP02_MCL1-01      WTESRTLSTMKRVVA--ELLEKHR-----Y---VYNGMT-----KRL-SL
A0A3B5K5B3_MCL1-01      WRESGALSTMKRVVA--NLMEKHR-----Y---VYNGMT-----KQL-TL
A0A3B3IJ04_MCL1-01      HRDNKYMSTAKRVVN--DVLEKHK-----I---TYNGMI-----VRL-SL
A0A3P9L1F3_MCL1-01      HRDNKYMSTAKRVVN--DVLEKHK-----I---TYNGMI-----VRL-SL
A0A3B3IJ04_MCL1-02      HRDNKYMSTAKRVVN--DVLEKHK-----I---TYNGMI-----VRL-SL
A0A3P9L1F3_MCL1-02      HRDNKYMSTAKRVVN--DVLEKHK-----I---TYNGMI-----VRL-SL
A0A3B3CEX1_MCL1-02      HRESKYISTAKRVVN--DMMDKHR-----F---AFNGMI-----NRL-SL
A0A3B3CEX1_MCL1-01      HRESKYISTAKRVVN--DMMDKHR-----F---AFNGMI-----NRL-SL
A0A3Q3B4P5_MCL1-01      WSESKELSTMNRVVE--DLLTKHR-----F---AYNGII-----KKL-SL
A0A3Q3B4P5_MCL1-02      WSESKELSTMNRVVE--DLLTKHR-----F---AYNGII-----KKL-SL
A0A3Q2EDX8_MCL1-01      RNQTKALSTMKRVVE--DVLSKHR-----Y---AYNGMM-----NKL-CL
A0A3Q2P7X9_MCL1-01      WYTKKSLSTMKRVVE--DLLSKHR-----Y---AYTGMI-----RKL-NL
A0A3Q2P7X9_MCL1-02      WYTKKSLSTMKRVVE--DLLSKHR-----Y---AYTGMI-----RKL-NL
A0A3B5PQ55_MCL1-02      WGQNKALSTMKRVVE--DLLSKHK-----Y---AYNGMV-----NRL-AL
A0A3B5PQ55_MCL1-01      WGQNKALSTMKRVVE--DLLSKHK-----Y---AYNGMV-----NRL-AL
A0A3P9Q4I8_MCL1-02      WSQNKALSTMKRVVE--DVLSKHR-----Y---AYNGML-----SKL-AL
A0A3P9Q4I8_MCL1-01      WSQNKALSTMKRVVE--DVLSKHR-----Y---AYNGML-----SKL-AL
A0A087X830_MCL1-01      WSQNKALSTMKRVVE--DVLSKHR-----Y---AYNGML-----NRL-AL
A0A3B3YCD0_MCL1-01      WSQNKALSTMKRVVE--DVLSKHR-----Y---AYNGML-----NRL-AL
I3JHR5_MCL1-01          RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q4HLQ8_MCL1-01      RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3P8NP63_MCL1-02      RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q2VNL8_MCL1-01      RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3P8NP63_MCL1-01      RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3P9BVM3_MCL1-01      RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3B4G4Z6_MCL1-01      RKETKALKTMKRVVA--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A2U9CJ81_MCL1-01      WTDSKALSTMKRVVD--RLVEKHR-----Y---AYNGMM-----NRL-SL
A0A3P8VKM5_MCL1-05      WGERKALTTMKRVVD--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3P8VKM5_MCL1-04      WGERKALTTMKRVVD--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3P8VKM5_MCL1-03      WGERKALTTMKRVVD--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q3IZW0_MCL1-01      WTRRKTLSTMKRVVE--GVLEKHR-----Y---AYKGMI-----NKL-SL
A0A3Q1GX28_MCL1-02      WCETKELSTMKRVVN--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q1GX28_MCL1-01      WCETKELSTMKRVVN--DVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3B4XKA5_MCL1-01      RTEHRALQTMKRVVE--GVLEKHR-----Y---AYNGMI-----NKL-SL
A0A3Q3GP42_MCL1-01      WNESSALSTMKRVVE--DVLAKHR-----Y---AYNGMI-----NKL-SL
A0A3Q3M6G2_MCL1-01      WHDSKALSTMKRVVE--DLLEKYR-----Y---TYNGMI-----NKL-SL
A0A3Q3M6G2_MCL1-02      WHDSKALSTMKRVVE--DLLEKYR-----Y---TYNGMI-----NKL-SL
A0A3B1IEV7_MCL1-01      REQSPALRTMSRVVA--GVVLKHG-----I---AYNGMV-----QKL-NL
A0A3B4CGU9_MCL1-03      RDQHPAHGTMSRVVE--GVILKHS-----I---AYNGMV-----QRL-CL
A0A3B4CGU9_MCL1-02      RNQHPASDTLSRVVE--GMLHKHS-----V---AYSGMV-----QRL-CL
Q8UWD6_MCL1-01          SGRKQVLSTMRRVVD--NLAVKHE-----L---AYKGMI-----ARL-NL
A2BF68_MCL1-01          SGRKQVLSTMRRVVD--NLAVKHE-----L---AYKGMI-----ARL-NL
Q568W5_MCL1-01          SGRKQVLSTMRRVVD--NLAVKHE-----L---AYKGMI-----ARL-NL
A0A3B1K5R1_MCL1-01      GGHGAVVQTMKRVVD--DLVVKHG-----I---AYKGML-----NKL-GM
A0A3B4C6H5_MCL1-01      GRHRGVVQTIRRVVD--GLVVKHE-----L---VYKGMF-----TRL-GM
A0A3B4C6H5_MCL1-03      GRHRGVVQTIRRVVD--GLVVKHE-----L---VYKGMF-----TRL-GM
Q9Z0F3_BCL2L10-01       ----VEAALLRSVTR--QIQQEHQ-----E---FFSSFCES-RGNRL-EL
E1B9B3_BCL2L10-01       ----PEAAVLRHVAA--RIQEANR-----N---VLPLYRRC-RRHRV-EL
A0A1U7QVA0_BCL2L10      ----AEAALLRSVAE--QIQQQHH-----F---FFSSFVGY-QGNRV-EL
F1RZB9_BCL2L10-01       ----PEAAVLRCVAA--QIREYNV-----R---TLSVYRGF-RWNRV-EL
F1MV39_BCL2L10-01       ----PEAAVLRHVAA--RIQEANR-----N---VLPLYRRC-RRHRV-EL
W5QIG4_BCL2L10-01       ----PEAAVLRHVAA--RVLEANR-----N---VLPLYRRY-RRHRV-EL
Q99M66_BCL2L10-01       ----VEAALLRSVTS--QIQQEHQ-----D---LFNSFRDY-QGNRL-EL
F6ZPD4_BCL2L10-01       -----EVAVLRCVAA--QIQPRNQ-----R---VLSRYRGF-RGDHV-GL
A0A2K6F2Q2_BCL2L10      ----LEAAAMRFAAT--KIRRKHA-----S---FFSAYVGY-PGNRV-YL
H0WZ06_BCL2L10-01       ----PEAALLRSVTA--YIQQRHW-----S---FFSAYIGY-PGNRV-QV
A0A1U7UZD8_BCL2L10      ----PEAAVLRSTAA--RLRQRHA-----S---FFSAFVDY-PGSRV-DL
G1T264_BCL2L10-01       ----PEAAVLRCAAT--QLQRVHW-----P---FFSVYRGY-PGNRI-EL
A0A0D9RG38_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYLGY-PGNRV-EL
A0A2K5RIU7_BCL2L10      ----AEAAVLRATAA--GVRKVYR-----S---FFSAYLGY-PGNRV-EL
A0A2K5F974_BCL2L10      ----AEAAVLRAMAA--GVRKLYR-----S---FFSAYLGY-PGNRV-EL
A0A2K6TIT7_BCL2L10      ----AEAAVLRATAA--VVRKLYP-----S---FFSAYRGY-PRNRV-EL
F7CT87_BCL2L10-01       ----AEAAVLRAVAA--SVRKLYR-----S---FFSAYLGY-PGNRV-EL
A0A096NM44_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYRGY-PGNRV-EL
A0A2K6R5T5_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYLGY-PGNRV-EL
Q9HD36_BCL2L10-02       ----PEAAVLRSAAA--RLRQIHR-----S---FFSAYLGY-PGNRF-EL
G1R3W6_BCL2L10-01       ----PEAAMLRSAAA--RLRQLHP-----S---FFSAYLGY-PGNRV-EL
A0A2K5K3B0_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYLGY-PGNRV-EL
A0A2K6M5H5_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYLGY-PGNRV-EL
A0A2K5TKG9_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYRGY-PGNRV-EL
F7H6U5_BCL2L10-01       ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYRGY-PGNRV-EL
A0A2K6B2D9_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYRGY-PGNRV-EL
A0A2K5MMZ4_BCL2L10      ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYRGY-RGNRV-EL
H2NN92_BCL2L10-01       ----PEAAVLRSAAA--RLRQLHR-----S---FFSAYLGY-PGNRV-EL
A0A2R9BCD9_BCL2L10      ----PEAAVLRSAAA--RLRQIHR-----S---FFSAYLGY-PGNRF-EL
H2Q9G4_BCL2L10-01       ----PEAAVLRSAAA--RLRQIHR-----S---FFSAYLGY-PGNRF-EL
G3QLU6_BCL2L10-01       ----PEAAVLRSAAA--RLRQIHR-----S---FFSAYLGY-PGNRF-EL
A0A337RYG8_BCL2L10      ----PEAAVLRYLAA--QIRQRHQ-----R---FLSAYRGY-RGNRV-EL
G1LKR4_BCL2L10-01       ----PEAAVLRSVAA--QVQQRHE-----R---FLSDYRGYAGGNRV-EL
A0A452QJG0_BCL2L10      ----PEAAVLRSVAA--QVQQRHE-----H---FLSDYRGY-GGNRV-EL
R4JQR8_BCL2L1-01        ----QIQLKLRSLGD--EFQERFQ-----T---QFDDMV-----NQL-HI
A0A346RRN1_BCL2L1-      ----QVQLTLRTIGD--EFQERFR-----T---QFDDMV-----DQL-HI
A0A3Q4MN81_BCL2L10      ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
A0A3B4ETX9_BCL2L10      ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
D2IT42_BCL2L10-02       ----ESAAAMRGLAQ--DMERQHY-----A---RFQAL------AQS-FL
A0A3Q0S9R1_BCL2L10      ----ESAAAMRRLGQ--DIERQHQ-----A---RFDNL------AQT-FL
I3J363_BCL2L10-01       ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
A0A3Q2UUN9_BCL2L10      ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
A0A3P8PVZ8_BCL2L10      ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
A0A3Q2UUN9_BCL2L10      ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
A0A3P9BLI0_BCL2L10      ----ESAAAMRRLGW--DIERQHQ-----A---RFDNL------AQT-FL
A0A3Q2PJS5_BCL2L10      ----EPAAAMRRLAQ--DVESQHQ-----A---RFHAL------AQS-FL
A0A3Q2GL87_BCL2L10      ----EPAAAMRRLAQ--DMETQHQ-----A---RFHTL------AQS-FL
A0A3B5MJ12_BCL2L10      ----EPAAAMRRLAQ--DVEAKHQ-----A---RFHSL------AQG-FL
M4AUW7_BCL2L10-01       ----EPAAAMRRLAQ--DVEAKHQ-----A---RFHSL------AQG-FL
A0A096ME02_BCL2L10      ----EPAAAMRRLAQ--DVEAQHQ-----A---RFHSL------AQG-FL
A0A3B3TYN4_BCL2L10      ----EPAAAMRRLAQ--DVEAQHQ-----A---RFHSL------AQG-FL
A0A3B3YT99_BCL2L10      ----EPAAAMRRLAQ--DVEAQHQ-----A---RFHSL------AQG-FL
A0A3P9NE65_BCL2L10      ----EPAAAMRRLAQ--DVEAQHQ-----A---RFHSL------AQG-FL
A0A3P9IIZ2_BCL2L10      ----ESAAAMRRLAQ--DMEAQYQ-----P---RFSTL------AQN-FR
A0A3P9LM07_BCL2L10      ----ESAAAMRRLAQ--DMEAQYQ-----P---RFSTL------AQN-FR
H2MBQ3_BCL2L10-01       ----ESAAAMRRLAQ--DMEAQYQ-----P---RFSTL------AQN-FR
A0A3B4AAV4_BCL2L10      ----GSASAMRRLGQ--DMEAQHK-----A---RFHSL------SQT-FL
A0A3Q3EZT5_BCL2L10      ----MSAAAIRRLAQ--DMEKQHQ-----A---RFQSL------AQT-FL
A0A3Q3EZT5_BCL2L10      ----MSAAAIRRLAQ--DMEKQHQ-----A---RFQSL------AQT-FL
A0A3Q3JQ78_BCL2L10      ----ESAAAMRCLAQ--DMETQHQ-----A---RFHSL------AQT-FL
A0A3B4TIY6_BCL2L10      ----ESAAAMRSMAQ--DMETQHQ-----A---RFHTL------AQT-FV
A0A3B4WGF4_BCL2L10      ----ESAAAMRGMAQ--DMETQHQ-----A---RFHTL------AQT-FV
A0A3Q3KZW1_BCL2L10      ----ESAAAMRCLAQ--KMERQHQ-----A---RFHSL------TQT-FL
A0A3B5KD08_BCL2L10      ----ESATAMRHLGQ--DMEKQHQ-----A---RFNSL------AQT-FL
A0A3Q3VI28_BCL2L10      ----ESAAAMRDLAQ--DMEKQHQ-----A---RFHSL------AQT-FL
A0A3Q1GM98_BCL2L10      ----ESAAAMRRLAQ--DMEKQHQ-----A---RFHSL------TQA-FL
A0A3Q1D2L0_BCL2L10      ----ESAAAMRRLAQ--DMEKQHQ-----A---RFHSL------TQT-FL
A0A3P8RL82_BCL2L10      ----ESAAAMRRLAQ--DMEKQHQ-----A---RFHSL------TQT-FL
A0A3B4ZFS0_BCL2L10      ----ESAAAMRCLAQ--DMEKQHQ-----A---RFHSL------TQT-FL
A0A3B3C5I4_BCL2L10      ----ESASAMRRLAQ--DMETQYQ-----P---RFSTL------AQD-FR
A0A3Q1IAB0_BCL2L10      ----ESAAAMRRLAQ--DMEKQHQ-----V---RFHSL------AQT-FL
A0A3P8W7K5_BCL2L10      ----ESAAAMRHLAQ--DMEKQHQ-----A---RFQTL------SQS-FL
H3AAS7_BCL2L2-02        ----PLYRAMREAGD--EFEARFH-----R---TFNSLS-----SHL-HI
H3AAS7_BCL2L2-01        ----PLYRAMREAGD--EFEARFH-----R---TFNSLS-----SHL-HI
G1Q051_BCL2L2-01        ----PLHQAMRAAGD--EFETHFR-----C---TFSDLV-----AQL-HV
G3WPT1_BCL2L2-01        ----PLHRAMRAAGD--EFESRFR-----R---TFSDLA-----AQL-HV
A0A287D9B3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A482LX62_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
W5QDH4_BCL2L2-02        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
Q7TS60_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
G1LMC3_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
M3Y5X5_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
G1P3J2_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
G3WPT1_BCL2L2-02        ----PLHRAMRAAGD--EFESRFR-----R---TFSDLA-----AQL-HV
G1TV33_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----Q---NFSDLA-----AQL-HV
P70345_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
O88996_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A3Q9B4M8_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
H0XR82_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A250YBR2_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A250YBR2_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
L8HP19_BCL2L2-02        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
L8HP19_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
Q1RMX3_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A452ECF0_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A286XQQ9_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5RUN8_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5MZX9_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A0D9RU30_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5HEJ9_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A1S3FYD8_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2I2UAE3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2I2YPX6_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A287D9B3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5V0Q3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
F7G4L5_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6EA59_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6AI25_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A1U7RC37_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2I3GEA7_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2R9A2Q3_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
H2Q805_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A096NX09_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6GWM6_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6ME72_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6RW35_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6RW35_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K6TM77_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A287ATE4_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A1U7UJF2_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A452SHI1_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
Q05KI8_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
Q568V1_MCL1-01          ----HAIPTMKRVVD--NILVKHQ-----I---AYKGMI-----QRL-QL
Q1L8X3_MCL1-01          ----HAIPTMKRVVD--NILVKHQ-----I---AYKGMI-----QRL-QL
Q9I9N3_MCL1-01          ----HAIPTMKRVVD--NILVKHQ-----I---AYKGMI-----QRL-QL
A0A286XUI2_BCL2A1-      ----KASKVLQDMAL--SVQEEVE-----R---RLKPWL-----DRI-DV
A0A452U285_BCL2A1-      ----RASQVLRDVAS--SVQGEVE-----K---NLKPCL-----DSF-DV
A0A452U285_BCL2A1-      ----RASQVLRDVAS--SVQGEVE-----K---NLKPCL-----DSF-DV
A0A3B3R4U0_MCL1-01      ----KAYPVLRRVAE--TVIGKHL-----I---AYNGMI-----KKL-EL
F7CP56_BCL2A1-03        ----IIRDIFQQGKT--CFIPRYQFNSNHM---DMVKLA-----SPE-EI
Q2TAP5_BCL2L1-01        ----EVLQALLEATE--EFELRYQ-----R---AFSDLT-----SQL-HI
Q91828_BCL2L1-01        ----EVLQALLEATE--EFELRYQ-----R---AFSDLT-----SQL-HI
I7GKS6_BCL2L1-01        -----------RPQK--GLNRRWR-----P---PVP--------SMA-TH
A0A2K5EBP4_BCL2L1-      -----------RPQK--GLIRRWR-----P---PVP--------SML-HI
A0A2K5Q6R6_BCL2L1-      -----------RPQK--GLIRRWR-----P---PVP--------SML-HI
A0A2K6UWY8_BCL2L1-      -----------RPQK--GLIRRWR-----P---PVP--------SML-HI
A0A3P8V8T6_MCL1-01      ----KALSTMKRVVK--GILDKHR-----H---AFSGMI-----NNL-SF
A0A3P8YNB4_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFLEMS-----HQL-YL
A0A3P8WUE9_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFSEMS-----RQL-YL
A0A3B4A3G8_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q3G1D7_BCL2-01      ----DIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q2XQX2_BCL2-02      ----DIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q2XQX2_BCL2-01      ----DIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q3B0R2_BCL2-01      ----HIHRVLREAGD--ELERLYQ-----P---DFVEMS-----RQL-GL
A0A3Q2PN77_BCL2-01      ----DIHRVLREAGD--ELERLYQ-----L---DFAEMS-----QQL-YI
A0A3P9J8Y9_BCL2-01      ----DIHRVLREAGD--ELERLYQ-----R---DFTEMS-----RQL-YL
A0A3Q0S5Z7_BCL2-01      ----DIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-HL
A0A3P8QVM8_BCL2-01      ----GIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-HL
A0A3P9DIG5_BCL2-01      ----GIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-HL
A0A3Q2UYW8_BCL2-01      ----GIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-HL
A0A3B4G3K4_BCL2-01      ----GIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-HL
A0A2U9BJ09_BCL2-01      ----AVHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q1I5N1_BCL2-01      ----ALHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q3K1K1_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-HL
A0A3Q3MEY1_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A1X9JZA1_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A4D6FTA2_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q1FLK7_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3Q1B8C3_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3P8S9L3_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3B5BBQ0_BCL2-01      ----AIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3B4TX71_BCL2-01      ----EIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
A0A3B4YAG2_BCL2-01      ----EIHRVLREAGD--ELERLYQ-----P---DFTEMS-----RQL-YL
Q5XGJ4_BCL2L2-01        ----SLHSAMRAAGD--EFEERFR-----Q---AFSEIS-----TQI-HV
F7G6M3_BCL2L2-01        ----PLHRAMRAAGD--EFESRFR-----R---AFSDLA-----SQL-HV
A0A2K5CWY6_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
A0A2K5CWY6_BCL2L2-      ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
G3TMU7_BCL2L2-01        ----PLHQAMRAAGD--EFETRFR-----R---TFSDLA-----AQL-HV
G1TW27_BCL2-02          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
E2RS00_BCL2A1-02        ----VLQDVAFSVQG--QVEKNLK-----P---CLDSFD---------VV
A0A2K5M8B1_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A2K5H963_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A2K5VPG2_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A2K5YR37_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A2R8Z9D7_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A096NV05_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A2K6QFA2_BCL2L1-      --------MWKRTGL--RPQKGLN-----R---RWRPPV-----PSM-AT
A0A1U7T4L4_BCL2L1-      --------MWKRTGL--RPQKGLS-----R---RWRPPV-----PSM-AT
A0A2K6G3C5_BCL2L1-      --------MQKRTGL--RPQKRLN-----R---RWRPPV-----PLM-AT
A0A3Q1LRT3_BCL2L1-      ----TVKQALREASN--EFKLRYQ-----Q---TFSDLM-----SQL-RI
H9GHK7_BCL2L1-01        ----DVSQTLREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q07816_BCL2L1-04        ----DVRQALRDAGD--EFELR-------G---FVRGER-----GQG-DA
A0A493TIA6_BCL2L1-      ----AVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q07816_BCL2L1-03        ----DVRQALRDAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q07816_BCL2L1-02        ----DVRQALRDAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q07816_BCL2L1-01        ----DVRQALRDAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G1N5N5_BCL2L1-01        ----DVRQTLRDAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A452ILL8_BCL2L1-      ----GVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A452ILL8_BCL2L1-      ----GVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
K7F655_BCL2L1-01        ----EVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A452E1B1_BCL2L1-      ----VVKQALREASN--ECELRYQ-----Q---TFSDLT-----SQL-HI
W5PSA5_BCL2L1-01        ----VVKQALREASN--ECELRYQ-----Q---TFSDLT-----SQL-HI
P53563_BCL2L1-02        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
P53563_BCL2L1-03        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A287CZ07_BCL2L1-      ----AVKQALREAGD--EFELWYW-----R---AFSDLT-----SQL-HI
A0A3Q2H0F6_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
F6WA14_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G3WKX6_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
M3XA94_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
M3XA94_BCL2L1-02        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
H0X6V2_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G3SPN0_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q2PFS6_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
O35843_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
M3XA94_BCL2L1-03        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G1RER8_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A1S2ZQT6_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q64373_BCL2L1-09        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q64373_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
P53563_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
O77737_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q9MYW4_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A3Q2H0F6_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
L8J061_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q05KJ0_BCL2L1-02        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q05KJ0_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
E2IV76_BCL2L1-01        ----AVKQALKEAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K6G3C5_BCL2L1-      ----AVKQALKEAGD--EFELRYR-----R---AFSDLT-----SQL-HI
B2Z3Z4_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G3HEA7_BCL2L1-02        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G3HEA7_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A1U7T4L4_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
M3Z2H9_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A1U7QU73_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A0D9RJZ8_BCL2L1-      ----AVKQTLREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A286Y5D6_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A250YD48_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A1L5BWY3_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
I3MUP5_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
I3MUP5_BCL2L1-02        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
I3MUP5_BCL2L1-03        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
G1P9D2_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5EBP4_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
E2IV75_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
F7IT34_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q76LT7_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5Q6R6_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5Q6R6_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5M8B1_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5H963_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q8SQ42_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5VPG2_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K5YR37_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2R8Z9D7_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A096NV05_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2J8VIH3_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K6QFA2_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K6QFA2_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A2K6UWY8_BCL2L1-      ----AIKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
E2IV77_BCL2L1-01        ----AIKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A452SDS4_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A384D3U1_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A452FWV3_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q9MZS7_BCL2L1-01        ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A3B3TCS4_BCL2-01      ----RLHRVLREAGD--EIERMFQ-----R---DFSEMH-----EEL-HI
A0A0U3DHY6_BCL2-01      ----RLHRVLREAGD--EIERMYL-----R---DFAEMS-----GQL-HF
A0A3P9AAB2_BCL2-01      ----RLHRVLRDAGN--EIERMYQ-----R---DFAEMS-----GQL-HI
F6YNL8_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFDEMS-----GQL-HL
A0A218UQA0_BCL2-01      ----VVHLVLRQAGD--EFSRRYQ-----R---DFSQMS-----GQL-HL
Q00709_BCL2-01          ----GVHLALRQAGD--EFSRRYQ-----R---DFAQMS-----GQL-HL
A0A493T1X3_BCL2-01      ----VVHLALRQAGD--EFSRRYQ-----R---DFAQMS-----GQL-HL
U3KEW4_BCL2-01          ----VVHLVLRQAGD--EFSRRYQ-----R---DFAQMS-----GQL-HL
G3WZW9_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFDEMS-----GQL-HL
A0A452R110_BCL2-02      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
E2QWA1_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R----FAEMS-----SQL-HL
G1LIC9_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A452R110_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
M3YYK3_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K6R2I5_BCL2-02      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2R9APW6_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
M3X1R9_BCL2-02          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
G3SLZ1_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
Q75SV7_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
M3X1R9_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
Q8I008_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A076FU27_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A4P8GLJ2_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
F6R2C4_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
O02718_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A076FZV9_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A452EV13_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A250YD83_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A9QXG9_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K5NZS5_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A0D9S017_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K6CIX3_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K5XRD4_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K6KHG1_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K6R2I5_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K5HK49_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
G3QES9_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
H2QEM8_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2I3GZF9_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K6UEL3_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
G3WZW9_BCL2-02          ----VVHLTLRQAGD--DFSRRYR-----R---DFDEMS-----GQL-HL
G3SLZ1_BCL2-02          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A452T603_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
H3ANS8_BCL2L1-01        ----AVKRTLREAGE--EFELRYS-----R---AFSDLS-----SQL-HI
A0A452FHY1_BCL2L1-      ----TAQQAPREAGS--EFELRHQ-----Q---TVSDLT-----SQL-HT
A0A452FHY1_BCL2L1-      ----TAQQAPREAGS--EFELRHQ-----Q---TVSDLT-----SQL-HT
A0A1S3EPX7_BCL2L1-      ----AVKQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A218USB3_BCL2L1-      ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
H0Z8G3_BCL2L1-01        ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A218USB3_BCL2L1-      ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
U3JSL7_BCL2L1-01        ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A218USB3_BCL2L1-      ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
A0A218USB3_BCL2L1-      ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
Q4U2V6_BCL2L1-01        ----DVRQALREAGD--EFELRYR-----R---AFSDLT-----SQL-HI
X4ZGI8_BCL2-01          ----RIYRSLREAGD--QIERMYQ-----R---EFEEMS-----HQM-TF
A0A3B3E2W4_BCL2L1-      ----AIKSTLKDSAN--EFERRFS-----Q---GFSDLS-----LQF-HI
A0A3B3I2Q5_BCL2L1-      ----AIKSTLKDSAD--EFERRFH-----Q---GFSDLS-----VQL-HI
A0A3P9I2N4_BCL2L1-      ----AIKSTLKDSAD--EFERRFH-----Q---GFSDLS-----VQL-HI
A0A3P9MKK4_BCL2L1-      ----AIKSTLKDSAD--EFERRFH-----Q---GFSDLS-----VQL-HI
A0A3B5B4X7_BCL2L1-      ----AVKAALKDSAD--EFELLFT-----Q---AFSDLS-----SQL-DI
A0A3B4BFZ8_BCL2L1-      ----AIKTALTDSAD--EFEELFT-----Q---AFSNLS-----SQL-DI
A0A3Q3FUB6_BCL2L1-      ----AVKAALLDSAD--EFELLFT-----Q---AFSDLS-----SQL-DI
A0A3B5MGS2_BCL2L1-      ----VVKSVLKDAAE--EFERLYT-----Q---SFKHLS-----LQL-DI
M4A558_BCL2L1-01        ----VVKSVLKDAAE--EFERLYT-----Q---SFKHLS-----LQL-DI
A0A3P9QFB3_BCL2L1-      ----VVKSVLKDAAE--EFERLYT-----Q---SFKHLS-----LQL-DI
A0A087YBW4_BCL2L1-      ----VVKLVLKDAAE--EFERLYT-----Q---SFKHLS-----LQL-DI
A0A3B3VWI7_BCL2L1-      ----VVKLVLKDAAE--EFERLYT-----Q---SFKHLS-----LQL-DI
A0A3B3XN57_BCL2L1-      ----VVKSVLKDAAE--EFERLYT-----Q---SFKHLS-----LQL-DI
A0A3Q2C6K4_BCL2L1-      ----AVKSALKDSAN--EFELLFS-----Q---SFSDLS-----MQL-DI
A0A3Q2NRP4_BCL2L1-      ----AVKSALRDSAD--EFEHLFT-----Q---SFSHLS-----LQL-DI
A0A0B4KJI5_BCL2L1-      ----AVKAALRDSSE--EFELLFT-----Q---AFSDLS-----TQL-DI
A0A3Q1JZ46_BCL2L1-      ----AVKTALRDSAD--EFELLFT-----Q---AFSDLS-----SQL-DV
A0A3Q1JZ46_BCL2L1-      ----AVKTALRDSAD--EFELLFT-----Q---AFSDLS-----SQL-DV
A0A3Q3NFM4_BCL2L1-      ----AVKAALRDSAE--EFELLFT-----Q---AFSDLS-----SQL-DI
A0A3Q3NFM4_BCL2L1-      ----AVKAALRDSAE--EFELLFT-----Q---AFSDLS-----SQL-DI
A0A3B4V9K8_BCL2L1-      ----AVKSALKDSAD--EFELLFN-----Q---AFSDLS-----TQL-DI
A0A3B4XS24_BCL2L1-      ----AVKSALKDSAD--EFELLFN-----Q---AFSDLS-----TQL-DI
C1BLI0_BCL2L1-01        ----AVKAALRDSAD--EFELRYT-----R---AFNDPS-----SQL-HI
C0HAD8_BCL2L1-01        ----PVKAALRDSVD--EFELRYT-----R---AFSDLS-----SQL-HI
A0A3B3ZMX9_BCL2L1-      ----DSAPALRDSAN--EFELRFS-----R---AFSDLH-----RQL-HI
A0A3B5K6B9_BCL2L1-      ----TVKEALRDTGN--EFELRYT-----C---AFSDLH-----NQL-HI
A0A3B5K6B9_BCL2L1-      ----TVKEALRDTGN--EFELRYT-----C---AFSDLH-----NQL-HI
H3CH49_BCL2L1-01        ----AVKEALRDTGN--EFELRYT-----C---AFSDLH-----NQL-HI
A0A3B3TFR4_BCL2L1-      ----AVKEALRLSAN--EFEFRYQ-----R---AFSDLS-----SQL-HI
A0A3P8XYL5_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----L---AFSDLS-----SQL-HL
Q90Z98_BCL2L1-02        ----AVKEALRDSAN--EFELRYS-----R---AFNDLS-----SQL-HI
Q90Z98_BCL2L1-01        ----AVKEALRDSAN--EFELRYS-----R---AFNDLS-----SQL-HI
A0A059PJI5_BCL2L1-      ----AVKEALRDSGN--EFELRYS-----R---AFSDLS-----SQL-HI
A0A3B4DTL9_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----R---AFSDLS-----SQL-HI
A0A3Q2FR43_BCL2L1-      ----AVKAALRDTAC--EFELRYA-----R---AFNDLH-----STL-HI
B5XAY3_BCL2L1-01        ----AVKEALRDSAN--EFELRYA-----R---AFSDLS-----SQL-HI
W5MG74_BCL2L1-01        ----AVQGALRDSAN--EFELRYG-----R---AFSDLS-----SQL-HI
A0A2U9BY16_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3Q3B3X5_BCL2L1-      ----KVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3B3IB64_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----L---AFNNLH-----SQL-HI
A0A3P9JYH1_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----L---AFNNLH-----SQL-HI
A0A3B3DHA1_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----L---AFNNLH-----SQL-HI
A0A3Q0RTF8_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFNDLH-----SQL-HI
I3IZK7_BCL2L1-01        ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A2U9BY16_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A2U9BY16_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A2U9BY16_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A0D6DR75_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3Q3WIW8_BCL2L1-      ----AVKDALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A219P0Y3_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----HQL-HI
A0A3Q3MX20_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3Q3G2E1_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----S---AFSDLH-----NQL-HI
A0A3Q3G2E1_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----S---AFSDLH-----NQL-HI
A0A3Q3G2E1_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----S---AFSDLH-----NQL-HI
A0A3Q1GZ93_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3Q1GZ93_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3Q1GZ93_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3B4V3T1_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----R---AFSDLH-----NQL-HI
A0A3B4XU17_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----R---AFSDLH-----NQL-HI
A0A3P9MKK4_BCL2L1-      ----AIKSTLKDSAD--EFERRFH-----Q---GFSDLS-----VQL-HI
A0A3B3I2Q5_BCL2L1-      ----AIKSTLKDSAD--EFERRFH-----Q---GFSDLS-----VQL-HI
A0A3P9I2N4_BCL2L1-      ----AIKSTLKDSAD--EFERRFH-----Q---GFSDLS-----VQL-HI
A0A3B4AFB7_MCL1-01      ----PALSTMKGVVD--KLLEKHR-----Y---AYNGMI-----NKL-AL
B9ZYL7_BCL2-01          ----AVLQTLSRAGD--EFSRLYQ-----Q---DFRQIS-----GLL-HL
M3Y8D1_BCL2L10-01       ----REAAVLRSVAA--VVRQRHE-----R---FLSDYRGY-GGNRV-EL
A0A3Q2Y539_MCL1-01      ----KAQSTMKRVVT--RLVDKHR-----I---LFNNMV-----NEL-SL
A0A3Q3BEB7_BCL2L1-      ----AVKSALKDSAD--EFERLYT-----Q---SFSHLS-----LQL-DI
A0A3P8VMA1_BCL2L1-      ----AVKAALKDSAD--EFELRFT-----Q---AFRNLF-----LKL-DL
A0A345BSW9_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----R---AFNDLS-----SQL-HI
A0A286MU87_BCL2L1-      ----PVKAALRDSVD--EFELRYT-----R---AFSDLS-----SQL-HI
A0A3P8XFS0_BCL2L1-      ----AVKAALRDSAD--EFELRYT-----R---AFSDLS-----SQL-HI
A0A3P8XFS0_BCL2L1-      ----AVKAALRDSAD--EFELRYT-----R---AFSDLS-----SQL-HI
A0A0F7L1T6_BCL2L1-      ----AVNAALRDSAE--EFEKLFA-----Q---AFSDLS-----SQL-DI
H2U5I3_BCL2L1-01        ----AVNAALRDSAE--EFEKLFA-----Q---AFSDLS-----SQL-DI
H2U5I3_BCL2L1-02        ----AVNAALRDSAE--EFEKLFA-----Q---AFSDLS-----SQL-DI
A0A3Q3J5K3_BCL2L1-      ----AVKAALRDSAD--EFELRFT-----Q---AFSDLS-----SQL-VI
A0A3Q1EVP6_BCL2L1-      ----AVKSTLKDAAD--EFELLFT-----Q---TFSDLS-----SQI-DI
A0A3Q1BQA0_BCL2L1-      ----AVKSALKDAAD--EFELLFT-----Q---AFSDLS-----SQL-DI
A0A3P8U812_BCL2L1-      ----AVKSALKDAAD--EFELLFT-----Q---AFSDLS-----SQL-DI
E6ZFR0_BCL2L1-01        ----AVKAALRDSAD--EFELLFT-----Q---AFSDLS-----SQI-DI
G3P7B4_BCL2L1-01        ----AVKAALQDSAN--EFELLFT-----Q---AFSDLS-----LQL-DV
A0A3Q3X5M5_BCL2L1-      ----AVKSALRDSAN--EFEQLFT-----Q---AFSDLS-----SQL-DI
A0A2U9BIG9_BCL2L1-      ----AVKEALRDSAH--EFEQLFN-----Q---AFSDLS-----LQL-DI
D2ITA2_BCL2L1-02        ----AVRAALLESVE--EFELRYT-----L---AFSDLS-----SQL-PI
A0A3B3ZMX9_BCL2L1-      ----AVKEALRDSAN--EFELRFS-----R---AFSDLH-----RQL-HI
G3NJY1_BCL2L1-01        ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A2U9BY16_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----NQL-HI
A0A3Q3DUT7_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----H---AFSDLD-----KQL-HI
A0A3Q3DUT7_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----H---AFSDLD-----KQL-HI
A0A3Q3DUT7_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----H---AFSDLD-----KQL-HI
A0A3B1JJ42_BCL2L1-      ----AVKEALRDSAN--EFELRYS-----R---AFSDLS-----SQL-HI
A0A3P8UWG7_BCL2L1-      ----SIKEALRDSAN--EFELRYA-----R---AFSDLH-----QQL-HI
A0A3Q3IVF5_BCL2L1-      ----AVKEALRDSAN--EFELRYA-----R---AFSDLH-----HQL-HI
A0A3Q1DHJ3_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3Q1DHJ3_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3Q1DHJ3_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3P8TL99_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3P8TL99_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3Q1FR00_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3B4Z3X2_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3B4Z3X2_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
C3VIT1_BCL2L1-01        ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3P8P0F1_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3Q2X557_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3P9D632_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3P9D632_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3Q4N4B5_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3B4FNX1_BCL2L1-      ----AVKEALRDTAN--EFELRYA-----R---AFSDLH-----SQL-HI
A0A3Q2QPL9_BCL2L1-      ----AVKVALRETAC--EFELRYA-----R---AFNDLH-----STL-HI
A0A3B5PQJ0_BCL2L1-      ----AVKVALRDTAR--EFELRYS-----R---AFNDLH-----STL-HI
A0A087X9B7_BCL2L1-      ----AVKVTLRDTAR--EFELRYS-----R---AFNDLH-----STL-HI
A0A3B3TUS7_BCL2L1-      ----AVKVTLRDTAR--EFELRYS-----R---AFNDLH-----STL-HI
A0A3B3WI27_BCL2L1-      ----AVKVTLRDTAR--EFELRYS-----R---AFNDLH-----STL-HI
A0A3P9N9Y4_BCL2L1-      ----AVKVTLRDTAR--EFELRYS-----R---AFNDLH-----STL-HI
A0A3B3QRZ2_BCL2L1-      QGLEAVKEALRDSAN--EFELRYS-----R---AFSDLS-----SQL-HI
Q564A4_BCL2-01          -----LYRVLRDAGD--EIERIYQ-----R---EFEEMS-----QQM-VF
H9GPE7_BCL2-01          ----VVHTTLRQAGD--EFSRRYR-----R---DFAQMS-----GQL-HL
A0A452I9V7_BCL2-01      ----AVLLALCQAGD--EFSRRYH-----R---DFAQMS-----GQL-HL
W5N4F7_BCL2-01          ----ALHKVLREAGD--EIERMYH-----R---DFAEMS-----DQL-HF
K7F5Y3_BCL2-02          ----AVHLTLCQAGD--EFSRRYH-----R---DFAQMS-----GQL-HL
A0A3Q2HRY3_BCL2-02      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
H0YUX3_BCL2-01          ----AVHLVLRQAGD--EFSRRYQ-----R---DFSQMS-----GQL-HL
K7F5Y3_BCL2-01          ----AVHLTLCQAGD--EFSRRYH-----R---DFAQMS-----GQL-HL
F1LNV0_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
P49950_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
G1TW27_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K5EB04_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2R8MY14_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
H2NWH5_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A096MPU7_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K5PP81_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
H0WKI0_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A2K5UDI5_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
P10417_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
Q7TSN8_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
A0A3Q2HRY3_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
E2QWA1_BCL2-02          ----VVHLTLRQAGD--DFSRRYR-----R----FAEMS-----SQL-HL
A0A2K6G3I7_BCL2-01      ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
Q6R755_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
Q9JJV8_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
Q923R6_BCL2-01          ----VVHLTLRRAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
H0W1T3_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----Q---DFAEMS-----SQL-HL
G1LIC9_BCL2-02          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
I3MVK9_BCL2-01          ----VVHLTLRQAGD--DFSRRYR-----R---DFAEMS-----SQL-HL
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          -----------------EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A3Q1FR00_BCL2L1-      --TPATAYQSFENVM--DEVFRDGV--NWGRIVGLFAFGGALC-------
F6VJQ0_BCL2L10-01       --EPEQVIVNVAELM--DR----GE-FNWGRVAVLVVFAGALL-------
A0A2K5DMS4_MCL1-01      --KNEDNVKSFY-----------GV-TNWGRIVTLSSFGAFVA-------
U3KKY6_MCL1-01          --QQEEDLQSVVEVA--AHVFSDGV-TNWGRVVTLIAFGAFVA-------
G1MPY7_MCL1-01          --KKEEDLQAVCEVA--AHVFSDGV-TNWGRVVTLISFGAFVA-------
K7FPN7_MCL1-01          --KNEEDLKSVSSVA--THVFSDGI-TNWGRIVTLISFGAFVA-------
H3AR18_MCL1-01          --HKEDDLHIIPEIG--NQIFKDGA-TNWGRIVSLIAFGAVVA-------
J7H260_MCL1-01          --QRPEDIQKLSEVP--SMVFSDGV-TNWGRIVTVISFGAFVA-------
G1PZ39_MCL1-01          ----ERGPRALCLVR--DRWAPVGG-NRDEPGLEGLS-ARFRN-------
Q9Z1P3_MCL1-01          --KNEDDVKSFSRVM--THVFKDGV-TNWGRIVTLISFGAFVA-------
A5PJR2_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A452GA25_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
G1L3L7_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
G1T2Q0_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
F7AVA6_MCL1-01          --KNEDDVKSLSRVM--AHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A337S3J9_MCL1-01      --KNENDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A337S3J9_MCL1-03      --KNENDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
Q7YRZ9_MCL1-01          --KNENDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
F1PAP1_MCL1-01          --KNEDDVKSLSRVI--VHVFSDGV-TNWGRIVTLISFGAFVA-------
Q8HYS5_MCL1-01          --KNEDDVKSLSRVI--VHVFSDGV-TNWGRIVTLISFGAFVA-------
M3XZZ5_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A452RHX5_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
H0XFB7_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
F7GTF7_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5CFH3_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K6V5Y3_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K6KRW9_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5XSB2_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A0D9RZP5_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
I7G687_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5LXU8_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2I3GJZ3_MCL1-02      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
H2N5Y9_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2R9BPJ5_MCL1-01      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2I3RTV4_MCL1-01      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2I2YQH7_MCL1-01      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5C7L5_MCL1-01      -------------------LPCRRP-RRW---------------------
A0A2K5I9I0_MCL1-02      -------------------LPCRGP-RRW---------------------
A0A2K6GI15_MCL1-01      -------------------LPCRGP-RRR---------------------
A0A2I3GJZ3_MCL1-01      -------------------LPCRGP-RRW---------------------
A0A2K5CFH3_MCL1-03      -------------------LPCRGP-RRW---------------------
A0A2K5R5E2_MCL1-03      -------------------LPCRGP-RRW---------------------
A0A2K5W0W9_MCL1-01      -------------------LPCRGP-RRW---------------------
A0A2K6ECR0_MCL1-02      -------------------LPCRGP-RRW---------------------
A0A2I3LFM0_MCL1-01      -------------------LPCRGP-RRW---------------------
A0A2K6KRW9_MCL1-02      -------------------LPCRGP-RRW---------------------
A0A2K6PPI3_MCL1-02      -------------------LPCRGP-RRW---------------------
Q95KR3_MCL1-01          --KNEDDVKSLSRVM--VHVLSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5EPX0_MCL1-02      --KNKDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5EPX0_MCL1-01      --KNKDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
G3WBC5_MCL1-01          --KNEEDIKAVSRVV--THVFSDGV-TNWGRIVTLISFGAFVA-------
W5QI41_MCL1-01          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
F1MQX4_MCL1-01          --KNEDDVKSLSRVM--VHVFSDRV-TNWGRIVTLISFGAFVA-------
A0A287BK44_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
B4DLY8_MCL1-01          --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
B4DG83_MCL1-01          --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
B4E3L8_MCL1-01          --KNEDDVKSLSRVM--IHVFSDSV-TNWGRIVTLISFGAFVA-------
H3AR18_MCL1-02          --HKEDDLHIIPEIG--NQIFKDGA-TNWGRIVSLIAFGAVVA-------
E2RS00_BCL2A1-01        --SVDTARTIFNQVM--EKEFEDGV-INWGRIVTVFAFEGILT-------
B6V6J0_MCL1-01          --HSREDLQKLSEVP--ALVFNDGV-TNWGRIVTVISFGAFVA-------
G3PJT0_MCL1-01          --DRGDDASFVREVA--TSLFADGT-TNWGRIASLVAFGAVVC-------
H0XHA5_MCL1-01          --ETGEDINSLSRVM--AHVFSYGV-TNWGRIMTLI-FGGFVA-------
A0A2I2YPX6_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6TM77_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5RUN8_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6GWM6_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
W5QDH4_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6ME72_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6RW35_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A287ATE4_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2R8M4C0_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A452UF16_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5MZX9_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5HEJ9_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5V0Q3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
F7G4L5_BCL2L2-02        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6EA59_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6AI25_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A1U7RC37_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2I3GEA7_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2R9A2Q3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
H2Q805_BCL2L2-02        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A096NX09_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A287ATE4_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A4D6NWN1_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A1U7UJF2_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A452UF16_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6F6N9_MCL1-01      --KNEDDVKSLSRVM--VHVFSDSV-TNWGRIVTLISFCAFVS-------
G1QAV8_MCL1-01          --ENEDNVKSSSQAM--VHAFRDGV-TN-GRIVTHFFWC--LC-------
H9GEA6_MCL1-02          --KKEEDLASVAEVT--TEVFRDGI-INWGRIVTLISFGAFVA-------
H9GEA6_MCL1-01          --KKEEDLASVAEVT--TEVFRDGI-INWGRIVTLISFGAFVA-------
A0A493U0E8_MCL1-01      --KKEEDLQAVGEVA--AHLFSDGV-TNWGRVVTLISFGAFVA-------
A0A1L1RNM6_MCL1-01      --KKEDDLQAVCEVA--AHVFNDGV-TNWGRVVTLISFGAFVA-------
A0A1L1RNM6_MCL1-02      --KKEDDLQAVCEVA--AHVFNDGV-TNWGRVVTLISFGAFVA-------
G2HFR3_MCL1-01          --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
F6ZMX1_MCL1-01          --KNEEDIKAVSRVA--THVFSDGI-TNWGRIVTLISFGAFVA-------
F6ZMX1_MCL1-03          --KNEEDIKAVSRVA--THVFSDGI-TNWGRIVTLISFGAFVA-------
F6ZMX1_MCL1-02          --KNEEDIKAVSRVA--THVFSDGI-TNWGRIVTLISFGAFVA-------
G1T2Q0_MCL1-02          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
F1PAP1_MCL1-02          --KNEDDVKSLSRVI--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A337S3J9_MCL1-04      --KNENDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
F7AVA6_MCL1-02          --KNEDDVKSLSRVM--AHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K6GI15_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
C8YZ26_MCL1-01          --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
F7GTF7_MCL1-02          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5R5E2_MCL1-04      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLIYFGAFVA-------
A0A2K6V5Y3_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5LXU8_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5I9I0_MCL1-03      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2I2YQH7_MCL1-03      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
Q07820_MCL1-04          --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5W0W9_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K6ECR0_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K5XSB2_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2R9BPJ5_MCL1-03      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2I3RTV4_MCL1-03      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2I3LFM0_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A2K6PPI3_MCL1-03      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A286Y1M5_MCL1-01      --KNEDDVKSLSRVV--ALVFSDGV-TNWGRIVTLISFGAFVA-------
B4DU51_MCL1-01          --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A287DCH9_MCL1-02      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
P97287_MCL1-01          --KNEGDVKSFSRVM--VHVFKDGV-TNWGRIVTLISFGAFVA-------
A0A452GA25_MCL1-02      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A287DCH9_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
G3T756_MCL1-01          --KNEDDVKSLSRVM--AHVFSDGI-TNWGRIVTLISFGAFVA-------
A0A1S3F3I1_MCL1-01      --KNEDDVKSLSRVM--IHVFSDGV-TNWGRIVTLISFGAFVA-------
G1L3L7_MCL1-02          --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A287BK44_MCL1-01      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A0A287BK44_MCL1-02      --KNEDDVKSLSRVM--VHVFSDGV-TNWGRIVTLISFGAFVA-------
A2BF68_MCL1-02          --EQKGEDVSFIKQV-ATELFSDGT-TNWGRIASLLTFGAMLC-------
G1QEX2_BCL2L10-01       --RQRNRLEQMVDQI--ESLVPDGTDPNWLSVVALVSFAGALLERPPPGH
I3KXG5_MCL1-01          --SLDEREEDMSFVA--KSLFGDHT-TNWGRIVSFVAFGAVVS-------
H0ZCL9_BCL2A1-01        T-SVAAAKRIFNGVM--DEKFADGN-TNWGRIMTIFTFGGLLT-------
U3JTB2_BCL2A1-01        T-SVAVAKRIFNGVM--DEKFADGN-TNWGRIMTIFTFGGLLT-------
A0A218V8Z6_BCL2A1-      S-SVAVAKRIFNGVM--DEKFADGN-TNWGRIMTIFTFGGLLT-------
Q9W6F2_BCL2A1-01        T-SVDVAKRIFNGVM--EEKFADGN-TNWGRIMTIFTFGGLLT-------
A0A493SSZ7_BCL2A1-      S-SVDVAKRIFNGVM--DEKFADGN-TNWGRITTIFTFGGLLT-------
G1N8C5_BCL2A1-01        T-SVDVAKRIFNGVM--EEKFADGN-TNWGRIMTIFTFGGLLT-------
A0A452J3N6_BCL2A1-      T-SVDAARRIFTQVM--DKEFADGN-TNWGRILTIFMFGGILS-------
K7G130_BCL2A1-01        T-SVDAARRIFIQVM--DKEFDDGN-TNWGRILTIFMFGGILS-------
F7CP56_BCL2A1-02        --------------M--EKQFEDGI-INWGRIMTIFAFEGILI-------
F7CP56_BCL2A1-01        V-SIDAARTIFNQVM--EKQFEDGI-INWGRIMTIFAFEGILI-------
F6SFL4_BCL2A1-01        V-SVESARRIFNSVM--KKEFEDGV-INWGRIVTIFAFGGILI-------
G3WSP8_BCL2A1-01        T-SVDCARRIFNSVM--EKEFEDGI-INWGRIVTIFAFGGILI-------
A0A2K5PYQ3_BCL2A1-      V-SIDNARTIFSQVM--ETEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5PYQ3_BCL2A1-      V-SIDNARTIFSQVM--ETEFEDGI-INWGRIVTIFAFEGILI-------
F6S8G3_BCL2A1-01        G-SVGAARRIFGQIV--EKEFEDGI-VNWGRIVTIFVLGGILT-------
O55178_BCL2A1-01        E-SIDTTRIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
Q0P538_BCL2A1-01        E-SIDTTRIIFNQVM--EKEFENGI-INWGRIVTIFAFGGVLL-------
G3V977_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
Q925A9_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
Q07440_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
O55179_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
O55177_BCL2A1-02        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
Q497M6_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
Q8K164_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
Q4FK02_BCL2A1-01        E-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVLL-------
A0A452SIR9_BCL2A1-      V-SVDSARTIFNQVM--EKEFEDGI-INWGRIVTIFAFEGILT-------
M3YVH4_BCL2A1-01        G-SIDTARTIFNQVM--EKEFEDGI-INWGRIVTVFAFEGILS-------
U6CQS8_BCL2A1-01        G-SIDTARTIFNQVM--EKEFEDGI-INWGRIVTVFAFEGILS-------
I3MCZ7_BCL2A1-01        V-SADTARTIFNQVM--EKEFEDGI-MNWGRIVTIFAFGGVLV-------
G3T8E6_BCL2A1-01        I-SIDTAQTIFKQVM--EKEFEDGI-INWGRIVTIFAFGGILI-------
H0WZ23_BCL2A1-01        V-SIDTARTIFNQVM--EKEFEDGI-INWGRIVTIFAFGGILL-------
A0A2I3HBP6_BCL2A1-      V-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILV-------
A0A2K5D2I1_BCL2A1-      V-SIDNARMIFSQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
B4E1X9_BCL2A1-01        V-SVDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2I2YML2_BCL2A1-      V-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2R8ZJX9_BCL2A1-      V-SVDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2I3HBP6_BCL2A1-      V-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILV-------
A0A2K6PHF2_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6LV19_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5TMD1_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5KAA3_BCL2A1-      A-SIDTARTIFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6DS18_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A096NMX5_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6AD27_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6TLJ5_BCL2A1-      V-SMDNARTIFSQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
F7HXW0_BCL2A1-01        A-SIDNARTIFSQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6TLJ5_BCL2A1-      V-SMDNARTIFSQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6EKG1_BCL2A1-      A-SIDAARTIFNQVM--EKEFEDGI-VNWGRIVTVFAFGGILI-------
A0A452EK63_BCL2A1-      V-SVDTARTIFNQVM--EKEFEDGI-VNWGRIVTIFAFEGILT-------
W5Q0N6_BCL2A1-01        V-SVDTARTIFNQVM--EKEFEDGI-VNWGRIVTIFAFEGILT-------
L8IZT5_BCL2A1-01        V-SVDTARTIFNQVM--EKEFEDGI-VNWGRIVTIFAFEGILT-------
Q3C2I0_BCL2A1-01        V-SVDTARTIFNQVM--EKEFEDGI-VNWGRIVTIFAFEGILT-------
F7CP56_BCL2A1-04        V-SIDAARTIFNQVM--EKQFEDGI-INWGRIMTIFAFEGILI-------
C7F841_BCL2A1-01        V-SIDTARIIFNQVM--EKEFEDGI-INWGRIVTIFAFEGILM-------
A0A2K5D2I1_BCL2A1-      V-SIDNARMIFSQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
H2NNZ9_BCL2A1-01        V-SVDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2I2YML2_BCL2A1-      V-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6LV19_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6PHF2_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5KHH8_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5KHH8_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5KAA3_BCL2A1-      A-SIDTARTIFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K5TMD1_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
F7E8V5_BCL2A1-01        A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6DS18_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2K6AD27_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A096NMX5_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A0D9RRC3_BCL2A1-      A-SIDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
Q16548_BCL2A1-01        V-SVDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
A0A2R8ZJX9_BCL2A1-      V-SVDTARTLFNQVM--EKEFEDGI-INWGRIVTIFAFEGILI-------
W5MMB7_MCL1-01          --ENKGEDVSFVTGV-AKSLFSDGK-TNWGRIASLVSFGAVVA-------
A0A3B3SG34_MCL1-01      --NQQSDDMTVIKTV-AERIFSDGT-TNWGRIASLVAFGAEVC-------
Q4SW32_MCL1-01          --EDRVGDVSFVGAV-AKSTFEDGN-TNWGRVASLLAFAAVVA-------
D2ITA0_MCL1-03          --DGRGEDMSFVTSV-AKSLFADST-TNWGRIASLVAFGAALC-------
D2ITA0_MCL1-04          --DGRGEDMSFVTSV-AKSLFADST-TNWGRIASLVAFGAALC-------
A0A3P9ILF6_MCL1-01      --DDQGDDMSFVSSV-AKSLFADGT-TNWGRIVSLLAFGAAVC-------
A0A3P9ILF6_MCL1-02      --DDQGDDMSFVSSV-AKSLFADGT-TNWGRIVSLLAFGAAVC-------
Q0KFR9_MCL1-01          --DDRCDDMGVINSV-AKTMFSDGI-TNWGRIASLVAFGAVVS-------
A0A3P8Y1W8_MCL1-02      --DDQGDDMGFITSV-AKSLFSDGT-TNWGRIASLVGFGAVVS-------
A0A3P8Y1W8_MCL1-01      --DDQGDDMGFITSV-AKSLFSDGT-TNWGRIASLVGFGAVVS-------
A0A3Q2XZL8_MCL1-01      --DDRGDNVSFISEV-AKSLFSDGT-TNWGRVASLVAFGAIVS-------
A0A3B4AFB7_MCL1-02      --DDRGDDVSFIGTV-AKSIFEDGT-TNWGRIASLIAFGAVVC-------
A0A3B3VM25_MCL1-01      --DNQPDNMGFVTEV-AQNLFSDGT-TNWGRIVSLVAFGAAVC-------
A0A3Q0R633_MCL1-01      --DERGEDVTFVSAV-AKSLFADKT-TNWGRIASLMAFGAVVC-------
A0A3Q0R633_MCL1-03      --DERGEDVTFVSAV-AKSLFADKT-TNWGRIASLMAFGAVVC-------
A0A3B4T8L9_MCL1-02      --DNTGDDVRFVGAV-AKSLFADGT-TNWGRIASLVAFGAVVC-------
A0A3B4T8L9_MCL1-01      --DNTGDDVRFVGAV-AKSLFADGT-TNWGRIASLVAFGAVVC-------
A0A3Q1EQB9_MCL1-02      --DDIGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3B4ZKP6_MCL1-01      --DDRGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3Q1BKL8_MCL1-02      --DDRGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3Q1EQB9_MCL1-01      --DDIGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3Q1BKL8_MCL1-01      --DDRGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3P8RQX7_MCL1-01      --DDRGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3P8RQX7_MCL1-02      --DDRGDDVSFVSAV-AKSLFADRT-TNWGRITSLVAFGAVVC-------
A0A3Q3VP02_MCL1-01      --ADTQDNVSFVSTV-SRDLFSDGA-TNWGRIASLVAFGVVVS-------
A0A3B5K5B3_MCL1-01      --DDRGDDVSFVSSV-AKSIFADGV-TNWGRIASLVAFGAVVA-------
A0A3B3IJ04_MCL1-01      --DDQGDDMSFVSSV-AKSLFADGT-TNWGRIVSLLAFGAAVC-------
A0A3P9L1F3_MCL1-01      --DDQGDDMSFVSSV-AKSLFADGT-TNWGRIVSLLAFGAAVC-------
A0A3B3IJ04_MCL1-02      --DDQGDDMSFVSSV-AKSLFADGT-TNWGRIVSLLAFGAAVC-------
A0A3P9L1F3_MCL1-02      --DDQGDDMSFVSSV-AKSLFADGT-TNWGRIVSLLAFGAAVC-------
A0A3B3CEX1_MCL1-02      --EDNLDDMSFISRV-AENMFADRT-TNWGRIASLLAFGAAVC-------
A0A3B3CEX1_MCL1-01      --EDNLDDMSFISRV-AENMFADRT-TNWGRIASLLAFGAAVC-------
A0A3Q3B4P5_MCL1-01      --DDKSEDMTFVTKT-ARSLFADGI-TNWGRISSLVAFGAVVA-------
A0A3Q3B4P5_MCL1-02      --DDKSEDMTFVTKT-ARSLFADGI-TNWGRISSLVAFGAVVA-------
A0A3Q2EDX8_MCL1-01      --DEVPDNMGFVSSV-ATSLFSDGT-TNWGRIVSLVAFGAVVC-------
A0A3Q2P7X9_MCL1-01      --DQKSDDMGFVTSV-AVSLFSDGT-TNWGRIASLVAFGAVLC-------
A0A3Q2P7X9_MCL1-02      --DQKSDDMGFVTSV-AVSLFSDGT-TNWGRIASLVAFGAVLC-------
A0A3B5PQ55_MCL1-02      --DNEPDDMEFVTEI-AESLFSDGI-TNWGRIASLVTFGAAVC-------
A0A3B5PQ55_MCL1-01      --DNEPDDMEFVTEI-AESLFSDGI-TNWGRIASLVTFGAAVC-------
A0A3P9Q4I8_MCL1-02      --DNQPDNMGFVTEV-AESLFSDGT-TNWGRIVSLVAFGAVVC-------
A0A3P9Q4I8_MCL1-01      --DNQPDNMGFVTEV-AESLFSDGT-TNWGRIVSLVAFGAVVC-------
A0A087X830_MCL1-01      --DNQPDNMGFVTEV-AENLFSDGT-TNWGRIVSLVAFGAAVC-------
A0A3B3YCD0_MCL1-01      --DNQPDNMGFVTEV-AENLFSDGT-TNWGRIVSLVAFGAAVC-------
I3JHR5_MCL1-01          --DERHEDMSFVGAV-AKSLFADHT-TNWGRIVSFVAFGAVVS-------
A0A3Q4HLQ8_MCL1-01      --DERDEDMSFVGAV-AKSLFGDHT-TNWGRVVSFVAFGAVVS-------
A0A3P8NP63_MCL1-02      --DERDEDMSFVGAV-AKSLFGDHT-TNWGRIVSFMAFGAVVS-------
A0A3Q2VNL8_MCL1-01      --DERDEDMSFVGAV-AKSLFGDHT-TNWGRIVSFMAFGAVVS-------
A0A3P8NP63_MCL1-01      --DERDEDMSFVGAV-AKSLFGDHT-TNWGRIVSFMAFGAVVS-------
A0A3P9BVM3_MCL1-01      --DERDEDMSFVGAV-AKSLFGDHT-TNWGRIVSFMAFGAVVS-------
A0A3B4G4Z6_MCL1-01      --DERDEDMSFVGAV-AKSLFGDHT-TNWGRIVSFMAFGAVVS-------
A0A2U9CJ81_MCL1-01      --DNRRDDVTFVGAV-ARSLFGDGN-TNWGRVSSLVAFGAVVS-------
A0A3P8VKM5_MCL1-05      --ENRQGDLTFISSV-AKSLFGDGT-TNWGRITSLVAFGAVVC-------
A0A3P8VKM5_MCL1-04      --ENRQGDLTFISSV-AKSLFGDGT-TNWGRITSLVAFGAVVC-------
A0A3P8VKM5_MCL1-03      --ENRQGDLTFISSV-AKSLFGDGT-TNWGRITSLVAFGAVVC-------
A0A3Q3IZW0_MCL1-01      --DERGDDMSFVGSV-AQSIFADGT-TNWGRITSLLAFGAVVC-------
A0A3Q1GX28_MCL1-02      --DDKVDDVSFITAV-AQSLFSDGT-TNWGRIASLVAFGAAVC-------
A0A3Q1GX28_MCL1-01      --DDKVDDVSFITAV-AQSLFSDGT-TNWGRIASLVAFGAAVC-------
A0A3B4XKA5_MCL1-01      --DNRGDDVRFVGAV-AKSLFADGT-TNWGRIASLVAFGVVVC-------
A0A3Q3GP42_MCL1-01      --EDRGDDASFVSAV-AKSLFADGT-TNWGRIASLVAFGAAVS-------
A0A3Q3M6G2_MCL1-01      --DDRGDDVRFVSTV-AKSLFADGT-TNWGRIASLVAFGAVVC-------
A0A3Q3M6G2_MCL1-02      --DDRGDDVRFVSTV-AKSLFADGT-TNWGRIASLVAFGAVVC-------
A0A3B1IEV7_MCL1-01      --EEQDDSMDIISSV-AKALFSDGT-TNWGRIVSLVAFGAVVC-------
A0A3B4CGU9_MCL1-03      --EQQDDSMEFISSV-AKTLFNDGT-TNWGRIASLVAFGAVVC-------
A0A3B4CGU9_MCL1-02      --EQQDDSMEFISSV-AKTLFDDGI-TNWGRIASLVALGAVVC-------
Q8UWD6_MCL1-01          --EQKGEDVSFIKQV-ATELFSDGT-TNWGRIASLLTFGAMLC-------
A2BF68_MCL1-01          --EQKGEDVSFIKQV-ATELFSDGT-TNWGRIASLLTFGAMLC-------
Q568W5_MCL1-01          --EQKGEDVSFIKQV-ATELFSDGT-TNWGRIASLLTFGAMLC-------
A0A3B1K5R1_MCL1-01      --EDRGDDMYVIRAV-AKELFSDGI-TNWGRVASLVAFGAVVS-------
A0A3B4C6H5_MCL1-01      --EDRGDDMHIIRTV-AKELFSDGI-TNWGRIASLLAFGAVVC-------
A0A3B4C6H5_MCL1-03      --EDRGDDMHIIRTV-AKELFSDGI-TNWGRIASLLAFGAVVC-------
Q9Z0F3_BCL2L10-01       --VKQMADKLLSKDQ--------D--FSWSQLVMLLAFAGTLM-------
E1B9B3_BCL2L10-01       --VARMAQRLLDEDP--------G--PSWGRVASLVTFAGSLL-------
A0A1U7QVA0_BCL2L10      --MTQMVDAVLPDGQ--------D--LNWGRLVLLLAFAGTIV-------
F1RZB9_BCL2L10-01       --VAWMAQKLLASPR--------G--PNWYRVASLLTFAGMLL-------
F1MV39_BCL2L10-01       --VARMAQRLLDEDP--------G--PSWGRVASLVTFAGSLL-------
W5QIG4_BCL2L10-01       --VARMAQRLLDEDP--------G--PSWGRVASLVTFAGSLL-------
Q99M66_BCL2L10-01       --VTQMADELLSNDQ--------E--FNWGRLVMLLAFVGTLM-------
F6ZPD4_BCL2L10-01       --AARMAQAIFGDRH--------V--PSWGRVAALVTLAGTLL-------
A0A2K6F2Q2_BCL2L10      --LERMAEAVLCDS------------LSWGRVVMLVTFAGTLL-------
H0WZ06_BCL2L10-01       --VERMVKAMLSDNQ--------R--LNWGRVVTLVTFAGTLL-------
A0A1U7UZD8_BCL2L10      --TARMADAVLSGSR--------D--LSWGRVVTLVTFAGTLL-------
G1T264_BCL2L10-01       --AARVAEAVLSDGH--------D--LSWGRVVTLVTFAGTLL-------
A0A0D9RG38_BCL2L10      --VALMADAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
A0A2K5RIU7_BCL2L10      --VARMAEALLSDSP--------G--PTWGNVVMLLAFAGTLL-------
A0A2K5F974_BCL2L10      --VARMAEALLSDSP--------G--PTWGNVVMLLAFAGTLL-------
A0A2K6TIT7_BCL2L10      --VARMAEALLSDSP--------G--PTWGNVVMLLAFAGTLL-------
F7CT87_BCL2L10-01       --VARMAEALLSDSP--------G--PTWGNVVMLLAFAGTLL-------
A0A096NM44_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
A0A2K6R5T5_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
Q9HD36_BCL2L10-02       --VALMADSVLSDSP--------G--PTWGRVVTLVTFAGTLL-------
G1R3W6_BCL2L10-01       --VVLMADSVLSDSP--------G--PTWGRVVTLVAFAGTLL-------
A0A2K5K3B0_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
A0A2K6M5H5_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
A0A2K5TKG9_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
F7H6U5_BCL2L10-01       --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
A0A2K6B2D9_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
A0A2K5MMZ4_BCL2L10      --VALMAEAVLSDSP--------G--PTWGRVVSLVTFAGTLL-------
H2NN92_BCL2L10-01       --VALMADSVLSDSP--------S--PTWGRVVTLVTFAGTLL-------
A0A2R9BCD9_BCL2L10      --VALMADSVLSDSP--------G--PTWGRVVTLVTFAGTLL-------
H2Q9G4_BCL2L10-01       --VALMADSVLSDSP--------G--PTWGRVVTLVTFAGTLL-------
G3QLU6_BCL2L10-01       --VALMADSVLSDSP--------G--PTWGRVVTLVTFAGTLL-------
A0A337RYG8_BCL2L10      --VARLEQDLLSNPQ--------T--LSWGHVVALLTFAGTLL-------
G1LKR4_BCL2L10-01       --VAQVEREILAHPQ--------P--LSWGRVVALLTFAGTLL-------
A0A452QJG0_BCL2L10      --VAQVEREILAHPQ--------P--LSWGRVVALLTFAGTLL-------
R4JQR8_BCL2L1-01        --TEATAYPTFQRVV--QELFIDGN-INWGRIVALFGFGGSLS-------
A0A346RRN1_BCL2L1-      --TEATAYPTFQRVV--QELFIDGN-INWGRVVALFGFGGALS-------
A0A3Q4MN81_BCL2L10      VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3B4ETX9_BCL2L10      VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
D2IT42_BCL2L10-02       AQCEADACAGLRKVM--EELVGDGQ-LNWGRVVSLFTFTGVLA-------
A0A3Q0S9R1_BCL2L10      RHCGPDHCSSLRKVM--EELVGDGH-LNWGRVVSLFAFTGVLA-------
I3J363_BCL2L10-01       VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3Q2UUN9_BCL2L10      VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3P8PVZ8_BCL2L10      VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3Q2UUN9_BCL2L10      VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3P9BLI0_BCL2L10      VQCGPDHCLSLRKVM--KELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3Q2PJS5_BCL2L10      RHSQTDLCTSLWKVM--DEMVGDGH-FNWGRVVSLFTFAGVLA-------
A0A3Q2GL87_BCL2L10      RHSGTDLCSSLRKVM--DEMVGDGL-FNWGRVVSLFTFAGVLA-------
A0A3B5MJ12_BCL2L10      KHCGSDLCSNLRKVM--DEMVGDGH-FNWGRVVSLFAFAGVLA-------
M4AUW7_BCL2L10-01       KHCGSDLCSNLRKVM--DEMVGDGH-FNWGRVVSLFAFAGVLA-------
A0A096ME02_BCL2L10      KHCGTDLCSNLRKVM--DEMVGDGH-FNWGRVVSLFAFAGVLA-------
A0A3B3TYN4_BCL2L10      KHCGTDLCSNLRKVM--DEMVGDGH-FNWGRVVSLFAFAGVLA-------
A0A3B3YT99_BCL2L10      KHCGTDLCSNLRKVM--DEMVGDGH-FNWGRVVSLFAFAGVLA-------
A0A3P9NE65_BCL2L10      KHCGTDLCSNLRKVM--DEMVGDGH-FNWGRVVSLFAFAGVLA-------
A0A3P9IIZ2_BCL2L10      KHSGQDLCSSLRKVM--EELVGDER-LNWGRVVSLFAFVGVLA-------
A0A3P9LM07_BCL2L10      KHSGPDLCSSLRKVM--EELVGDER-LNWGRVVSLFAFVGVLA-------
H2MBQ3_BCL2L10-01       KHSGPDLCSSLRKVM--EELVGDER-LNWGRVVSLFAFVGVLA-------
A0A3B4AAV4_BCL2L10      KQCGPDPCSSLRKVM--EELVGDGH-LNWGRVVSLFTFAGVLA-------
A0A3Q3EZT5_BCL2L10      RQCGPDPCSGLRKVM--EELVGDGH-LNWGRVVSLFTFTGVLA-------
A0A3Q3EZT5_BCL2L10      RQCGPDPCSGLRKVM--EELVGDGH-LNWGRVVSLFTFTGVLA-------
A0A3Q3JQ78_BCL2L10      KQCGPDPCSSLRKVM--EELVGDGH-LNWGRVVSLFAFTGVLA-------
A0A3B4TIY6_BCL2L10      TQCGLDPCSSLRKVM--EELVGDGH-LNWGRVVSIFTFTGVLA-------
A0A3B4WGF4_BCL2L10      TQCGLDPCSSLRKVM--EELVGDGH-LNWGRVVSIFTFTGVLA-------
A0A3Q3KZW1_BCL2L10      KQCGPDPCSSLRKVI--EELVADGH-LNWGRVVSLFTFTGVLS-------
A0A3B5KD08_BCL2L10      RQCGPDLCSSLRKVM--EELVGDGH-LNWGRVVSLFTFTGVLA-------
A0A3Q3VI28_BCL2L10      RQCGTDPCSSLRNVM--EELVGDGH-LNWGRVVSIFTFTGVLA-------
A0A3Q1GM98_BCL2L10      RQCGPDFCSSLRMVM--EELVEDGH-LNWGRVVSLFTFTGVLA-------
A0A3Q1D2L0_BCL2L10      RQCGPDLCSSLRKVM--EELVGDGH-LNWGRVVSLFTFTGVLA-------
A0A3P8RL82_BCL2L10      RQCGPDLCSSLRKVM--EELVGDGH-LNWGRVVSLFTFTGVLA-------
A0A3B4ZFS0_BCL2L10      RQPGPDLCSSLRRVM--EELVGDGH-LNWGRVVSLFTFTGVLA-------
A0A3B3C5I4_BCL2L10      KHCGPDLCSSLRKVM--EELVGDEH-LNWGRVVSLFAFVGVLA-------
A0A3Q1IAB0_BCL2L10      KQCGPDPCSSLRKVM--EELVGDGH-MNWGRVVSLFTFTGVLA-------
A0A3P8W7K5_BCL2L10      RQCGSEPCVCLRKVM--EELVGDGH-LNWGRVVSIFTFTGVLA-------
H3AAS7_BCL2L2-02        --TPGTAYRRFAETA--DSLFQDG--VNWGRVVALFVFSAALC-------
H3AAS7_BCL2L2-01        --TPGTAYRRFAETA--DSLFQDG--VNWGRVVALFVFSAALC-------
G1Q051_BCL2L2-01        --TPGSAQQCFTQVS--DELFQGG--PNWGYLVAFFVFGAALC-------
G3WPT1_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--ANWGRLVAFFVFGAALC-------
A0A287D9B3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A482LX62_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
W5QDH4_BCL2L2-02        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
Q7TS60_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
G1LMC3_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
M3Y5X5_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
G1P3J2_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
G3WPT1_BCL2L2-02        --TPGSAQQRFTQVS--DELFQGG--ANWGRLVAFFVFGAALC-------
G1TV33_BCL2L2-01        --TPGSAQQSFTQVC--DELFQRG--PNWGRVVAFFAFGAALC-------
P70345_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
O88996_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A3Q9B4M8_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
H0XR82_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A250YBR2_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A250YBR2_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
L8HP19_BCL2L2-02        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
L8HP19_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
Q1RMX3_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A452ECF0_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A286XQQ9_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5RUN8_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5MZX9_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A0D9RU30_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5HEJ9_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A1S3FYD8_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2I2UAE3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2I2YPX6_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A287D9B3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5V0Q3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
F7G4L5_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6EA59_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6AI25_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A1U7RC37_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2I3GEA7_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2R9A2Q3_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
H2Q805_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A096NX09_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6GWM6_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6ME72_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6RW35_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6RW35_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K6TM77_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A287ATE4_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A1U7UJF2_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A452SHI1_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
Q05KI8_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
Q568V1_MCL1-01          --DSQPASLDFIRCI-ASTMFKDGV-TNWGRIASLVAFGAVVC-------
Q1L8X3_MCL1-01          --DSQPASLDFIRCI-ASTMFKDGV-TNWGRIASLVAFGAVVC-------
Q9I9N3_MCL1-01          --DSQPASLDFIRCI-ASTMFKDGV-TNWGRIASLVAFGAVVC-------
A0A286XUI2_BCL2A1-      E-SIDTAKSIFNQVM--EKEFEDGI-INWGRIVTIFAFGGVI--------
A0A452U285_BCL2A1-      V-SVDSARTIFNQVM--EKEFEDGI-INWGRIVTIFAFEGIL--------
A0A452U285_BCL2A1-      V-SVDSARTIFNQVM--EKEFEDGI-INWGRIVTIFAFEGIL--------
A0A3B3R4U0_MCL1-01      --DKRGDDTSFVTKV-AEEIFSDKV-TNWGRIASLIAFGGVVC-------
F7CP56_BCL2A1-03        LSLPKTSWNIHQPGE--EEVREEA--LSTGGLDLILMPG--LG-------
Q2TAP5_BCL2L1-01        --TQDTAQQSFQQVM--GELFRDG--TNWGRIVAFFSFGRALC-------
Q91828_BCL2L1-01        --TQDTAQQSFQQVM--GELFRDG--TNWGRIVAFFSFGRALC-------
I7GKS6_BCL2L1-01        PGTPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5EBP4_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5Q6R6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6UWY8_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A3P8V8T6_MCL1-01      --ENGVYNIGVVGAV-ARSLFRDGT-SNWGRIVSLVAFGAVLC-------
A0A3P8YNB4_BCL2-01      --TSSVAERRFREVI--DELFRDG--VNWGRIIAFFEFGGTIC-------
A0A3P8WUE9_BCL2-01      --TSSTAQRRFTEVI--DELFRDG--VNWGRIIAFFEFGGVVC-------
A0A3B4A3G8_BCL2-01      --TSSTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q3G1D7_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q2XQX2_BCL2-02      --SSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q2XQX2_BCL2-01      --SSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q3B0R2_BCL2-01      --ASAAAKARFAEVM--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q2PN77_BCL2-01      --TRDTARTRFAEVV--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3P9J8Y9_BCL2-01      --TSTTAKTRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q0S5Z7_BCL2-01      --TSATAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3P8QVM8_BCL2-01      --TSSTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3P9DIG5_BCL2-01      --TSSTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q2UYW8_BCL2-01      --TSATAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3B4G3K4_BCL2-01      --TSATAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A2U9BJ09_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q1I5N1_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q3K1K1_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTMC-------
A0A3Q3MEY1_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A1X9JZA1_BCL2-01      --TSTTAQRRFADVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A4D6FTA2_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q1FLK7_BCL2-01      --TTTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3Q1B8C3_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3P8S9L3_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3B5BBQ0_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3B4TX71_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
A0A3B4YAG2_BCL2-01      --TSTTAQRRFAEVI--DELFRDG--VNWGRIIAFFEFGGTVC-------
Q5XGJ4_BCL2L2-01        --TPGTAYARFAEVA--GSLFQGG--VNWGRIVAFFVFGAALC-------
F7G6M3_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5CWY6_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
A0A2K5CWY6_BCL2L2-      --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
G3TMU7_BCL2L2-01        --TPGSAQQRFTQVS--DELFQGG--PNWGRLVAFFVFGAALC-------
G1TW27_BCL2-02          --TPFHARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
E2RS00_BCL2A1-02        --SVDTARTIFNQVM--EKEFEDGV-INWGRIVTVFAFEGILT-------
A0A2K5M8B1_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5H963_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5VPG2_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5YR37_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2R8Z9D7_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A096NV05_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6QFA2_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A1U7T4L4_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6G3C5_BCL2L1-      --HPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A3Q1LRT3_BCL2L1-      --TPGTACQSFEQVI--NELFRDR--VKWGHVVAFFSFSGTLC-------
H9GHK7_BCL2L1-01        --TLGTAYQSFEQVV--NELFHDG--VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-04        --GTGGTHCVLDDHV--LDRPSRS--LDPGEWRL-----GALCGSVWEQR
A0A493TIA6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-03        --TPGTAYQSFEQVV--NELFHDG--VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-02        --TPGTAYQSFEQVV--NELFHDG--VNWGRIVAFFSFGGALC-------
Q07816_BCL2L1-01        --TPGTAYQSFEQVV--NELFHDG--VNWGRIVAFFSFGGALC-------
G1N5N5_BCL2L1-01        --TPGTAYQSFEQVV--NELFHDG--VNWGRIVAFFSFGGALC-------
A0A452ILL8_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A452ILL8_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
K7F655_BCL2L1-01        --TLGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A452E1B1_BCL2L1-      --TPGTTYQSFEQVI--NELFQDG--VNWCRNVAFFSFGGALC-------
W5PSA5_BCL2L1-01        --TPGKAYQSFEQVI--NELFQDG--VNWGRNVAFFSFGGALC-------
P53563_BCL2L1-02        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
P53563_BCL2L1-03        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A287CZ07_BCL2L1-      --TLGTAYQSFEQVV--NELFRDG--VNWGHIVAFLSFGGALC-------
A0A3Q2H0F6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
F6WA14_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
G3WKX6_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
M3XA94_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
M3XA94_BCL2L1-02        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
H0X6V2_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
G3SPN0_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q2PFS6_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
O35843_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
M3XA94_BCL2L1-03        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
G1RER8_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A1S2ZQT6_BCL2L1-      --TPATAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q64373_BCL2L1-09        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q64373_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
P53563_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
O77737_BCL2L1-01        --TPGTAYQSFEQVL--NELFRDG--VNWGRIVAFFSFGGALC-------
Q9MYW4_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A3Q2H0F6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
L8J061_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q05KJ0_BCL2L1-02        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q05KJ0_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
E2IV76_BCL2L1-01        --TLGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6G3C5_BCL2L1-      --TLGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
B2Z3Z4_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
G3HEA7_BCL2L1-02        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
G3HEA7_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A1U7T4L4_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
M3Z2H9_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A1U7QU73_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A0D9RJZ8_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A286Y5D6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A250YD48_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A1L5BWY3_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
I3MUP5_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
I3MUP5_BCL2L1-02        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
I3MUP5_BCL2L1-03        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
G1P9D2_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5EBP4_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
E2IV75_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
F7IT34_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q76LT7_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5Q6R6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5Q6R6_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5M8B1_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5H963_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q8SQ42_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5VPG2_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K5YR37_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2R8Z9D7_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A096NV05_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2J8VIH3_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6QFA2_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6QFA2_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A2K6UWY8_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
E2IV77_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A452SDS4_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A384D3U1_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A452FWV3_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q9MZS7_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A3B3TCS4_BCL2-01      --TPSTAQRRFTAVI--EELFSDG--VNWGRIVAFLEFGGTMC-------
A0A0U3DHY6_BCL2-01      --TPSTAQXRFTAVI--DELFSDG--VNWGRIVAFFEFGGTMC-------
A0A3P9AAB2_BCL2-01      --TPSTAHGRFTAVI--DELFSDG--VNWGRIVAFLEFGGTMC-------
F6YNL8_BCL2-01          --TPVTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A218UQA0_BCL2-01      --TPFTARSRFVAVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q00709_BCL2-01          --TPFTAHGRFVAVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A493T1X3_BCL2-01      --TPFTARGRFVAVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
U3KEW4_BCL2-01          --TPFTARSRFVAVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G3WZW9_BCL2-01          --TPVTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A452R110_BCL2-02      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
E2QWA1_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G1LIC9_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A452R110_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
M3YYK3_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K6R2I5_BCL2-02      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2R9APW6_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
M3X1R9_BCL2-02          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G3SLZ1_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q75SV7_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
M3X1R9_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q8I008_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A076FU27_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVIC-------
A0A4P8GLJ2_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
F6R2C4_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
O02718_BCL2-01          --TPFTARERFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A076FZV9_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A452EV13_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A250YD83_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A9QXG9_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K5NZS5_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A0D9S017_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K6CIX3_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K5XRD4_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K6KHG1_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K6R2I5_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K5HK49_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G3QES9_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
H2QEM8_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2I3GZF9_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K6UEL3_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G3WZW9_BCL2-02          --TPVTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G3SLZ1_BCL2-02          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A452T603_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
H3ANS8_BCL2L1-01        --TPGTAYQSFEQVV--NELFRDG--VNWGRVVAFFAFGGALC-------
A0A452FHY1_BCL2L1-      --TPGTAYQSFEQVM--YELFWDG--VNWDHTVAFFSFRGALC-------
A0A452FHY1_BCL2L1-      --TPGTAYQSFEQVM--YELFWDG--VNWDHTVAFFSFRGALC-------
A0A1S3EPX7_BCL2L1-      --TPGTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
H0Z8G3_BCL2L1-01        --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
U3JSL7_BCL2L1-01        --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
A0A218USB3_BCL2L1-      --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
Q4U2V6_BCL2L1-01        --TPSTAYQSFEQVV--NELFRDG--VNWGRIVAFFSFGGALC-------
X4ZGI8_BCL2-01          --SPSAAQRSFLAVA--EELFRDG--VNWGRIVAFFEFGGTMC-------
A0A3B3E2W4_BCL2L1-      --TPDTAYQNFKSVL--DELFKDG--INWGRVVGLFVFGGVLC-------
A0A3B3I2Q5_BCL2L1-      --TPDTAYQNFKRVL--DELFKDG--INWGRVVGLFVFGGALC-------
A0A3P9I2N4_BCL2L1-      --TPDTAYQNFKRVL--DELFKDG--INWGRVVGLFVFGGALC-------
A0A3P9MKK4_BCL2L1-      --TPDTAYQNFKRVL--DELFKDG--INWGRVVGLFVFGGALC-------
A0A3B5B4X7_BCL2L1-      --TPDTAYHSFKSVM--DEVFKDG--VNWGRIVGLFCFGGVLC-------
A0A3B4BFZ8_BCL2L1-      --TPDTAYNSFKSVM--DEVFKDG--VNWGRIVGLFVFGGVLS-------
A0A3Q3FUB6_BCL2L1-      --TPNTAYHSFKSVM--DEVFKDG--VNWGRIVGLFAFGGVLC-------
A0A3B5MGS2_BCL2L1-      --TPDTAYHSFKTVL--DELFKGG--VNWGRVVAMFTFGGILC-------
M4A558_BCL2L1-01        --TPDTAYHSFKTVL--DELFKGG--VNWGRVVAMFTFGGILC-------
A0A3P9QFB3_BCL2L1-      --TPDTAYHSFKTVL--DELFKGE--VNWGRVVAMFTFGGILC-------
A0A087YBW4_BCL2L1-      --TPDTAYQSFKTVL--DELFKGE--VNWGRVVAMFTFGGILC-------
A0A3B3VWI7_BCL2L1-      --TPDTAYQSFKTVL--DELFKGE--VNWGRVVAMFTFGGILC-------
A0A3B3XN57_BCL2L1-      --TPDTAYQSFKTVL--DELFKGE--VNWGRVVAMFTFGGILC-------
A0A3Q2C6K4_BCL2L1-      --TPDTAYHSFKAVL--DELFKDG--INWGRVVGLFAFGGVLC-------
A0A3Q2NRP4_BCL2L1-      --TPDTAYHSFKAVL--DELFKDG--VNWGRVVGLFAFGGVLC-------
A0A0B4KJI5_BCL2L1-      --TPDTAYHSFKSVM--DEVFKDG--VNWGRVVGLFAFGGVLC-------
A0A3Q1JZ46_BCL2L1-      --TPDTAYQSFKSVM--DELFKDG--VNWGRIVGLFAFGGVLC-------
A0A3Q1JZ46_BCL2L1-      --TPDTAYQSFKSVM--DELFKDG--VNWGRIVGLFAFGGVLC-------
A0A3Q3NFM4_BCL2L1-      --TPDTAYHSFKSVM--DEVFKDG--VNWGRIVGLFAFGGVLC-------
A0A3Q3NFM4_BCL2L1-      --TPDTAYHSFKSVM--DEVFKDG--VNWGRIVGLFAFGGVLC-------
A0A3B4V9K8_BCL2L1-      --TPDTAYHSFKSVM--DELFKDG--VNWGRIVGLFAFGGVLC-------
A0A3B4XS24_BCL2L1-      --TPDTAYHSFKSVM--DELFKDG--VNWGRIVGLFAFGGVLC-------
C1BLI0_BCL2L1-01        --TPATAYHSFESVM--NEVFRDG--VNWGRVVGLFAFGGALC-------
C0HAD8_BCL2L1-01        --TPATAYHSFESVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
A0A3B3ZMX9_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRVVGLFAFGGALA-------
A0A3B5K6B9_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B5K6B9_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
H3CH49_BCL2L1-01        --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B3TFR4_BCL2L1-      --TPATAYQSFESVM--NEVFRDG--VNWGRVVGLFAFGGALC-------
A0A3P8XYL5_BCL2L1-      --TPATAYQSFASVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
Q90Z98_BCL2L1-02        --TPATAYQSFESVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
Q90Z98_BCL2L1-01        --TPATAYQSFESVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A059PJI5_BCL2L1-      --TPVTVYQSFESVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B4DTL9_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
A0A3Q2FR43_BCL2L1-      --TPATAYQSFENVM--NEVFRDG--VNWGRIVGLFAFGGALC-------
B5XAY3_BCL2L1-01        --TPSTAYQSFENVM--DEVFRDG--VNWGRVVGLFSFGGALC-------
W5MG74_BCL2L1-01        --TPATAYQSFEHVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A2U9BY16_BCL2L1-      --TPATAYQSFESVM--NEVFRDG--VNWGRIIGLFAFGGALS-------
A0A3Q3B3X5_BCL2L1-      --TPGTVYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B3IB64_BCL2L1-      --TPATAYQSFENVM--NELFRDN--INWGRIVGLFAFGGALC-------
A0A3P9JYH1_BCL2L1-      --TPATAYQSFENVM--NELFRDN--INWGRIVGLFAFGGALC-------
A0A3B3DHA1_BCL2L1-      --TPATAYQSFENVM--NELFRDN--INWGRIVGLFAFGGALC-------
A0A3Q0RTF8_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
I3IZK7_BCL2L1-01        --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A2U9BY16_BCL2L1-      --TPATAYQSFESVM--NEVFRDG--VNWGRIIGLFAFGGALS-------
A0A2U9BY16_BCL2L1-      --TPATAYQSFESVM--NEVFRDG--VNWGRIIGLFAFGGALS-------
A0A2U9BY16_BCL2L1-      --TPATAYQSFESVM--NEVFRDG--VNWGRIIGLFAFGGALS-------
A0A0D6DR75_BCL2L1-      --TPATAYQSFANVM--DEVFRDG--VNWGRIIGLFAFGGALC-------
A0A3Q3WIW8_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A219P0Y3_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q3MX20_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRIIGLFAFGGALC-------
A0A3Q3G2E1_BCL2L1-      --TPATTHQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q3G2E1_BCL2L1-      --TPATTHQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q3G2E1_BCL2L1-      --TPATTHQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q1GZ93_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q1GZ93_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q1GZ93_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B4V3T1_BCL2L1-      --TPATAYQSFANVM--DEVFRDG--FNWGRIIGLFVFGGALC-------
A0A3B4XU17_BCL2L1-      --TPATAYQSFANVM--DEVFRDG--FNWGRIIGLFVFGGALC-------
A0A3P9MKK4_BCL2L1-      --TPDTAYQNFKRVL--DELFKDG--INWGRVVGLFVFGGALC-------
A0A3B3I2Q5_BCL2L1-      --TPDTAYQNFKRVL--DELFKDG--INWGRVVGLFVFGGALC-------
A0A3P9I2N4_BCL2L1-      --TPDTAYQNFKRVL--DELFKDG--INWGRVVGLFVFGGALC-------
A0A3B4AFB7_MCL1-01      --DDRGDDVSFIGTV-AKSIFEDGT-TNWGRIASLIAFGAVVC-------
B9ZYL7_BCL2-01          --TPSTVRVRFATVV--EELFHDG--VNWGRIVAFFEFGGVMC-------
M3Y8D1_BCL2L10-01       --VAQLEREILAHPQ--------A--LSWGRVVALVTFAGTLL-------
A0A3Q2Y539_MCL1-01      --DQRGLDRSFVSQVAQTEFANGN--INWGRIASLLAFCAVLS-------
A0A3Q3BEB7_BCL2L1-      --SPDTVYHSFKSVL--DELFKDG--VNWGRVVGLFAFGGVLC-------
A0A3P8VMA1_BCL2L1-      --TPDTVYHSFKSVM--DEVFRDG--VNWGRIVGLFTFGGVLC-------
A0A345BSW9_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A286MU87_BCL2L1-      --TPATAYHSFESVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
A0A3P8XFS0_BCL2L1-      --TPATAYHSFESVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
A0A3P8XFS0_BCL2L1-      --TPATAYHSFESVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
A0A0F7L1T6_BCL2L1-      --TPDTAYQSFKNVM--DEVFKDG--DNWGRVVGLFAFGGVLC-------
H2U5I3_BCL2L1-01        --TPDTAYQSFKNVM--DEVFKDG--VNWGRVVGLFAFGGVLC-------
H2U5I3_BCL2L1-02        --TPDTAYQSFKNVM--DEVFKDG--VNWGRVVGLFAFGGVLC-------
A0A3Q3J5K3_BCL2L1-      --TPDTAYNSFKSVM--DEVFKDG--VNWGRIVGLFAFGGALC-------
A0A3Q1EVP6_BCL2L1-      --TPETAYHSFKSVM--DEVFKDG--VNWGRIVGLFCFGGVLC-------
A0A3Q1BQA0_BCL2L1-      --TPETAYHSFKSVM--DEVFKDG--VNWGRIVGLFCFGGVLC-------
A0A3P8U812_BCL2L1-      --TPETAYHSFKSVM--DEVFKDG--VNWGRIVGLFCFGGVLC-------
E6ZFR0_BCL2L1-01        --TPDTAYHSFKSVM--DEVFKDG--VNWGRIVGLFAFGGVLC-------
G3P7B4_BCL2L1-01        --TPDTAYHSFKSVM--DEVFKDG--VNWGRVVGLFAFGGVLC-------
A0A3Q3X5M5_BCL2L1-      --TPDTAYHSFKSVM--DEVFKDG--VNWGRIVGLFAFGGVLC-------
A0A2U9BIG9_BCL2L1-      --TPDTAYQSFKSVM--DEVFKDG--VNWGRIVGLFAFGGVLC-------
D2ITA2_BCL2L1-02        --TPATAYGSFESVM--DEVFRDS--INWGRIVGLFAFGGALC-------
A0A3B3ZMX9_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRVVGLFAFGGALA-------
G3NJY1_BCL2L1-01        --TPATAYQSFEDVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A2U9BY16_BCL2L1-      --TPATAYQSFESVM--NEVFRDG--VNWGRIIGLFAFGGALS-------
A0A3Q3DUT7_BCL2L1-      --TPATAYQSFENVV--DEVFQDD--VNWGRIVGLFAFGGALC-------
A0A3Q3DUT7_BCL2L1-      --TPATAYQSFENVV--DEVFQDD--VNWGRIVGLFAFGGALC-------
A0A3Q3DUT7_BCL2L1-      --TPATAYQSFENVV--DEVFQDD--VNWGRIVGLFAFGGALC-------
A0A3B1JJ42_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRVVGLFAFGGALC-------
A0A3P8UWG7_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIIGLFAFGGALS-------
A0A3Q3IVF5_BCL2L1-      --TPATAYQSFESVM--DEVFRDG--VNWGRIIGLFAFGGALC-------
A0A3Q1DHJ3_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q1DHJ3_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q1DHJ3_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3P8TL99_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3P8TL99_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q1FR00_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B4Z3X2_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B4Z3X2_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
C3VIT1_BCL2L1-01        --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3P8P0F1_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q2X557_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3P9D632_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3P9D632_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q4N4B5_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B4FNX1_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3Q2QPL9_BCL2L1-      --TPATAYQSFENVM--NEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B5PQJ0_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A087X9B7_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B3TUS7_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B3WI27_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3P9N9Y4_BCL2L1-      --TPATAYQSFENVM--DEVFRDG--VNWGRIVGLFAFGGALC-------
A0A3B3QRZ2_BCL2L1-      --TPVTAYQSFESVM--NEVFRDG--INWGRIVGLFAFGGALC-------
Q564A4_BCL2-01          --NPNSAQRSFLTVA--EELFRDG--VNWGRIIAFFEFGGTMC-------
H9GPE7_BCL2-01          --TPSTARSRFVAVV--EELFQDG--VNWGRIVAFFEFGGMLC-------
A0A452I9V7_BCL2-01      --TPFTARGRFVAVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
W5N4F7_BCL2-01          --TPNTARRKFTAVV--EELFRDG--VNWGRIVAFFEFGGTMC-------
K7F5Y3_BCL2-02          --TPFTARGRFVAVV--EELFRDG--INWGRIVAFFEFGGVMC-------
A0A3Q2HRY3_BCL2-02      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
H0YUX3_BCL2-01          --TPFTARSRFVAVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
K7F5Y3_BCL2-01          --TPFTARGRFVAVV--EELFRDG--INWGRIVAFFEFGGVMC-------
F1LNV0_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
P49950_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
G1TW27_BCL2-01          --TPFHARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K5EB04_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2R8MY14_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
H2NWH5_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A096MPU7_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K5PP81_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
H0WKI0_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K5UDI5_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
P10417_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q7TSN8_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A3Q2HRY3_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
E2QWA1_BCL2-02          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
A0A2K6G3I7_BCL2-01      --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q6R755_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q9JJV8_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
Q923R6_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
H0W1T3_BCL2-01          --TPFTARGRFAT------LFRDG--VNWGRIVAFFEFGGVMC-------
G1LIC9_BCL2-02          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
I3MVK9_BCL2-01          --TPFTARGRFATVV--EELFRDG--VNWGRIVAFFEFGGVMC-------
                                                                          

P70345_BCL2L2-02        -------------MEPL--------------------VG-------Q---
G1MZW1_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A3Q1FR00_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
F6VJQ0_BCL2L10-01       ---EME--ELLK-EEQV--------------------LQLRRETSRR---
A0A2K5DMS4_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
U3KKY6_MCL1-01          ---KHL--KSIK-QEQS--------------------IT-------S---
G1MPY7_MCL1-01          ---KHL--KSIN-QEKC--------------------IS-------S---
K7FPN7_MCL1-01          ---KHL--KSIN-QENC--------------------IN-------T---
H3AR18_MCL1-01          ---KKL--KKMN-LEDS--------------------IE-------Q---
J7H260_MCL1-01          ---KHL--KSIH-MENC--------------------VG-------I---
G1PZ39_MCL1-01          ---QHI--LAMS-H--C--------------------FR-------P---
Q9Z1P3_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
A5PJR2_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
A0A452GA25_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
G1L3L7_MCL1-01          ---KHL--KSIN-QEGC--------------------IE-------P---
G1T2Q0_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
F7AVA6_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
A0A337S3J9_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
A0A337S3J9_MCL1-03      ---KHL--KSIN-QESC--------------------IE-------P---
Q7YRZ9_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
F1PAP1_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
Q8HYS5_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
M3XZZ5_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
A0A452RHX5_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
H0XFB7_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
F7GTF7_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5CFH3_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K6V5Y3_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K6KRW9_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5XSB2_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A0D9RZP5_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
I7G687_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5LXU8_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2I3GJZ3_MCL1-02      ---KHL--KTIN-QESC--------------------IE-------P---
H2N5Y9_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
A0A2R9BPJ5_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2I3RTV4_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2I2YQH7_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5C7L5_MCL1-01      -------------HQKC--------------------AA-------G---
A0A2K5I9I0_MCL1-02      -------------HQKC--------------------AA-------G---
A0A2K6GI15_MCL1-01      -------------HQKC--------------------AA-------G---
A0A2I3GJZ3_MCL1-01      -------------HQKC--------------------AA-------G---
A0A2K5CFH3_MCL1-03      -------------HQKC--------------------AA-------G---
A0A2K5R5E2_MCL1-03      -------------HQKC--------------------AA-------G---
A0A2K5W0W9_MCL1-01      -------------HQKC--------------------AA-------G---
A0A2K6ECR0_MCL1-02      -------------HQKC--------------------AA-------G---
A0A2I3LFM0_MCL1-01      -------------HQKC--------------------AA-------G---
A0A2K6KRW9_MCL1-02      -------------HQKC--------------------AA-------G---
A0A2K6PPI3_MCL1-02      -------------HQKC--------------------AA-------G---
Q95KR3_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
A0A2K5EPX0_MCL1-02      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5EPX0_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
G3WBC5_MCL1-01          ---KHL--KSIN-QESC--------------------ID-------P---
W5QI41_MCL1-01          ---KHL--KSIN-QESC--------------------IE-------P---
F1MQX4_MCL1-01          ---KHF--KSIN-QESC--------------------IE-------P---
A0A287BK44_MCL1-03      ---KHL--KSIN-QESC--------------------IE-------P---
B4DLY8_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
B4DG83_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
B4E3L8_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
H3AR18_MCL1-02          ---KKL--KKMN-LEDS--------------------IE-------Q---
E2RS00_BCL2A1-01        ---KKLLEQRIS-SDVD--------------------AE-------K---
B6V6J0_MCL1-01          ---KHL--KSLN-LEDC--------------------IG-------V---
G3PJT0_MCL1-01          ---QHL--AERG-RGNC--------------------VE-------L---
H0XHA5_MCL1-01          ---KHL--KTIN-QEGY--------------------IK-------P---
A0A2I2YPX6_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6TM77_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5RUN8_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6GWM6_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
W5QDH4_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6ME72_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6RW35_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A287ATE4_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2R8M4C0_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A452UF16_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5MZX9_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5HEJ9_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5V0Q3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
F7G4L5_BCL2L2-02        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6EA59_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6AI25_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A1U7RC37_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2I3GEA7_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2R9A2Q3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
H2Q805_BCL2L2-02        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A096NX09_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A287ATE4_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A4D6NWN1_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A1U7UJF2_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A452UF16_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6F6N9_MCL1-01      ---KHL--KTIN-QESC--------------------IE-------P---
G1QAV8_MCL1-01          ---SHL--KSIN-QESC--------------------IE-------P---
H9GEA6_MCL1-02          ---KHL--KSIN-QENA--------------------IN-------T---
H9GEA6_MCL1-01          ---KHL--KSIN-QENA--------------------IN-------T---
A0A493U0E8_MCL1-01      ---RHL--KSVK-QEKS--------------------IG-------S---
A0A1L1RNM6_MCL1-01      ---KHL--KSIN-QEKC--------------------IT-------S---
A0A1L1RNM6_MCL1-02      ---KHL--KSIN-QEKC--------------------IT-------S---
G2HFR3_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
F6ZMX1_MCL1-01          ---KHL--KSIN-QESC--------------------ID-------P---
F6ZMX1_MCL1-03          ---KHL--KSIN-QESC--------------------ID-------P---
F6ZMX1_MCL1-02          ---KHL--KSIN-QESC--------------------ID-------P---
G1T2Q0_MCL1-02          ---KHL--KSIN-QESC--------------------IE-------P---
F1PAP1_MCL1-02          ---KHL--KSIN-QESC--------------------IE-------P---
A0A337S3J9_MCL1-04      ---KHL--KSIN-QESC--------------------IE-------P---
F7AVA6_MCL1-02          ---KHL--KSIN-QESC--------------------IE-------P---
A0A2K6GI15_MCL1-03      ---KHL--KSIN-QESC--------------------IE-------P---
C8YZ26_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
F7GTF7_MCL1-02          ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5R5E2_MCL1-04      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K6V5Y3_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5LXU8_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5I9I0_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2I2YQH7_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
Q07820_MCL1-04          ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5W0W9_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K6ECR0_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K5XSB2_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2R9BPJ5_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2I3RTV4_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2I3LFM0_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A2K6PPI3_MCL1-03      ---KHL--KTIN-QESC--------------------IE-------P---
A0A286Y1M5_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
B4DU51_MCL1-01          ---KHL--KTIN-QESC--------------------IE-------P---
A0A287DCH9_MCL1-02      ---KHL--KSIN-QESC--------------------IE-------P---
P97287_MCL1-01          ---KHL--KSVN-QESF--------------------IE-------P---
A0A452GA25_MCL1-02      ---KHL--KSIN-QESC--------------------IE-------P---
A0A287DCH9_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
G3T756_MCL1-01          ---KHL--KSVN-QESR--------------------IE-------P---
A0A1S3F3I1_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
G1L3L7_MCL1-02          ---KHL--KSIN-QEGC--------------------IE-------P---
A0A287BK44_MCL1-01      ---KHL--KSIN-QESC--------------------IE-------P---
A0A287BK44_MCL1-02      ---KHL--KSIN-QESC--------------------IE-------P---
A2BF68_MCL1-02          ---KYQ--NDRG-HSKY--------------------VR-------L---
G1QEX2_BCL2L10-01       SQARRE--WDAT-VDQD--------------------CQ-------R---
I3KXG5_MCL1-01          ---QHL--KEKG-RD-----------------------N-------C---
H0ZCL9_BCL2A1-01        ---KKL--QEHG-VQLT--------------------AE-------E---
U3JTB2_BCL2A1-01        ---KKL--QEHG-VQLT--------------------AE-------E---
A0A218V8Z6_BCL2A1-      ---KKL--QEHG-VQLT--------------------AE-------E---
Q9W6F2_BCL2A1-01        ---KKL--QEHG-VQLT--------------------GE-------E---
A0A493SSZ7_BCL2A1-      ---KKL--QEHG-VQLT--------------------GE-------K---
G1N8C5_BCL2A1-01        ---KKL--QEQG-VQLT--------------------GE-------E---
A0A452J3N6_BCL2A1-      ---KKL--QEHR-VQLT--------------------GE-------N---
K7G130_BCL2A1-01        ---KRL--QEHK-VQLT--------------------GD-------N---
F7CP56_BCL2A1-02        ---KKL--LPER-IAPD--------------------VD-------T---
F7CP56_BCL2A1-01        ---KKL--LPER-IAPD--------------------VD-------T---
F6SFL4_BCL2A1-01        ---KKL--LRHR-APLT--------------------MG-------T---
G3WSP8_BCL2A1-01        ---KKL--LRHR-APLT--------------------MD-------T---
A0A2K5PYQ3_BCL2A1-      ---KKL--LQER-IAPD--------------------VD-------T---
A0A2K5PYQ3_BCL2A1-      ---KKL--LQER-IAPD--------------------VD-------T---
F6S8G3_BCL2A1-01        ---KKL--QRSG-VPLT--------------------RE-------T---
O55178_BCL2A1-01        ---KKT--STRA-DCPG--------------------CT-------C---
Q0P538_BCL2A1-01        ---KKT--STRA-DCPG--------------------CT-------C---
G3V977_BCL2A1-01        ---KKL--PQEQ-IALD--------------------VD-------T---
Q925A9_BCL2A1-01        ---KKL--PQEQ-IGLD--------------------VD-------T---
Q07440_BCL2A1-01        ---KKL--PQEQ-IALD--------------------VC-------A---
O55179_BCL2A1-01        ---KKL--PQEQ-IALD--------------------VG-------A---
O55177_BCL2A1-02        ---KKL--PQEQ-IALD--------------------VG-------A---
Q497M6_BCL2A1-01        ---KKL--PQEQ-IALD--------------------VG-------A---
Q8K164_BCL2A1-01        ---KKL--PQEQ-IALD--------------------VG-------A---
Q4FK02_BCL2A1-01        ---KKL--PQEQ-IALD--------------------VG-------A---
A0A452SIR9_BCL2A1-      ---KKL--LQER-ISPD--------------------VD-------A---
M3YVH4_BCL2A1-01        ---KKL--LRER-ISPD--------------------VD-------A---
U6CQS8_BCL2A1-01        ---KKL--LRER-ISPD--------------------VD-------A---
I3MCZ7_BCL2A1-01        ---KKL--LRER-IAPA--------------------VD-------S---
G3T8E6_BCL2A1-01        ---KKL--LRER-IAPD--------------------VD-------T---
H0WZ23_BCL2A1-01        ---KKL--LQQR-IALD--------------------VD-------T---
A0A2I3HBP6_BCL2A1-      ---KKL--LRQR-TAPD--------------------VD-------T---
A0A2K5D2I1_BCL2A1-      ---KKL--LRER-IAPD--------------------VD-------T---
B4E1X9_BCL2A1-01        ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2I2YML2_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2R8ZJX9_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2I3HBP6_BCL2A1-      ---KKL--LRQR-TAPD--------------------VD-------T---
A0A2K6PHF2_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2K6LV19_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2K5TMD1_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K5KAA3_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K6DS18_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A096NMX5_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K6AD27_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K6TLJ5_BCL2A1-      ---KKL--LRER-IAPD--------------------VD-------T---
F7HXW0_BCL2A1-01        ---KKL--LRER-IAPD--------------------VD-------T---
A0A2K6TLJ5_BCL2A1-      ---KKL--LRER-IAPD--------------------VD-------T---
A0A2K6EKG1_BCL2A1-      ---KKL--LREQ-IALD--------------------VD-------T---
A0A452EK63_BCL2A1-      ---KKL--LSKR-IASD--------------------MD-------M---
W5Q0N6_BCL2A1-01        ---KKL--LSKR-IASD--------------------MD-------M---
L8IZT5_BCL2A1-01        ---KKL--LGKC-IASD--------------------MD-------M---
Q3C2I0_BCL2A1-01        ---KKL--LGKC-IASD--------------------MD-------M---
F7CP56_BCL2A1-04        ---KKL--LPER-IAPD--------------------VD-------T---
C7F841_BCL2A1-01        ---KKL--LRKR-IAPD--------------------VD-------T---
A0A2K5D2I1_BCL2A1-      ---KKL--LRER-IAPD--------------------VD-------T---
H2NNZ9_BCL2A1-01        ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2I2YML2_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2K6LV19_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2K6PHF2_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2K5KHH8_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K5KHH8_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K5KAA3_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K5TMD1_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
F7E8V5_BCL2A1-01        ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K6DS18_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A2K6AD27_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A096NMX5_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
A0A0D9RRC3_BCL2A1-      ---KKL--LRQR-IAPD--------------------VD-------T---
Q16548_BCL2A1-01        ---KKL--LRQQ-IAPD--------------------VD-------T---
A0A2R8ZJX9_BCL2A1-      ---KKL--LRQQ-IAPD--------------------VD-------T---
W5MMB7_MCL1-01          ---KQM--KDSG-RESC--------------------VE-------A---
A0A3B3SG34_MCL1-01      ---KYL--KETG-REHC--------------------VE-------A---
Q4SW32_MCL1-01          ---QYL--NDHG-QRDC--------------------VE-------Q---
D2ITA0_MCL1-03          ---QYL--EARG-KEGC--------------------VS-------L---
D2ITA0_MCL1-04          ---QYL--EARG-KEGC--------------------VS-------L---
A0A3P9ILF6_MCL1-01      ---QSL--KEKG-RGHC--------------------VD-------L---
A0A3P9ILF6_MCL1-02      ---QSL--KEKG-RGHC--------------------VD-------L---
Q0KFR9_MCL1-01          ---QHL--KERG-RGHC--------------------VE-------L---
A0A3P8Y1W8_MCL1-02      ---QHL--KEMG-KGNC--------------------VE-------L---
A0A3P8Y1W8_MCL1-01      ---QHL--KEMG-KGNC--------------------VE-------L---
A0A3Q2XZL8_MCL1-01      ---QHL--KEKG-RAHC--------------------VE-------P---
A0A3B4AFB7_MCL1-02      ---QYL--KTKG-RESC--------------------VE-------R---
A0A3B3VM25_MCL1-01      ---QHL--KERG-REHC--------------------VE-------L---
A0A3Q0R633_MCL1-01      ---QRL--KEKG-RDNC--------------------VE-------L---
A0A3Q0R633_MCL1-03      ---QRL--KEKG-RDNC--------------------VE-------L---
A0A3B4T8L9_MCL1-02      ---QRM--KETG-RENC--------------------VE-------S---
A0A3B4T8L9_MCL1-01      ---QRM--KETG-RENC--------------------VE-------S---
A0A3Q1EQB9_MCL1-02      ---QYL--KERG-RENC--------------------VD-------L---
A0A3B4ZKP6_MCL1-01      ---QYL--KERG-RENC--------------------VD-------L---
A0A3Q1BKL8_MCL1-02      ---QYL--KERG-RENC--------------------VD-------L---
A0A3Q1EQB9_MCL1-01      ---QYL--KERG-RENC--------------------VD-------L---
A0A3Q1BKL8_MCL1-01      ---QYL--KERG-RENC--------------------VD-------L---
A0A3P8RQX7_MCL1-01      ---QYL--KERG-RENC--------------------VD-------L---
A0A3P8RQX7_MCL1-02      ---QYL--KERG-RENC--------------------VD-------L---
A0A3Q3VP02_MCL1-01      ---QCL--KENG-KSDR--------------------VE-------L---
A0A3B5K5B3_MCL1-01      ---QHM--KDNG-RRDC--------------------VE-------P---
A0A3B3IJ04_MCL1-01      ---QSL--KEKG-RGHC--------------------VD-------L---
A0A3P9L1F3_MCL1-01      ---QSL--KEKG-RGHC--------------------VD-------L---
A0A3B3IJ04_MCL1-02      ---QSL--KEKG-RGHC--------------------VD-------L---
A0A3P9L1F3_MCL1-02      ---QSL--KEKG-RGHC--------------------VD-------L---
A0A3B3CEX1_MCL1-02      ---LQL--KEKG-RGHS--------------------VD-------L---
A0A3B3CEX1_MCL1-01      ---LQL--KEKG-RGHS--------------------VD-------L---
A0A3Q3B4P5_MCL1-01      ---VHL--KEKG-REEC--------------------VE-------L---
A0A3Q3B4P5_MCL1-02      ---VHL--KEKG-REEC--------------------VE-------L---
A0A3Q2EDX8_MCL1-01      ---QHL--KEKG-RENC--------------------VE-------L---
A0A3Q2P7X9_MCL1-01      ---QHL--KESG-RSHC--------------------VD-------L---
A0A3Q2P7X9_MCL1-02      ---QHL--KESG-RSHC--------------------VD-------L---
A0A3B5PQ55_MCL1-02      ---QRL--KERG-REHC--------------------VE-------L---
A0A3B5PQ55_MCL1-01      ---QRL--KERG-REHC--------------------VE-------L---
A0A3P9Q4I8_MCL1-02      ---QHL--KERG-REHC--------------------VD-------L---
A0A3P9Q4I8_MCL1-01      ---QHL--KERG-REHC--------------------VD-------L---
A0A087X830_MCL1-01      ---QHL--KERG-REHC--------------------VE-------L---
A0A3B3YCD0_MCL1-01      ---QHL--KERG-REHC--------------------VE-------L---
I3JHR5_MCL1-01          ---QHL--KEKG-RDNC--------------------VA-------L---
A0A3Q4HLQ8_MCL1-01      ---QHL--KEKG-RDNC--------------------VA-------L---
A0A3P8NP63_MCL1-02      ---QHL--KEKG-RDNY--------------------VA-------L---
A0A3Q2VNL8_MCL1-01      ---QHL--KEKG-RDNY--------------------VA-------L---
A0A3P8NP63_MCL1-01      ---QHL--KEKG-RDNY--------------------VA-------L---
A0A3P9BVM3_MCL1-01      ---QHL--KEKG-RDNY--------------------VA-------L---
A0A3B4G4Z6_MCL1-01      ---QHL--KEKG-RDNY--------------------VA-------L---
A0A2U9CJ81_MCL1-01      ---QHL--KETG-RGNC--------------------VE-------L---
A0A3P8VKM5_MCL1-05      ---QHL--KECG-QENS--------------------TE-------L---
A0A3P8VKM5_MCL1-04      ---QHL--KECG-QENS--------------------TE-------L---
A0A3P8VKM5_MCL1-03      ---QHL--KECG-QENS--------------------TE-------L---
A0A3Q3IZW0_MCL1-01      ---QYL--KEKG-RENC--------------------VE-------L---
A0A3Q1GX28_MCL1-02      ---QHL--KEKH-RENC--------------------VD-------L---
A0A3Q1GX28_MCL1-01      ---QHL--KEKH-RENC--------------------VD-------L---
A0A3B4XKA5_MCL1-01      ---QHM--KDTG-RENC--------------------VE-------S---
A0A3Q3GP42_MCL1-01      ---QYL--KENG-RGHC--------------------VE-------L---
A0A3Q3M6G2_MCL1-01      ---QYL--KEKG-RGDC--------------------VE-------L---
A0A3Q3M6G2_MCL1-02      ---QYL--KEKG-RGDC--------------------VE-------L---
A0A3B1IEV7_MCL1-01      ---DHL--KKKS-RDHC--------------------VE-------N---
A0A3B4CGU9_MCL1-03      ---EQM--KEAG-REQC--------------------VE-------N---
A0A3B4CGU9_MCL1-02      ---EWL--KEVG-REQC--------------------VE-------N---
Q8UWD6_MCL1-01          ---KYQ--NDRG-HSKY--------------------VR-------L---
A2BF68_MCL1-01          ---KYQ--NDRG-HSKY--------------------VR-------L---
Q568W5_MCL1-01          ---KYQ--NDRG-HSKY--------------------VR-------L---
A0A3B1K5R1_MCL1-01      ---KHQ--HDMG-RGHC--------------------VS-------L---
A0A3B4C6H5_MCL1-01      ---QHQ--NQMG-RGHC--------------------VS-------L---
A0A3B4C6H5_MCL1-03      ---QHQ--NQMG-RGHC--------------------VS-------L---
Q9Z0F3_BCL2L10-01       -----------N-QGPYMAVK------QKRDLGNRVIVT-------R---
E1B9B3_BCL2L10-01       -----------E-RPPQTT--------RRQEKRDDDGVS-------R---
A0A1U7QVA0_BCL2L10      -----------S-QE------------QRNRLKDKMKVL-------Q---
F1RZB9_BCL2L10-01       -----------E-RHPREACGRKK---------KEGNVS-------R---
F1MV39_BCL2L10-01       -----------E-RPPQTT---------RRQKRDDDGVS-------R---
W5QIG4_BCL2L10-01       -----------E-RQPQTT---------RRQKRDDGSVS-------R---
Q99M66_BCL2L10-01       -----------N-QDRTVK---RRRDQRNRLL-----LE-------R---
F6ZPD4_BCL2L10-01       -----------E-RAPRGTYRKPKRGYKLELREWKAGVD-------R---
A0A2K6F2Q2_BCL2L10      -----------E-RGPPVTAWWKKWGLQPQPKEGDPEVA-------R---
H0WZ06_BCL2L10-01       -----------Q-RPPVEARREKQD--KSQLKEGEDEVA-------R---
A0A1U7UZD8_BCL2L10      -----------E-RGPLLPAGGQQRGFRPRRKKEEGDVA-------R---
G1T264_BCL2L10-01       -----------D-RGPPVTTQ----------RVRRNEIA-------R---
A0A0D9RG38_BCL2L10      -----------E-REPLMTAWWKKQSFQPRL-EQEGDVA-------R---
A0A2K5RIU7_BCL2L10      -----------E-RGPLVTARWKKWGFQSRLKEPEGNVS-------R---
A0A2K5F974_BCL2L10      -----------E-RGPLVTARWKKWGFQSRLKEPEGDVA-------R---
A0A2K6TIT7_BCL2L10      -----------E-RGPLVTARWKKWGFQSRLKEPEGDVA-------R---
F7CT87_BCL2L10-01       -----------E-RGPLVTARWKKWGFQSRLKEPEGDVA-------R---
A0A096NM44_BCL2L10      -----------E-REPLVTAWWKKRSFQPRLKEQEGDVA-------R---
A0A2K6R5T5_BCL2L10      -----------E-REPLVTAWWKKRSFQPRLKEQEGEVA-------R---
Q9HD36_BCL2L10-02       -----------E-RGPLVTARWKKWGFQPRLKEQEGDVA-------R---
G1R3W6_BCL2L10-01       -----------E-RGPLVTARWKKWGFQPRLKEQEGDVA-------R---
A0A2K5K3B0_BCL2L10      -----------E-REPLVTAWWKKRSFQPRLKEQEGDVA-------R---
A0A2K6M5H5_BCL2L10      -----------E-REPLVTAWWKKRSFQPRLKEQEGDVA-------R---
A0A2K5TKG9_BCL2L10      -----------E-REPLVTAWWKKRGFQPRLKEQEGDVA-------R---
F7H6U5_BCL2L10-01       -----------E-REPLVTAWWKKRGFQPRLKEQEGDVA-------R---
A0A2K6B2D9_BCL2L10      -----------E-REPLVTAWWKKRGFQPRLKEQEGDVA-------R---
A0A2K5MMZ4_BCL2L10      -----------E-REPLVTAWWKKRGFQPRLKEQEGDVA-------R---
H2NN92_BCL2L10-01       -----------E-RGPLVTARWKKWGFQPRLKEQEGDVA-------R---
A0A2R9BCD9_BCL2L10      -----------E-RGPLVTTRWKKWGFQPRLKEQEGDVA-------R---
H2Q9G4_BCL2L10-01       -----------E-RGPLVTTRWKKWGFQPRLNEQEGDVA-------R---
G3QLU6_BCL2L10-01       -----------E-RGPLVTARWKKWGFQPRLKEQEGDVA-------R---
A0A337RYG8_BCL2L10      -----------E-RPPPGTYLNLTPDQQQEL-EWETNVG-------Q---
G1LKR4_BCL2L10-01       -----------E-RSPSGTYSNLGPDQELELGEWEAGVR-------Q---
A0A452QJG0_BCL2L10      -----------E-RSPSGTYSNLGPDQELELGEREAGVR-------Q---
R4JQR8_BCL2L1-01        ---VKC--VQRG-MPQL--------------------VD-------S---
A0A346RRN1_BCL2L1-      ---VEC--VQNG-MPQL--------------------VD-------S---
A0A3Q4MN81_BCL2L10      ---RKI--LEQK---PG--------------------LD-------P--G
A0A3B4ETX9_BCL2L10      ---RKI--LEQK---PG--------------------LD-------P--G
D2IT42_BCL2L10-02       ---RQL--QEKKGVQLG--------------------QD-------P--G
A0A3Q0S9R1_BCL2L10      ---RKR--LEQKP---G--------------------LD-------P--G
I3J363_BCL2L10-01       ---RKI--LEQKP---G--------------------LD-------P--G
A0A3Q2UUN9_BCL2L10      ---RKI--LEQKP---G--------------------LD-------P--R
A0A3P8PVZ8_BCL2L10      ---RKI--LEQKP---G--------------------LD-------P--R
A0A3Q2UUN9_BCL2L10      ---RKI--LEQKP---G--------------------LD-------P--R
A0A3P9BLI0_BCL2L10      ---RKI--LEQKP---G--------------------LD-------P--R
A0A3Q2PJS5_BCL2L10      ---RQL--QEQQGRSPG--------------------PD-------P--G
A0A3Q2GL87_BCL2L10      ---RQL--QEQTGKNPG--------------------LD-------P--G
A0A3B5MJ12_BCL2L10      ---RQL--REQTGKNPV--------------------PD-------S--G
M4AUW7_BCL2L10-01       ---RQL--REQTGKNPV--------------------PD-------S--G
A0A096ME02_BCL2L10      ---RQL--REQTGKNPG--------------------PD-------S--G
A0A3B3TYN4_BCL2L10      ---RQL--REQTGKNPG--------------------PD-------S--G
A0A3B3YT99_BCL2L10      ---RQL--REQTGKNPG--------------------PD-------S--G
A0A3P9NE65_BCL2L10      ---RQL--REQTGKNPG--------------------PD-------S--G
A0A3P9IIZ2_BCL2L10      ---RQL--REQTDMNPG--------------------LD-------P---
A0A3P9LM07_BCL2L10      ---RQL--REQTDMNPG--------------------LD-------P---
H2MBQ3_BCL2L10-01       ---RQL--REQTDMNPG--------------------LD-------P---
A0A3B4AAV4_BCL2L10      ---RHI--KEQKSSRPG--------------------LD-------P--G
A0A3Q3EZT5_BCL2L10      ---RQL--QEQEDVKLG--------------------LD-------P--V
A0A3Q3EZT5_BCL2L10      ---RQL--QEQEDVKLG--------------------LD-------P--V
A0A3Q3JQ78_BCL2L10      ---RQL--TEQNGMKPG--------------------LD-------P--G
A0A3B4TIY6_BCL2L10      ---RLL--LEQNRVNPG--------------------LD-------P--G
A0A3B4WGF4_BCL2L10      ---RLL--LEQNRVNPG--------------------LD-------P--G
A0A3Q3KZW1_BCL2L10      ---RQL--MEQKGMKPG--------------------LD-------S--G
A0A3B5KD08_BCL2L10      ---RLM--QEQKSTKPG--------------------LD-------P--G
A0A3Q3VI28_BCL2L10      ---RQL--LEQKSTKPG--------------------LE-------PRQD
A0A3Q1GM98_BCL2L10      ---RQL--LEQKDTKPG--------------------LD-------P--G
A0A3Q1D2L0_BCL2L10      ---RQL--LEQKDTKLG--------------------LD-------P--G
A0A3P8RL82_BCL2L10      ---RQL--LEQKDTKPG--------------------LD-------P--G
A0A3B4ZFS0_BCL2L10      ---RQL--QEQRDTKPG--------------------LE-------P--G
A0A3B3C5I4_BCL2L10      ---RQL--REQTDTNPG--------------------LD-------L---
A0A3Q1IAB0_BCL2L10      ---RQM--LEQKDKKPG--------------------LD-------L--G
A0A3P8W7K5_BCL2L10      ---KQL--LVQKGLKPG--------------------QE-------P--E
H3AAS7_BCL2L2-02        ---VES--VDKE-MASL--------------------VG-------R---
H3AAS7_BCL2L2-01        ---VES--VDKE-MASL--------------------VG-------R---
G1Q051_BCL2L2-01        ---VES--VNKE-MEPL--------------------VG-------Q---
G3WPT1_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A287D9B3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A482LX62_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
W5QDH4_BCL2L2-02        ---AES--VNKE-MEPL--------------------VG-------Q---
Q7TS60_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
G1LMC3_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
M3Y5X5_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
G1P3J2_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
G3WPT1_BCL2L2-02        ---AES--VNKE-MEPL--------------------VG-------Q---
G1TV33_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
P70345_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
O88996_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A3Q9B4M8_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
H0XR82_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A250YBR2_BCL2L2-      ---AES--INKE-MEPL--------------------VG-------Q---
A0A250YBR2_BCL2L2-      ---AES--INKE-MEPL--------------------VG-------Q---
L8HP19_BCL2L2-02        ---AES--VNKE-MEPL--------------------VG-------Q---
L8HP19_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
Q1RMX3_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A452ECF0_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A286XQQ9_BCL2L2-      ---AES--VNKE-MQPL--------------------VG-------Q---
A0A2K5RUN8_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5MZX9_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A0D9RU30_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5HEJ9_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A1S3FYD8_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2I2UAE3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2I2YPX6_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A287D9B3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5V0Q3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
F7G4L5_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6EA59_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6AI25_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A1U7RC37_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2I3GEA7_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2R9A2Q3_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
H2Q805_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A096NX09_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6GWM6_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6ME72_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6RW35_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6RW35_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K6TM77_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A287ATE4_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A1U7UJF2_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A452SHI1_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
Q05KI8_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
Q568V1_MCL1-01          ---SRL--KELQ-QDQC--------------------VE-------R---
Q1L8X3_MCL1-01          ---SRL--KELQ-QDQC--------------------VE-------R---
Q9I9N3_MCL1-01          ---SRL--KELQ-QDQC--------------------VE-------R---
A0A286XUI2_BCL2A1-      ---LKK--LPREPIAPD--------------------VD-------T---
A0A452U285_BCL2A1-      ---TKK--LLQERISPD--------------------VD-------A---
A0A452U285_BCL2A1-      ---TKK--LLQERISPD--------------------VD-------A---
A0A3B3R4U0_MCL1-01      ----KY--LKDHGQTNC--------------------VD-------D---
F7CP56_BCL2A1-03        ---FDK--HGNR-------------------------LG-------R---
Q2TAP5_BCL2L1-01        ---VES--ANKE-MTDL--------------------LP-------R---
Q91828_BCL2L1-01        ---VES--ANKE-MTDL--------------------LP-------R---
I7GKS6_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5EBP4_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5Q6R6_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6UWY8_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A3P8V8T6_MCL1-01      ---QHL--KEKG-WENT--------------------VD-------Q---
A0A3P8YNB4_BCL2-01      ---VEC--VNKE-MTSQ--------------------VD-------H---
A0A3P8WUE9_BCL2-01      ---VEC--AAKEDLTPQ--------------------VE-------Q---
A0A3B4A3G8_BCL2-01      ---VEC--ASKEDMSSQ--------------------VD-------N---
A0A3Q3G1D7_BCL2-01      ---VEC--MSKQEMTSQ--------------------VD-------N---
A0A3Q2XQX2_BCL2-02      ---VEC--ATKEDMTSQ--------------------VD-------N---
A0A3Q2XQX2_BCL2-01      ---VEC--ATKEDMTSQ--------------------VD-------N---
A0A3Q3B0R2_BCL2-01      ---VEC--ASREEMTPQ--------------------VD-------H---
A0A3Q2PN77_BCL2-01      ---VEC--ASKEGMSSQ--------------------VD-------N---
A0A3P9J8Y9_BCL2-01      ---VEC--ASNEEMSTQ--------------------VA-------S---
A0A3Q0S5Z7_BCL2-01      ---VEC--ASNEGMTSQ--------------------VD-------N---
A0A3P8QVM8_BCL2-01      ---VEC--ASNEGMSSQ--------------------VD-------N---
A0A3P9DIG5_BCL2-01      ---VEC--ASNEGMSSQ--------------------VD-------N---
A0A3Q2UYW8_BCL2-01      ---VEC--ASNEGMSSQ--------------------VD-------N---
A0A3B4G3K4_BCL2-01      ---VEC--ASNEGMSSQ--------------------VD-------N---
A0A2U9BJ09_BCL2-01      ---VEC--ADTEEMTSQ--------------------VD-------N---
A0A3Q1I5N1_BCL2-01      ---VEC--ASKEEMTPQ--------------------VN-------N---
A0A3Q3K1K1_BCL2-01      ---VEC--AAKEEMTPQ--------------------VD-------K---
A0A3Q3MEY1_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
A0A1X9JZA1_BCL2-01      ---VEC--VAKEEMAAQ--------------------VN-------N---
A0A4D6FTA2_BCL2-01      ---VEC--VAKEEMTPQ--------------------VD-------N---
A0A3Q1FLK7_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
A0A3Q1B8C3_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
A0A3P8S9L3_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
A0A3B5BBQ0_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
A0A3B4TX71_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
A0A3B4YAG2_BCL2-01      ---VEC--AAKEEMTSQ--------------------VD-------N---
Q5XGJ4_BCL2L2-01        ---AES--VNKE-MSPL--------------------LP-------R---
F7G6M3_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5CWY6_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
A0A2K5CWY6_BCL2L2-      ---AES--VNKE-MEPL--------------------VG-------Q---
G3TMU7_BCL2L2-01        ---AES--VNKE-MEPL--------------------VG-------Q---
G1TW27_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------N---
E2RS00_BCL2A1-02        ---KKL--LEQR-ISSD--------------------VD-------A---
A0A2K5M8B1_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5H963_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5VPG2_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5YR37_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2R8Z9D7_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A096NV05_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6QFA2_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A1U7T4L4_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6G3C5_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A3Q1LRT3_BCL2L1-      ---MKS--IDKE-IHVL--------------------VS-------Q---
H9GHK7_BCL2L1-01        ---VES--VDKE-MQGL--------------------VV-------R---
Q07816_BCL2L1-04        CCRAEE--GPGD-LQQM--------------------AP-------H---
A0A493TIA6_BCL2L1-      ---VES--VDKE-MRVL--------------------VG-------R---
Q07816_BCL2L1-03        ---VES--VDKE-MRVL--------------------VG-------R---
Q07816_BCL2L1-02        ---VES--VDKE-MRVL--------------------VG-------R---
Q07816_BCL2L1-01        ---VES--VDKE-MRVL--------------------VG-------R---
G1N5N5_BCL2L1-01        ---VES--VDKE-MRVL--------------------VG-------R---
A0A452ILL8_BCL2L1-      ---VES--VDKE-MQVL--------------------VG-------R---
A0A452ILL8_BCL2L1-      ---VES--VDKE-MQVL--------------------VG-------R---
K7F655_BCL2L1-01        ---VES--VDKE-MQVL--------------------VG-------R---
A0A452E1B1_BCL2L1-      ---MKS--IVKE-MQVL--------------------VS-------Q---
W5PSA5_BCL2L1-01        ---MKS--IVKE-MQVL--------------------VS-------Q---
P53563_BCL2L1-02        ---VES--VDKE-MQVL--------------------VS-------R---
P53563_BCL2L1-03        ---VES--VDKE-MQVL--------------------VS-------R---
A0A287CZ07_BCL2L1-      ---MES--VDKE-MQVL--------------------VS-------R---
A0A3Q2H0F6_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
F6WA14_BCL2L1-01        ---VES--VDKE-MEVL--------------------VG-------R---
G3WKX6_BCL2L1-01        ---VES--VDKE-MEVL--------------------VA-------R---
M3XA94_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
M3XA94_BCL2L1-02        ---VES--VDKE-MQVL--------------------VS-------R---
H0X6V2_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
G3SPN0_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
Q2PFS6_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
O35843_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
M3XA94_BCL2L1-03        ---VES--VDKE-MQVL--------------------VS-------R---
G1RER8_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A1S2ZQT6_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
Q64373_BCL2L1-09        ---VES--VDKE-MQVL--------------------VS-------R---
Q64373_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
P53563_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
O77737_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
Q9MYW4_BCL2L1-01        ---VES--VDKE-MEVL--------------------VS-------R---
A0A3Q2H0F6_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
L8J061_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
Q05KJ0_BCL2L1-02        ---VES--VDKE-MQVL--------------------VS-------R---
Q05KJ0_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
E2IV76_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6G3C5_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
B2Z3Z4_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
G3HEA7_BCL2L1-02        ---VES--VDKE-MQVL--------------------VS-------R---
G3HEA7_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A1U7T4L4_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
M3Z2H9_BCL2L1-01        ---VES--VDKE-MQAL--------------------VS-------R---
A0A1U7QU73_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A0D9RJZ8_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A286Y5D6_BCL2L1-      ---VES--VDKE-MQVL--------------------VR-------R---
A0A250YD48_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A1L5BWY3_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
I3MUP5_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
I3MUP5_BCL2L1-02        ---VES--VDKE-MQVL--------------------VS-------R---
I3MUP5_BCL2L1-03        ---VES--VDKE-MQVL--------------------VS-------R---
G1P9D2_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5EBP4_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
E2IV75_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
F7IT34_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
Q76LT7_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5Q6R6_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5Q6R6_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5M8B1_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5H963_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
Q8SQ42_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5VPG2_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K5YR37_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2R8Z9D7_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A096NV05_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2J8VIH3_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6QFA2_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6QFA2_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A2K6UWY8_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
E2IV77_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A452SDS4_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A384D3U1_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A452FWV3_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
Q9MZS7_BCL2L1-01        ---VES--VDKE-MQVL--------------------VS-------R---
A0A3B3TCS4_BCL2-01      ---VES--VNRE-MTSQ--------------------VD-------N---
A0A0U3DHY6_BCL2-01      ---VES--VNRE-MTSQ--------------------VD-------N---
A0A3P9AAB2_BCL2-01      ---VES--VNRE-MTPQ--------------------VN-------N---
F6YNL8_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------S---
A0A218UQA0_BCL2-01      ---VES--VNRE-MFPL--------------------VD-------N---
Q00709_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A493T1X3_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------S---
U3KEW4_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------S---
G3WZW9_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------S---
A0A452R110_BCL2-02      ---VES--VNRE-MSPL--------------------VD-------N---
E2QWA1_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
G1LIC9_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A452R110_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
M3YYK3_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K6R2I5_BCL2-02      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2R9APW6_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
M3X1R9_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------N---
G3SLZ1_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
Q75SV7_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
M3X1R9_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
Q8I008_BCL2-01          ---VEG--VNRE-MSPL--------------------VD-------N---
A0A076FU27_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------S---
A0A4P8GLJ2_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------S---
F6R2C4_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------S---
O02718_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------S---
A0A076FZV9_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------S---
A0A452EV13_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------S---
A0A250YD83_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A9QXG9_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K5NZS5_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A0D9S017_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K6CIX3_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K5XRD4_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K6KHG1_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K6R2I5_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K5HK49_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
G3QES9_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
H2QEM8_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A2I3GZF9_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K6UEL3_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
G3WZW9_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------S---
G3SLZ1_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------N---
A0A452T603_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
H3ANS8_BCL2L1-01        ---VES--MDKE-MSSL--------------------VE-------R---
A0A452FHY1_BCL2L1-      ---MES--VDKE-MQVL--------------------VS-------Q---
A0A452FHY1_BCL2L1-      ---MES--VDKE-MQVL--------------------VS-------Q---
A0A1S3EPX7_BCL2L1-      ---VES--VDKE-MQVL--------------------VS-------R---
A0A218USB3_BCL2L1-      ---VES--VVKE-MRVL--------------------VK-------R---
H0Z8G3_BCL2L1-01        ---VES--VVKE-MRVL--------------------VK-------R---
A0A218USB3_BCL2L1-      ---VES--VVKE-MRVL--------------------VK-------R---
U3JSL7_BCL2L1-01        ---VES--VVKE-MRVL--------------------VK-------R---
A0A218USB3_BCL2L1-      ---VES--VVKE-MRVL--------------------VK-------R---
A0A218USB3_BCL2L1-      ---VES--VVKE-MRVL--------------------VK-------R---
Q4U2V6_BCL2L1-01        ---VES--VVKE-MRVL--------------------VK-------R---
X4ZGI8_BCL2-01          ---VES--FNRE-MASQ--------------------VD-------N---
A0A3B3E2W4_BCL2L1-      ---VEC--VERN-MSEL--------------------VS-------R---
A0A3B3I2Q5_BCL2L1-      ---VEC--VERN-MGEL--------------------VS-------R---
A0A3P9I2N4_BCL2L1-      ---VEC--VERN-MGEL--------------------VS-------R---
A0A3P9MKK4_BCL2L1-      ---VEC--VERN-MGEL--------------------VS-------R---
A0A3B5B4X7_BCL2L1-      ---VEC--VDKN-MNEL--------------------VP-------R---
A0A3B4BFZ8_BCL2L1-      ---VEC--VEKD-MSIL--------------------VP-------R---
A0A3Q3FUB6_BCL2L1-      ---VEC--VQKD-MGEL--------------------VS-------R---
A0A3B5MGS2_BCL2L1-      ---VDC--VQKN-MSEL--------------------VS-------R---
M4A558_BCL2L1-01        ---VDC--VQKN-MSEL--------------------VS-------R---
A0A3P9QFB3_BCL2L1-      ---VDC--VQKN-MSEL--------------------VS-------R---
A0A087YBW4_BCL2L1-      ---VDC--VQKN-MSEL--------------------VS-------R---
A0A3B3VWI7_BCL2L1-      ---VDC--VQKN-MSEL--------------------VS-------R---
A0A3B3XN57_BCL2L1-      ---VDC--VQKN-MSEL--------------------VS-------R---
A0A3Q2C6K4_BCL2L1-      ---VHC--VQKN-MSEL--------------------VS-------R---
A0A3Q2NRP4_BCL2L1-      ---VDC--VQKN-MSEL--------------------VP-------R---
A0A0B4KJI5_BCL2L1-      ---VEC--VEKD-TSEL--------------------VS-------R---
A0A3Q1JZ46_BCL2L1-      ---VEC--VEKN-MSEL--------------------VS-------R---
A0A3Q1JZ46_BCL2L1-      ---VEC--VEKN-MSEL--------------------VS-------R---
A0A3Q3NFM4_BCL2L1-      ---VEC--IEKN-MSAL--------------------VS-------R---
A0A3Q3NFM4_BCL2L1-      ---VEC--IEKN-MSAL--------------------VS-------R---
A0A3B4V9K8_BCL2L1-      ---VEC--IQKN-MSEL--------------------VS-------R---
A0A3B4XS24_BCL2L1-      ---VEC--IQKN-MSEL--------------------VS-------R---
C1BLI0_BCL2L1-01        ---AEC--VEKD-MSHL--------------------VA-------R---
C0HAD8_BCL2L1-01        ---VEC--VEKD-MSPL--------------------VA-------R---
A0A3B3ZMX9_BCL2L1-      ---VEC--VDKE-MSTL--------------------VA-------R---
A0A3B5K6B9_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3B5K6B9_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
H3CH49_BCL2L1-01        ---VEC--VEKE-MNPL--------------------VG-------R---
A0A3B3TFR4_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------H---
A0A3P8XYL5_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
Q90Z98_BCL2L1-02        ---VEC--VEKE-MSPL--------------------VG-------R---
Q90Z98_BCL2L1-01        ---VEC--VEKE-MSPL--------------------VG-------R---
A0A059PJI5_BCL2L1-      ---VEC--VEKE-MSPL--------------------VA-------R---
A0A3B4DTL9_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q2FR43_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
B5XAY3_BCL2L1-01        ---VEC--VDKE-MNPL--------------------VG-------R---
W5MG74_BCL2L1-01        ---VEC--VEKE-MSNL--------------------VS-------R---
A0A2U9BY16_BCL2L1-      ---VEC--VEKE-MSSL--------------------VG-------R---
A0A3Q3B3X5_BCL2L1-      ---VEC--VEKE-MSHL--------------------VA-------R---
A0A3B3IB64_BCL2L1-      ---VEC--VEKE-MSPL--------------------VD-------R---
A0A3P9JYH1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VD-------R---
A0A3B3DHA1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VD-------R---
A0A3Q0RTF8_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
I3IZK7_BCL2L1-01        ---VEC--VEKE-MSPL--------------------VG-------R---
A0A2U9BY16_BCL2L1-      ---VEC--VEKE-MSSL--------------------VG-------R---
A0A2U9BY16_BCL2L1-      ---VEC--VEKE-MSSL--------------------VG-------R---
A0A2U9BY16_BCL2L1-      ---VEC--VEKE-MSSL--------------------VG-------R---
A0A0D6DR75_BCL2L1-      ---VEC--VEKE-MSQL--------------------VV-------R---
A0A3Q3WIW8_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A219P0Y3_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q3MX20_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q3G2E1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q3G2E1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q3G2E1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q1GZ93_BCL2L1-      ---VEC--VEKE-MSQL--------------------VG-------R---
A0A3Q1GZ93_BCL2L1-      ---VEC--VEKE-MSQL--------------------VG-------R---
A0A3Q1GZ93_BCL2L1-      ---VEC--VEKE-MSQL--------------------VG-------R---
A0A3B4V3T1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3B4XU17_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3P9MKK4_BCL2L1-      ---VEC--VERN-MGEL--------------------VS-------R---
A0A3B3I2Q5_BCL2L1-      ---VEC--VERN-MGEL--------------------VS-------R---
A0A3P9I2N4_BCL2L1-      ---VEC--VERN-MGEL--------------------VS-------R---
A0A3B4AFB7_MCL1-01      ---QYL--KTKG-RESC--------------------VE-------R---
B9ZYL7_BCL2-01          ---VEI--VNRE-MSPL--------------------VD-------S---
M3Y8D1_BCL2L10-01       ---ERP--PSGA-CSNLGPDPELELELGEWEASVRQDCR-------R---
A0A3Q2Y539_MCL1-01      ---QAL--KENQ-QERC--------------------VE-------L---
A0A3Q3BEB7_BCL2L1-      ---VQC--VERD-MSEL--------------------VS-------R---
A0A3P8VMA1_BCL2L1-      ---VEC--VQRN-MSEL--------------------VP-------R---
A0A345BSW9_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A286MU87_BCL2L1-      ---VEC--VEKD-MSPL--------------------VA-------R---
A0A3P8XFS0_BCL2L1-      ---VEC--VEKD-MSLL--------------------VA-------R---
A0A3P8XFS0_BCL2L1-      ---VEC--VEKD-MSLL--------------------VA-------R---
A0A0F7L1T6_BCL2L1-      ---VEC--VERD-ASQL--------------------VC-------R---
H2U5I3_BCL2L1-01        ---VEC--VEKD-ASQL--------------------VC-------R---
H2U5I3_BCL2L1-02        ---VEC--VEKD-ASQL--------------------VC-------R---
A0A3Q3J5K3_BCL2L1-      ---VEC--VEKN-MSEL--------------------VS-------R---
A0A3Q1EVP6_BCL2L1-      ---VEC--VEKN-MSEL--------------------VP-------R---
A0A3Q1BQA0_BCL2L1-      ---VEC--VEKN-MSEL--------------------VP-------R---
A0A3P8U812_BCL2L1-      ---VEC--VDKN-MSEL--------------------VP-------R---
E6ZFR0_BCL2L1-01        ---VEC--VEKD-MSEL--------------------VS-------R---
G3P7B4_BCL2L1-01        ---VEC--VEKD-MTEL--------------------VS-------R---
A0A3Q3X5M5_BCL2L1-      ---VEC--AEKD-TGEL--------------------VC-------R---
A0A2U9BIG9_BCL2L1-      ---VEC--VEKN-RGEL--------------------VA-------R---
D2ITA2_BCL2L1-02        ---VEC--VEKE-MSHM--------------------VP-------R---
A0A3B3ZMX9_BCL2L1-      ---VEC--VDKE-MSTL--------------------VA-------R---
G3NJY1_BCL2L1-01        ---VEC--VDKE-MSPL--------------------VG-------R---
A0A2U9BY16_BCL2L1-      ---VEC--VEKE-MSSL--------------------VG-------R---
A0A3Q3DUT7_BCL2L1-      ---VEC--MEKE-MIPL--------------------VD-------R---
A0A3Q3DUT7_BCL2L1-      ---VEC--MEKE-MIPL--------------------VD-------R---
A0A3Q3DUT7_BCL2L1-      ---VEC--MEKE-MIPL--------------------VD-------R---
A0A3B1JJ42_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3P8UWG7_BCL2L1-      ---VEC--VEKE-MSQL--------------------VA-------R---
A0A3Q3IVF5_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q1DHJ3_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q1DHJ3_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q1DHJ3_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3P8TL99_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3P8TL99_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q1FR00_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3B4Z3X2_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3B4Z3X2_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
C3VIT1_BCL2L1-01        ---VEC--VERE-MSPL--------------------VG-------R---
A0A3P8P0F1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q2X557_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3P9D632_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3P9D632_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q4N4B5_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3B4FNX1_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3Q2QPL9_BCL2L1-      ---VEC--VEKE-MSPL--------------------VG-------R---
A0A3B5PQJ0_BCL2L1-      ---VEC--VEKE-MSHL--------------------VA-------R---
A0A087X9B7_BCL2L1-      ---VEC--VEKE-MSHL--------------------VA-------R---
A0A3B3TUS7_BCL2L1-      ---VEC--VEKE-MSHL--------------------VA-------R---
A0A3B3WI27_BCL2L1-      ---VEC--VEKE-MSHL--------------------VA-------R---
A0A3P9N9Y4_BCL2L1-      ---VEC--VEKE-MSHL--------------------VA-------R---
A0A3B3QRZ2_BCL2L1-      ---VEC--VEKE-MGHL--------------------VD-------R---
Q564A4_BCL2-01          ---VES--VNRE-MASQ--------------------VD-------N---
H9GPE7_BCL2-01          ---VES--VSRE-MSPL--------------------VD-------N---
A0A452I9V7_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------S---
W5N4F7_BCL2-01          ---VES--VNRE-MTSQ--------------------VD-------N---
K7F5Y3_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------S---
A0A3Q2HRY3_BCL2-02      ---VES--VNRE-MSPL--------------------VD-------N---
H0YUX3_BCL2-01          ---VES--VNRE-MFPL--------------------VD-------N---
K7F5Y3_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------S---
F1LNV0_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
P49950_BCL2-01          ---VGS--VNRE-MSPL--------------------VD-------N---
G1TW27_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K5EB04_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2R8MY14_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
H2NWH5_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A096MPU7_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K5PP81_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
H0WKI0_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K5UDI5_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
P10417_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
Q7TSN8_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
A0A3Q2HRY3_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
E2QWA1_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------N---
A0A2K6G3I7_BCL2-01      ---VES--VNRE-MSPL--------------------VD-------N---
Q6R755_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
Q9JJV8_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
Q923R6_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
H0W1T3_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
G1LIC9_BCL2-02          ---VES--VNRE-MSPL--------------------VD-------N---
I3MVK9_BCL2-01          ---VES--VNRE-MSPL--------------------VD-------N---
                                                                          

P70345_BCL2L2-02        ---------------VQDWMVAYLET-RLADWIHS-SGGW----------
G1MZW1_BCL2-01          ---------------IATWMTEYLNR-HLHNWIQD-NGGW----------
A0A3Q1FR00_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQG-QGGW----------
F6VJQ0_BCL2L10-01       ---------------LTEKLCNYLVE-RKGAWLHE-NGGW----------
A0A2K5DMS4_MCL1-01      ---------------LAESI--------------R-YSRW----------
U3KKY6_MCL1-01          ---------------LAGIITDALVS-SKRQWLES-QGGW----------
G1MPY7_MCL1-01          ---------------LAGIITDALVS-SKREWLMS-QGGW----------
K7FPN7_MCL1-01          ---------------LAGIITDVLVS-DKRDWLVN-QRGW----------
H3AR18_MCL1-01          ---------------LAVSITDFLVQ-NKGDWILK-NQGW----------
J7H260_MCL1-01          ---------------LADSFTDYLMT-QKKEWIVE-HNGW----------
G1PZ39_MCL1-01          ---------------PDSLGTALRSK-AGKVWETS-NTCH----------
Q9Z1P3_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A5PJR2_MCL1-01          ---------------LAESITDVLVR-SKRDWIVK-QRGW----------
A0A452GA25_MCL1-01      ---------------LAESITDVLVR-SKRDWIVK-QRGW----------
G1L3L7_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
G1T2Q0_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F7AVA6_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A337S3J9_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A337S3J9_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
Q7YRZ9_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F1PAP1_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
Q8HYS5_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
M3XZZ5_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A452RHX5_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
H0XFB7_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F7GTF7_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5CFH3_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K6V5Y3_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K6KRW9_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5XSB2_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A0D9RZP5_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
I7G687_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5LXU8_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2I3GJZ3_MCL1-02      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
H2N5Y9_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2R9BPJ5_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2I3RTV4_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2I2YQH7_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5C7L5_MCL1-01      ---------------FCRCCWS-------RSWF-----------------
A0A2K5I9I0_MCL1-02      ---------------FCRCCWS-------RSWF-----------------
A0A2K6GI15_MCL1-01      ---------------FCRCCWS-------RSWF-----------------
A0A2I3GJZ3_MCL1-01      ---------------FCRCCWS-------RSWF-----------------
A0A2K5CFH3_MCL1-03      ---------------FCRCCWS-------RSWF-----------------
A0A2K5R5E2_MCL1-03      ---------------FCRCCWS-------RSWF-----------------
A0A2K5W0W9_MCL1-01      ---------------FCRCCWS-------RSWF-----------------
A0A2K6ECR0_MCL1-02      ---------------FCRCCWS-------RSWF-----------------
A0A2I3LFM0_MCL1-01      ---------------FCRCCWS-------RSWF-----------------
A0A2K6KRW9_MCL1-02      ---------------FCRCCWS-------RSWF-----------------
A0A2K6PPI3_MCL1-02      ---------------FCRCCWS-------RSWF-----------------
Q95KR3_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5EPX0_MCL1-02      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5EPX0_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
G3WBC5_MCL1-01          ---------------LAESITDVLVK-SKRDWLMK-QKGW----------
W5QI41_MCL1-01          ---------------LAESITDVLVR-SKRDWIVK-QRGW----------
F1MQX4_MCL1-01          ---------------LAESITDVLVR-SKRDWIVK-ERGW----------
A0A287BK44_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
B4DLY8_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
B4DG83_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
B4E3L8_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
H3AR18_MCL1-02          ---------------LAVSITDFLVQ-NKGDWILK-NQGW----------
E2RS00_BCL2A1-01        ---------------VSYFVAEFITR-NMRDWIRQ-NGGW----------
B6V6J0_MCL1-01          ---------------LAEHFTQFLMM-SKKDWIIQ-EKGW----------
G3PJT0_MCL1-01          ---------------VGQEISAYLLS-DQRDWLIK-NNAW----------
H0XHA5_MCL1-01          ---------------LEENIADVLVR-TKPDWLVK-QRGW----------
A0A2I2YPX6_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6TM77_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5RUN8_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6GWM6_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
W5QDH4_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6ME72_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6RW35_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A287ATE4_BCL2L2-      ---------------VQEWMVTYLET-RLADWIHS-SGGW----------
A0A2R8M4C0_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A452UF16_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5MZX9_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5HEJ9_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5V0Q3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
F7G4L5_BCL2L2-02        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6EA59_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6AI25_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A1U7RC37_BCL2L2-      ---------------VQDWMVTYLET-RLADWIHS-SGGW----------
A0A2I3GEA7_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2R9A2Q3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
H2Q805_BCL2L2-02        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A096NX09_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A287ATE4_BCL2L2-      ---------------VQEWMVTYLET-RLADWIHS-SGGW----------
A0A4D6NWN1_BCL2L2-      ---------------VQEWMVTYLES-RLADWIHS-SGGW----------
A0A1U7UJF2_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A452UF16_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6F6N9_MCL1-01      ---------------LAESITDILVR-TKRDWL-----------------
G1QAV8_MCL1-01          ---------------LAEDITDVLVG-TERGWLVK-QRGW----------
H9GEA6_MCL1-02          ---------------LIEIITDVLVT-DKREWLLK-HNAW----------
H9GEA6_MCL1-01          ---------------LIEIITDVLVT-DKREWLLK-HNAW----------
A0A493U0E8_MCL1-01      ---------------LARIITDALVS-SKREWLVS-QGGW----------
A0A1L1RNM6_MCL1-01      ---------------LAGIITDALVS-SKREWLMS-QGGW----------
A0A1L1RNM6_MCL1-02      ---------------LAGIITDALVS-SKREWLMS-QGGW----------
G2HFR3_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F6ZMX1_MCL1-01          ---------------LAESITDVLVK-TKRDWLIK-QKGW----------
F6ZMX1_MCL1-03          ---------------LAESITDVLVK-TKRDWLIK-QKGW----------
F6ZMX1_MCL1-02          ---------------LAESITDVLVK-TKRDWLIK-QKGW----------
G1T2Q0_MCL1-02          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F1PAP1_MCL1-02          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A337S3J9_MCL1-04      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F7AVA6_MCL1-02          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K6GI15_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
C8YZ26_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
F7GTF7_MCL1-02          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5R5E2_MCL1-04      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K6V5Y3_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5LXU8_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5I9I0_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2I2YQH7_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
Q07820_MCL1-04          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5W0W9_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K6ECR0_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K5XSB2_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2R9BPJ5_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2I3RTV4_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2I3LFM0_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A2K6PPI3_MCL1-03      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A286Y1M5_MCL1-01      ---------------LAESITDALVH-SKRDWLVK-QRGW----------
B4DU51_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A287DCH9_MCL1-02      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
P97287_MCL1-01          ---------------LAETITDVLVR-TKRDWLVK-QRGW----------
A0A452GA25_MCL1-02      ---------------LAESITDVLVR-SKRDWIVK-QRGW----------
A0A287DCH9_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
G3T756_MCL1-01          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A1S3F3I1_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
G1L3L7_MCL1-02          ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A287BK44_MCL1-01      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A0A287BK44_MCL1-02      ---------------LAESITDVLVR-TKRDWLVK-QRGW----------
A2BF68_MCL1-02          ---------------VGEEISSYLLT-EQRDWILR-NKAW----------
G1QEX2_BCL2L10-01       ---------------LVTFLCSWLTE-THRTWMEA-QGGW----------
I3KXG5_MCL1-01          ------------VVLVSQEISAYLLS-EQRDWIIK-NNAW----------
H0ZCL9_BCL2A1-01        ------------KEQISYFITEYIIN-NKAEWIDA-NGGW----------
U3JTB2_BCL2A1-01        ------------KEEISYFITEYIIN-NKSEWIDA-NGGW----------
A0A218V8Z6_BCL2A1-      ------------KEEISYFITEYIIN-NKAEWIDA-NGGW----------
Q9W6F2_BCL2A1-01        ------------KEKISYFITEYIIN-NKAAWIDA-NGGW----------
A0A493SSZ7_BCL2A1-      ------------KEQISYFITEYIIN-NKAEWIDA-NGGW----------
G1N8C5_BCL2A1-01        ------------KEQISYFITEYIIN-NKAAWIDA-NGGW----------
A0A452J3N6_BCL2A1-      ------------KKQISYFITEYIIN-TKAEWIEA-NGGW----------
K7G130_BCL2A1-01        ------------KEQISYFITEYIIN-TKAEWIDA-NGGW----------
F7CP56_BCL2A1-02        ------------YKEISYFVAEFITK-NTGEWIRQ-NGGWVIAHSQYQKS
F7CP56_BCL2A1-01        ------------YKEISYFVAEFITK-NTGEWIRQ-NGGWVIAHSQYQKS
F6SFL4_BCL2A1-01        ------------QEEISHFIAEFIMN-NIAEWIRQ-NGGW----------
G3WSP8_BCL2A1-01        ------------HEEISHFIAEFIMN-NIAEWIRQ-NGGW----------
A0A2K5PYQ3_BCL2A1-      ------------YKEISYFVAEYIMN-NTGEWIRQ-NGGW----------
A0A2K5PYQ3_BCL2A1-      ------------YKEISYFVAEYIMN-NTGEWIRQ-NGGW----------
F6S8G3_BCL2A1-01        ------------REEISCFIAEFTTH-HAGEWIRQ-NGGW----------
O55178_BCL2A1-01        ------------LQTSFQF-------------------------------
Q0P538_BCL2A1-01        ------------LQTSFQF-------------------------------
G3V977_BCL2A1-01        ------------YKQVSSFVAEFIMN-NTGEWIQQ-NGGW----------
Q925A9_BCL2A1-01        ------------YKQVSSFVAEFIMN-NTGEWIQQ-NGGW----------
Q07440_BCL2A1-01        ------------YKQVSSFVAEFIMN-NTGEWIRQ-NGGW----------
O55179_BCL2A1-01        ------------YKQVSSFVAEFIMN-NTGEWIRR-NGGW----------
O55177_BCL2A1-02        ------------YKQVSSFVAEFIIN-NTGEWIRR-NGGW----------
Q497M6_BCL2A1-01        ------------YKQVSSFVAEFIIN-NTGEWIRR-NGGW----------
Q8K164_BCL2A1-01        ------------YKQVSSFVAEFIIN-NTGEWIRR-NGGW----------
Q4FK02_BCL2A1-01        ------------YKQVSSFVAEFIIN-NTGEWIRR-NGGW----------
A0A452SIR9_BCL2A1-      ------------SR-ISYFVAEFITT-NMREWIRQ-NGGW----------
M3YVH4_BCL2A1-01        ------------SR-VSYFVAEFITT-NMREWIRQ-NGGW----------
U6CQS8_BCL2A1-01        ------------SR-VSYFVAEFITT-NMREWIRQ-NGGW----------
I3MCZ7_BCL2A1-01        ------------DEEISYFVAEFIMN-NAGEWIRQ-NGGW----------
G3T8E6_BCL2A1-01        ------------YKKISSFVAEFIVD-NTAEWIRQ-NGGW----------
H0WZ23_BCL2A1-01        ------------YKEISYFVAEFIMN-YTGEWIRQ-NGGW----------
A0A2I3HBP6_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5D2I1_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWISQ-NGGW----------
B4E1X9_BCL2A1-01        ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2I2YML2_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2R8ZJX9_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2I3HBP6_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6PHF2_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6LV19_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5TMD1_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5KAA3_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6DS18_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A096NMX5_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6AD27_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6TLJ5_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRR-NGGW----------
F7HXW0_BCL2A1-01        ------------YKEISHFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6TLJ5_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRR-NGGW----------
A0A2K6EKG1_BCL2A1-      ------------YKEISYFIAEFITN-NAGEWIRQ-NGGW----------
A0A452EK63_BCL2A1-      ------------CKDISYFVAEFITE-NTGEWIRQ-NGGW----------
W5Q0N6_BCL2A1-01        ------------CKDISYFVAEFITK-NTGEWIRQ-NGGW----------
L8IZT5_BCL2A1-01        ------------CKDISYFVAEFITE-NTGEWIKQ-NGGW----------
Q3C2I0_BCL2A1-01        ------------CKDISFFVAEFITE-NTGEWIKQ-NGGW----------
F7CP56_BCL2A1-04        ------------YKEISYFVAEFITK-NTGEWIRQ-NGGW----------
C7F841_BCL2A1-01        ------------YKEISYFVAEFITK-NTGQWIRQ-NGGW----------
A0A2K5D2I1_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWISQ-NGGW----------
H2NNZ9_BCL2A1-01        ------------YKEISYFVAEFVMN-NTGGWIKQ-NGGW----------
A0A2I2YML2_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6LV19_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6PHF2_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5KHH8_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5KHH8_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5KAA3_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K5TMD1_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
F7E8V5_BCL2A1-01        ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6DS18_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2K6AD27_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A096NMX5_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A0D9RRC3_BCL2A1-      ------------YKEISYFVAEFITN-NTGEWIRQ-NGGW----------
Q16548_BCL2A1-01        ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
A0A2R8ZJX9_BCL2A1-      ------------YKEISYFVAEFIMN-NTGEWIRQ-NGGW----------
W5MMB7_MCL1-01          ---------------VGQAISNYLLQ-DQREWLLN-NRGW----------
A0A3B3SG34_MCL1-01      ---------------VGKQISSYLLS-EQRQWLLK-NKAW----------
Q4SW32_MCL1-01          ---------------VAQEISTYLLT-DQRDWLIK-NNAW----------
D2ITA0_MCL1-03          ---------------VAEEISSYLLS-DQREWLVK-NNSW----------
D2ITA0_MCL1-04          ---------------VAEEISSYLLS-DQREWLVK-NNSW----------
A0A3P9ILF6_MCL1-01      ---------------VSQEICTYLLS-EQRNWLVN-NNSW----------
A0A3P9ILF6_MCL1-02      ---------------VSQEICTYLLS-EQRNWLVN-NNSW----------
Q0KFR9_MCL1-01          ---------------VGQEIAKYLLS-DQSDWLIK-NNAW----------
A0A3P8Y1W8_MCL1-02      ---------------VGQEISTYLLT-DQRAWLVK-NNAW----------
A0A3P8Y1W8_MCL1-01      ---------------VGQEISTYLLT-DQRAWLVK-NNAW----------
A0A3Q2XZL8_MCL1-01      ---------------VADEISSYLLS-HQRNWLVK-NNSW----------
A0A3B4AFB7_MCL1-02      ---------------VGQEISSYLLL-DQRDWLVR-NNAW----------
A0A3B3VM25_MCL1-01      ---------------VIQEISTYLLE-NQRDWLAK-NNSW----------
A0A3Q0R633_MCL1-01      ---------------VSQEISTYLLS-DQRDWLVK-NNAW----------
A0A3Q0R633_MCL1-03      ---------------VSQEISTYLLS-DQRDWLVK-NNAW----------
A0A3B4T8L9_MCL1-02      ---------------VGQEISKYLLS-DQRDWLVK-NNSW----------
A0A3B4T8L9_MCL1-01      ---------------VGQEISKYLLS-DQRDWLVK-NNSW----------
A0A3Q1EQB9_MCL1-02      ---------------VSQEISTYLLS-EQRDWLVK-NNSW----------
A0A3B4ZKP6_MCL1-01      ---------------VSEEISTYLLC-DQRDWLVK-NNSW----------
A0A3Q1BKL8_MCL1-02      ---------------VSQEISTYLLS-EQRDWLVK-NNSW----------
A0A3Q1EQB9_MCL1-01      ---------------VSQEISTYLLS-EQRDWLVK-NNSW----------
A0A3Q1BKL8_MCL1-01      ---------------VSQEISTYLLS-EQRDWLVK-NNSW----------
A0A3P8RQX7_MCL1-01      ---------------VSQEISTYLLS-EQRDWLVK-NNSW----------
A0A3P8RQX7_MCL1-02      ---------------VSQEISTYLLS-EQRDWLVK-NNSW----------
A0A3Q3VP02_MCL1-01      ---------------VAHEISTYLLT-DQRDWMCV---GG----------
A0A3B5K5B3_MCL1-01      ---------------VAQEISTYLLT-DRRDWLIK-NNGW----------
A0A3B3IJ04_MCL1-01      ---------------VSQEICTYLLS-EQRNWLVN-NNSW----------
A0A3P9L1F3_MCL1-01      ---------------VSQEICTYLLS-EQRNWLVN-NNSW----------
A0A3B3IJ04_MCL1-02      ---------------VSQEICTYLLS-EQRNWLVN-NNSW----------
A0A3P9L1F3_MCL1-02      ---------------VSQEICTYLLS-EQRNWLVN-NNSW----------
A0A3B3CEX1_MCL1-02      ---------------VSQEICTYLLR-EQRDWLIN-NNSW----------
A0A3B3CEX1_MCL1-01      ---------------VSQEICTYLLR-EQRDWLIN-NNSW----------
A0A3Q3B4P5_MCL1-01      ---------------VGQEISTYLLS-EQKDWLLK-NNSW----------
A0A3Q3B4P5_MCL1-02      ---------------VGQEISTYLLS-EQKDWLLK-NNSW----------
A0A3Q2EDX8_MCL1-01      ---------------VSQEISTYLLQ-NQRDWLVK-NNSW----------
A0A3Q2P7X9_MCL1-01      ---------------VSREISTYLLT-NQRDWLAK-NNSW----------
A0A3Q2P7X9_MCL1-02      ---------------VSREISTYLLT-NQRDWLAK-NNSW----------
A0A3B5PQ55_MCL1-02      ---------------VSRKISTYLLA-NQRDWLAK-NNSW----------
A0A3B5PQ55_MCL1-01      ---------------VSRKISTYLLA-NQRDWLAK-NNSW----------
A0A3P9Q4I8_MCL1-02      ---------------VSQEISTYLLA-KQRDWLAK-NNSW----------
A0A3P9Q4I8_MCL1-01      ---------------VSQEISTYLLA-KQRDWLAK-NNSW----------
A0A087X830_MCL1-01      ---------------VSKEISTYLLE-NQRDWLAK-NNSW----------
A0A3B3YCD0_MCL1-01      ---------------VSKEISTYLLE-NQRDWLAK-NNSW----------
I3JHR5_MCL1-01          ---------------VSQEVSAYLLS-EQRDWIVK-NNAW----------
A0A3Q4HLQ8_MCL1-01      ---------------VSQEISAYLLS-EQRDWIVK-NNAW----------
A0A3P8NP63_MCL1-02      ---------------VSQEISAYLLS-EQRDWIVK-NNAW----------
A0A3Q2VNL8_MCL1-01      ---------------VSQEISAYLLS-EQRDWIVK-NNAW----------
A0A3P8NP63_MCL1-01      ---------------VSQEISAYLLS-EQRDWIVK-NNAW----------
A0A3P9BVM3_MCL1-01      ---------------VSQEISAYLLS-EQRDWIVK-NNAW----------
A0A3B4G4Z6_MCL1-01      ---------------VSQEISAYLLS-EQRDWIVK-NNAW----------
A0A2U9CJ81_MCL1-01      ---------------VGQEISTYLLT-DQRDWLVK-NNSW----------
A0A3P8VKM5_MCL1-05      ---------------VGREISSYLLS-YQRDWLLK-NNSW----------
A0A3P8VKM5_MCL1-04      ---------------VGREISSYLLS-YQRDWLLK-NNSW----------
A0A3P8VKM5_MCL1-03      ---------------VGREISSYLLS-YQRDWLLK-NNSW----------
A0A3Q3IZW0_MCL1-01      ---------------VGQEISTYLLS-HQRDWLVK-NNAW----------
A0A3Q1GX28_MCL1-02      ---------------VAQEISSYLLS-AQRDWLVR-NNSW----------
A0A3Q1GX28_MCL1-01      ---------------VAQEISSYLLS-AQRDWLVR-NNSW----------
A0A3B4XKA5_MCL1-01      ---------------VGQEISKYLLS-DQRDWLVK-NNSW----------
A0A3Q3GP42_MCL1-01      ---------------VGQEISTYLLS-DHRDWLVK-NNAW----------
A0A3Q3M6G2_MCL1-01      ---------------VGQEISTYLLS-DQRDWLVK-NNSW----------
A0A3Q3M6G2_MCL1-02      ---------------VGQEISTYLLS-DQRDWLVK-NNSW----------
A0A3B1IEV7_MCL1-01      ---------------VAQHISTYLNT-HQHQWLIN-NNAW----------
A0A3B4CGU9_MCL1-03      ---------------VIQHISTYLST-DQRQWLIN-NKAW----------
A0A3B4CGU9_MCL1-02      ---------------VIQHISMYLST-DQRQWLIN-NKAW----------
Q8UWD6_MCL1-01          ---------------VGEEISSYLLT-EQRDWILR-NKAW----------
A2BF68_MCL1-01          ---------------VGEEISSYLLT-EQRDWILR-NKAW----------
Q568W5_MCL1-01          ---------------VGEEISSYLLT-EQRDWILR-NKAW----------
A0A3B1K5R1_MCL1-01      ---------------VGEELSSYLLS-DERDWLLK-NKAW----------
A0A3B4C6H5_MCL1-01      ---------------VGQEISSYLLS-DQKDWLLK-NKAW----------
A0A3B4C6H5_MCL1-03      ---------------VGQEISSYLLS-DQKDWLLK-NKAW----------
Q9Z0F3_BCL2L10-01       -----------DCCLIVNFLYNLLMGRRHRARLEA-LGGW----------
E1B9B3_BCL2L10-01       -----------DCRLLVALLCAQFCE-RHRAWLMT-NGGW----------
A0A1U7QVA0_BCL2L10      -----------DCQLIVALLCNRLLR-RHRSWLEA-QGGW----------
F1RZB9_BCL2L10-01       -----------DCRLLVALLCAQLSG-QHRTWLLA-NGGW----------
F1MV39_BCL2L10-01       -----------DCRLLVALLCAQFCE-RHRAWLMA-NGGW----------
W5QIG4_BCL2L10-01       -----------DCRLLVALLCAQFCE-RHRAWLMA-NGGW----------
Q99M66_BCL2L10-01       -----------DCYLIVSLLYNRLTG-RHRSWLEA-HGGW----------
F6ZPD4_BCL2L10-01       -----------DWPRLVDFLCAWLKG-RHRAWLEA-HYGW----------
A0A2K6F2Q2_BCL2L10      -----------DRQRLVALLCARLAG-QHRAWLQA-QGGW----------
H0WZ06_BCL2L10-01       -----------DCQRLVALLSSRLVG-QHRVWLEA-QGGW----------
A0A1U7UZD8_BCL2L10      -----------DCQRLVALLSARLAG-RHRAWLQA-QGGW----------
G1T264_BCL2L10-01       -----------DCQRLVALLCARLAG-QHRAWLQA-QGGW----------
A0A0D9RG38_BCL2L10      -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
A0A2K5RIU7_BCL2L10      -----------DRQRLVGLLSSRLVG-QHRAWLEA-QGGW----------
A0A2K5F974_BCL2L10      -----------DCQRLVALLSSRLVG-QHRAWLEA-QGGW----------
A0A2K6TIT7_BCL2L10      -----------DCQRLVGLLSSRLVG-QHRAWLEA-QGGW----------
F7CT87_BCL2L10-01       -----------DCQRLVALLSSRLVG-QHRAWLEA-QGGW----------
A0A096NM44_BCL2L10      -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
A0A2K6R5T5_BCL2L10      -----------DCQRLVALLSSRLTG-QHRAWLQA-QGGW----------
Q9HD36_BCL2L10-02       -----------DCQRLVALLSSRLMG-QHRAWLQA-QGGW----------
G1R3W6_BCL2L10-01       -----------DCQRLVALLSSRLVG-QHRAWLQA-QGGW----------
A0A2K5K3B0_BCL2L10      -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
A0A2K6M5H5_BCL2L10      -----------DCQRLVALLSSRLTG-QHRAWLQA-QGGW----------
A0A2K5TKG9_BCL2L10      -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
F7H6U5_BCL2L10-01       -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
A0A2K6B2D9_BCL2L10      -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
A0A2K5MMZ4_BCL2L10      -----------DCQRLVALLSSRLAG-QHRAWLQA-QGGW----------
H2NN92_BCL2L10-01       -----------DCQRLVALLSSRLVG-QHRAWLQA-QGGW----------
A0A2R9BCD9_BCL2L10      -----------DCQRLVALLSSRLVG-QHRAWLQA-QGGW----------
H2Q9G4_BCL2L10-01       -----------DCQRLVALLSSRLVG-QHRAWLQA-QGGW----------
G3QLU6_BCL2L10-01       -----------DCQRLVALLSSRLMG-QHRAWLQA-QGGW----------
A0A337RYG8_BCL2L10      -----------DCQHLVALLCNRLTG-RHRAWLEA-HDGW----------
G1LKR4_BCL2L10-01       -----------DCRHLVDFLCNRLTG-QHRAWLEA-HDGW----------
A0A452QJG0_BCL2L10      -----------DCRHLVDFLCNRLTG-QHRAWLEA-HDGW----------
R4JQR8_BCL2L1-01        ---------------IVDWVSTYLCN-SLEQWITD-NGGW----------
A0A346RRN1_BCL2L1-      ---------------IVDWVSVYLCD-NLEPWITS-NGGW----------
A0A3Q4MN81_BCL2L10      QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
A0A3B4ETX9_BCL2L10      QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
D2IT42_BCL2L10-02       TGRALGQVPGGSCRGLAETIADYLGE-EKRDWLLE-NGGW----------
A0A3Q0S9R1_BCL2L10      QQQELGQEP-ISCRELAETIADYLGE-EKKDWLLD-NDGW----------
I3J363_BCL2L10-01       QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
A0A3Q2UUN9_BCL2L10      QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
A0A3P8PVZ8_BCL2L10      QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
A0A3Q2UUN9_BCL2L10      QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
A0A3P9BLI0_BCL2L10      QQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLD-NDGW----------
A0A3Q2PJS5_BCL2L10      RQQ----EP-VSCRELAETIADYLEK-HKKDWLQE-NDGW----------
A0A3Q2GL87_BCL2L10      RQQELQTEP-VSCRALAETIADYLET-HKKDWLQE-NNGW----------
A0A3B5MJ12_BCL2L10      KQQELQQEP-VSCRALAETIADYLEK-HKKDWLQE-NNGW----------
M4AUW7_BCL2L10-01       KQQELQQEP-VSCRALAETIADYLEK-HKKDWLQE-NNGW----------
A0A096ME02_BCL2L10      KQQELQQEP-VSCRALAETIADYLEK-HKKDWLQE-NNGW----------
A0A3B3TYN4_BCL2L10      KQQELQQEP-VSCRALAETIADYLEK-HKKDWLQE-NNGW----------
A0A3B3YT99_BCL2L10      KQQELQQEP-VSCRALAETIADYLEK-HKKDWLQE-NNGW----------
A0A3P9NE65_BCL2L10      KQQELQQET-VSCRALAETIADYLEK-HKKDWLQE-NNGW----------
A0A3P9IIZ2_BCL2L10      -GREVAAGP-VSCQALAETVADFLGG-DKKEWMLE-NDGW----------
A0A3P9LM07_BCL2L10      -GREVAPGP-VSCQALAETVADFLGG-DKKEWMLE-NDGW----------
H2MBQ3_BCL2L10-01       -GREVAPGP-VSCQALAETVADFLGG-DKKEWMLE-NDGW----------
A0A3B4AAV4_BCL2L10      QVQGLGQVP-SDCRRLAQTIADYLGE-EKRDWLLE-NGGW----------
A0A3Q3EZT5_BCL2L10      QGQKLGQGP-GHCRGLAETIADYLGE-EKKEWLLE-NDGW----------
A0A3Q3EZT5_BCL2L10      QGQKLGQGP-GHCRGLAETIADYLGE-EKKEWLLE-NDGW----------
A0A3Q3JQ78_BCL2L10      QGQELGQGP-GNCRELAETIADYLGE-EKKDWLLE-NDGW----------
A0A3B4TIY6_BCL2L10      QGQGLG-----NCRGLAETIADYLGE-EKKDWLLE-NGGW----------
A0A3B4WGF4_BCL2L10      QGQGLR-----NCRGLAETIADYLGE-EKKDWLLE-NGGW----------
A0A3Q3KZW1_BCL2L10      KGQELGQGP-ESCRGLAETIADYLGE-EKKDWLQE-NDGW----------
A0A3B5KD08_BCL2L10      QEQQLGQVP-ENCRGLAETIADYLGE-EKKDWLLE-NGGW----------
A0A3Q3VI28_BCL2L10      QDQELGQVP-GNCSELAETIADYLGE-EKKAWLLE-NDGW----------
A0A3Q1GM98_BCL2L10      KRQELGQRP-VNCRGLAETIADYLGE-EKKDWLLE-NDGW----------
A0A3Q1D2L0_BCL2L10      KQQELGQGP-VNCRELAETIADYLGE-EKKDWLLE-NDGW----------
A0A3P8RL82_BCL2L10      KQQELGQGP-VNCRELAETIADYLGE-EKKDWLLE-NDGW----------
A0A3B4ZFS0_BCL2L10      KRQELGQGP-VNCRGLAETIADYLGE-EKKDWLLE-NDGW----------
A0A3B3C5I4_BCL2L10      -GREAAPGP-VSCQALAETVADFLGG-DKKEWMLE-NDGW----------
A0A3Q1IAB0_BCL2L10      KGQELGQEP-GQCRGLAETIADYLGE-EKKDWLLE-NDGW----------
A0A3P8W7K5_BCL2L10      AGQELGPEP-GTCRELAETIADYLGE-EKKAWLLE-NGGW----------
H3AAS7_BCL2L2-02        ---------------IIDWTVTYVES-SLQDWINH-SGGW----------
H3AAS7_BCL2L2-01        ---------------IIDWTVTYVES-SLQDWINH-SGGW----------
G1Q051_BCL2L2-01        ---------------VQEWTVAYLEM-RLADWIHS-IGGW----------
G3WPT1_BCL2L2-01        ---------------EKRYGVHLKQG-ILARYLPS-KAGA----------
A0A287D9B3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A482LX62_BCL2L2-      ---------------VQEWMVTYLET-RLADWIHS-SASP----------
W5QDH4_BCL2L2-02        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
Q7TS60_BCL2L2-01        ---------------VQDWMVTYLET-RLADWIHS-SGGW----------
G1LMC3_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
M3Y5X5_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
G1P3J2_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
G3WPT1_BCL2L2-02        ---------------VQDWMVTYLET-QLADWIHS-SGGW----------
G1TV33_BCL2L2-01        ---------------VQEWMVTYLET-QLAGWIHS-TGGW----------
P70345_BCL2L2-01        ---------------VQDWMVAYLET-RLADWIHS-SGGW----------
O88996_BCL2L2-01        ---------------VQDWMVTYLET-RLADWIHS-SGGW----------
A0A3Q9B4M8_BCL2L2-      ---------------VPEWMVTYLET-RLADWIHS-SGGW----------
H0XR82_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A250YBR2_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A250YBR2_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
L8HP19_BCL2L2-02        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
L8HP19_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
Q1RMX3_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A452ECF0_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A286XQQ9_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5RUN8_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5MZX9_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A0D9RU30_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5HEJ9_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A1S3FYD8_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2I2UAE3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2I2YPX6_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A287D9B3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5V0Q3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
F7G4L5_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6EA59_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6AI25_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A1U7RC37_BCL2L2-      ---------------VQDWMVTYLET-RLADWIHS-SGGW----------
A0A2I3GEA7_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2R9A2Q3_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
H2Q805_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A096NX09_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6GWM6_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6ME72_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6RW35_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6RW35_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K6TM77_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A287ATE4_BCL2L2-      ---------------VQEWMVTYLET-RLADWIHS-SGGW----------
A0A1U7UJF2_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A452SHI1_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
Q05KI8_BCL2L2-01        ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
Q568V1_MCL1-01          ---------------VAEQISSYLTS-EQQDWILK-NKSC----------
Q1L8X3_MCL1-01          ---------------VAEQISSYLTS-EQQDWILK-NKSW----------
Q9I9N3_MCL1-01          ---------------VAEQISSYLTS-EQQDWILK-NKSW----------
A0A286XUI2_BCL2A1-      ------------YKEISYFVAEFIMS-RMGGWIRQ-NGGW----------
A0A452U285_BCL2A1-      ------------SR-ISYFVAEFITT-NMREWIRQ-NGGW----------
A0A452U285_BCL2A1-      ------------SR-ISYFVAEFITT-NMREWIRQ-NGGW----------
A0A3B3R4U0_MCL1-01      ---------------VASRISCYLLE-HQRDWLNR-NNGW----------
F7CP56_BCL2A1-03        ---------------GKGYYDTYLKR-CLQH--QE-VKPY----------
Q2TAP5_BCL2L1-01        ---------------IVQWMVNYLEH-TLQPWMQE-NGGW----------
Q91828_BCL2L1-01        ---------------IVQWMVNYLEH-TLQPWMQE-NGGW----------
I7GKS6_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5EBP4_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5Q6R6_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K6UWY8_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A3P8V8T6_MCL1-01      ---------------VGQEIASYLLS-YQKDWLLK-NNSW----------
A0A3P8YNB4_BCL2-01      ---------------IAGWMTEYLNG-PLHSWIQE-NGGW----------
A0A3P8WUE9_BCL2-01      ---------------VVDWMTEYLNG-PLNIWIKE-NGGW----------
A0A3B4A3G8_BCL2-01      ---------------IADWMTEYLNG-TLSSWIQD-NGGW----------
A0A3Q3G1D7_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3Q2XQX2_BCL2-02      ---------------IAEWMTEYLNG-PLGSWIQD-NGGW----------
A0A3Q2XQX2_BCL2-01      ---------------IAEWMTEYLNG-PLGSWIQD-NGGW----------
A0A3Q3B0R2_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIED-NGGW----------
A0A3Q2PN77_BCL2-01      ---------------IAEWMTEYLNG-PLGSWIQD-NGGW----------
A0A3P9J8Y9_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIEE-NGGW----------
A0A3Q0S5Z7_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3P8QVM8_BCL2-01      ---------------IADWMTEYLNG-PLNSWIQD-NGGW----------
A0A3P9DIG5_BCL2-01      ---------------IADWMTEYLNG-PLNSWIQD-NGGW----------
A0A3Q2UYW8_BCL2-01      ---------------IADWMTEYLNG-PLNSWIQD-NGGW----------
A0A3B4G3K4_BCL2-01      ---------------IADWMTEYLNG-PLNSWIQD-NGGW----------
A0A2U9BJ09_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIMD-NGGW----------
A0A3Q1I5N1_BCL2-01      ---------------IAEWMTEYLNG-PLHSWIQD-NGGW----------
A0A3Q3K1K1_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQE-NGGW----------
A0A3Q3MEY1_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A1X9JZA1_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A4D6FTA2_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3Q1FLK7_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3Q1B8C3_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3P8S9L3_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3B5BBQ0_BCL2-01      ---------------IAEWMTEYLNG-PLNSWIQD-NGGW----------
A0A3B4TX71_BCL2-01      ---------------IVEWMTEYLNG-PLNSWIKD-NGGW----------
A0A3B4YAG2_BCL2-01      ---------------IVEWMTEYLNG-PLNSWIKD-NGGW----------
Q5XGJ4_BCL2L2-01        ---------------IQDWMVTYLET-NLRDWIQS-NGGW----------
F7G6M3_BCL2L2-01        ---------------VQDWMVAYLDT-QLADWIRS-SGGW----------
A0A2K5CWY6_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
A0A2K5CWY6_BCL2L2-      ---------------VQEWMVAYLET-RLADWIHS-SGGW----------
G3TMU7_BCL2L2-01        ---------------VQEWMVVYLET-RLADWIHS-SGGW----------
G1TW27_BCL2-02          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
E2RS00_BCL2A1-02        -------------EKVSYFVAEFITR-NMRDWIRQ-NGGW----------
A0A2K5M8B1_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5H963_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A2K5VPG2_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5YR37_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2R8Z9D7_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A096NV05_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K6QFA2_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A1U7T4L4_BCL2L1-      ---------------IATWMATYLND-HLEPWIQD-NGGW----------
A0A2K6G3C5_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A3Q1LRT3_BCL2L1-      ---------------VTTSTATYLNN-HLKPWIQE-NGGW----------
H9GHK7_BCL2L1-01        ---------------IASWMTTYLTE-HLDPWIQE-NGGW----------
Q07816_BCL2L1-04        ----------RGDRGRSASAGIPAEP-QVTPWLCPLAPGW----------
A0A493TIA6_BCL2L1-      ---------------IVAWMTTYLSD-HLDPWIQE-NGGW----------
Q07816_BCL2L1-03        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
Q07816_BCL2L1-02        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
Q07816_BCL2L1-01        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
G1N5N5_BCL2L1-01        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
A0A452ILL8_BCL2L1-      ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
A0A452ILL8_BCL2L1-      ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
K7F655_BCL2L1-01        ---------------IASWMTTYLTD-HLDPWIQE-NGGW----------
A0A452E1B1_BCL2L1-      ---------------VTTWMATYLNN-HLEPWIQE-NGDW----------
W5PSA5_BCL2L1-01        ---------------VTTWMATYLND-HLEPWIQE-NGDW----------
P53563_BCL2L1-02        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
P53563_BCL2L1-03        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
A0A287CZ07_BCL2L1-      ---------------IASWM----------PWIQE-NGGW----------
A0A3Q2H0F6_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
F6WA14_BCL2L1-01        ---------------ITSWMATYLDD-HLDPWIQE-NGGW----------
G3WKX6_BCL2L1-01        ---------------ITSWMATYLDE-HLDPWIQE-NGGW----------
M3XA94_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
M3XA94_BCL2L1-02        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
H0X6V2_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
G3SPN0_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q2PFS6_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
O35843_BCL2L1-01        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
M3XA94_BCL2L1-03        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
G1RER8_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A1S2ZQT6_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q64373_BCL2L1-09        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
Q64373_BCL2L1-01        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
P53563_BCL2L1-01        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
O77737_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q9MYW4_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A3Q2H0F6_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
L8J061_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q05KJ0_BCL2L1-02        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q05KJ0_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
E2IV76_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A2K6G3C5_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
B2Z3Z4_BCL2L1-01        ---------------IASWMATYLND-HLEPWIQD-NGGW----------
G3HEA7_BCL2L1-02        ---------------IASWMATYLND-HLEPWIQD-NGGW----------
G3HEA7_BCL2L1-01        ---------------IASWMATYLND-HLEPWIQD-NGGW----------
A0A1U7T4L4_BCL2L1-      ---------------IATWMATYLND-HLEPWIQD-NGGW----------
M3Z2H9_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A1U7QU73_BCL2L1-      ---------------IASWMATYLND-HLEPWIQD-NGGW----------
A0A0D9RJZ8_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A286Y5D6_BCL2L1-      ---------------IASWMATYLND-HLEPWIQD-NGGW----------
A0A250YD48_BCL2L1-      ---------------IASWMATYLND-HLEPWIQE-NGGW----------
A0A1L5BWY3_BCL2L1-      ---------------IASWMATYLND-HLEPWIQE-NGGW----------
I3MUP5_BCL2L1-01        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
I3MUP5_BCL2L1-02        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
I3MUP5_BCL2L1-03        ---------------IASWMATYLND-HLEPWIQE-NGGW----------
G1P9D2_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A2K5EBP4_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
E2IV75_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
F7IT34_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
Q76LT7_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5Q6R6_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5Q6R6_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5M8B1_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5H963_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q8SQ42_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5VPG2_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K5YR37_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2R8Z9D7_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A096NV05_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2J8VIH3_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K6QFA2_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K6QFA2_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A2K6UWY8_BCL2L1-      ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
E2IV77_BCL2L1-01        ---------------IAAWMATYLND-HLEPWIQE-NGGW----------
A0A452SDS4_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A384D3U1_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A452FWV3_BCL2L1-      ---------------IATWMATYLND-HLEPWIQE-NGGW----------
Q9MZS7_BCL2L1-01        ---------------IATWMATYLND-HLEPWIQE-NGGW----------
A0A3B3TCS4_BCL2-01      ---------------IAHWMTEYLNG-PLHNWIQE-NGGW----------
A0A0U3DHY6_BCL2-01      ---------------IALWMTEYLNG-PLQNWIQE-NGGW----------
A0A3P9AAB2_BCL2-01      ---------------IVHWMTEYLNG-PLQNWIQE-NGGW----------
F6YNL8_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A218UQA0_BCL2-01      ---------------IATWMTEYLNR-HLHNWIQD-NGGW----------
Q00709_BCL2-01          ---------------IATWMTEYLNR-HLHNWIQD-NGGW----------
A0A493T1X3_BCL2-01      ---------------IAAWMTEYLNR-HLHNWIQD-NGGW----------
U3KEW4_BCL2-01          ---------------IAAWMTEYLNR-HLHNWIQD-NGGW----------
G3WZW9_BCL2-01          ---------------IALWMTEYLNR-HLHNWIQD-NGGW----------
A0A452R110_BCL2-02      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
E2QWA1_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
G1LIC9_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A452R110_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
M3YYK3_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K6R2I5_BCL2-02      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2R9APW6_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
M3X1R9_BCL2-02          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
G3SLZ1_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
Q75SV7_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
M3X1R9_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
Q8I008_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A076FU27_BCL2-01      ---------------IALWMTEYLNR-HLHAWIQD-NGGW----------
A0A4P8GLJ2_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
F6R2C4_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
O02718_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A076FZV9_BCL2-01      ---------------IALWMTEYLNR-HLHAWIQD-NGGW----------
A0A452EV13_BCL2-01      ---------------IALWMTEYLNR-HLHAWIQD-NGGW----------
A0A250YD83_BCL2-01      ---------------IALWMIEYLNR-HLHTWIQD-NGGW----------
A9QXG9_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K5NZS5_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A0D9S017_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K6CIX3_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K5XRD4_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K6KHG1_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K6R2I5_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K5HK49_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
G3QES9_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
H2QEM8_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2I3GZF9_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K6UEL3_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
G3WZW9_BCL2-02          ---------------IALWMTEYLNR-HLHNWIQD-NGGW----------
G3SLZ1_BCL2-02          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A452T603_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
H3ANS8_BCL2L1-01        ---------------IAEWMTTYLDD-NLNPWIQE-QGGW----------
A0A452FHY1_BCL2L1-      ---------------VMTWMASQLND-HLEPWIQE-NGGW----------
A0A452FHY1_BCL2L1-      ---------------VMTWMASQLND-HLEPWIQE-NGGW----------
A0A1S3EPX7_BCL2L1-      ---------------IASWMATYLND-HLEPWIQE-HGGW----------
A0A218USB3_BCL2L1-      ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
H0Z8G3_BCL2L1-01        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
A0A218USB3_BCL2L1-      ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
U3JSL7_BCL2L1-01        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
A0A218USB3_BCL2L1-      ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
A0A218USB3_BCL2L1-      ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
Q4U2V6_BCL2L1-01        ---------------IVSWMTTYLTD-HLDPWIQE-NGGW----------
X4ZGI8_BCL2-01          ---------------IAHWMTDYLNG-PLENWIEE-NGGW----------
A0A3B3E2W4_BCL2L1-      ---------------IAEWMTMYLDE-QISPWIHS-QGGW----------
A0A3B3I2Q5_BCL2L1-      ---------------IAEWMTQYLDE-QISPWIHS-HGGW----------
A0A3P9I2N4_BCL2L1-      ---------------IAEWMTQYLDE-QISPWIHS-HGGW----------
A0A3P9MKK4_BCL2L1-      ---------------IAEWMTQYLDE-QISPWIHS-HGGW----------
A0A3B5B4X7_BCL2L1-      ---------------IADWMTMYLDE-HISLWIQS-QGGW----------
A0A3B4BFZ8_BCL2L1-      ---------------IANWMTIYLDE-NIATWIQN-QGGW----------
A0A3Q3FUB6_BCL2L1-      ---------------IAGWMTTYLDE-HISAWIES-QGGW----------
A0A3B5MGS2_BCL2L1-      ---------------IAEWMTTYLDE-QLSPWIQS-QGGW----------
M4A558_BCL2L1-01        ---------------IAEWMTTYLDE-QLSPWIQS-QGGW----------
A0A3P9QFB3_BCL2L1-      ---------------IAEWMTTYLDE-QLNPWIQS-QGGW----------
A0A087YBW4_BCL2L1-      ---------------IAEWMTTYLDE-QLNPWIQS-QGGW----------
A0A3B3VWI7_BCL2L1-      ---------------IAEWMTTYLDE-QLNPWIQS-QGGW----------
A0A3B3XN57_BCL2L1-      ---------------IAEWMTTYLDE-QLNPWIQS-QGGW----------
A0A3Q2C6K4_BCL2L1-      ---------------IADWMTIYLDE-QLNPWIHS-QGGW----------
A0A3Q2NRP4_BCL2L1-      ---------------IADWMTIYLDE-QLDPWVRS-QGGW----------
A0A0B4KJI5_BCL2L1-      ---------------IADWMTMYLDE-HINPWIES-QGGW----------
A0A3Q1JZ46_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
A0A3Q1JZ46_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
A0A3Q3NFM4_BCL2L1-      ---------------IADWMTMYLDE-HISPWIES-QGGW----------
A0A3Q3NFM4_BCL2L1-      ---------------IADWMTMYLDE-HISPWIES-QGGW----------
A0A3B4V9K8_BCL2L1-      ---------------ITDWMTMYLDE-HISPWIQS-QGGW----------
A0A3B4XS24_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
C1BLI0_BCL2L1-01        ---------------IADWMTTYLDN-HIQPWIQR-QGGW----------
C0HAD8_BCL2L1-01        ---------------IADWMTTYLDN-HIQPWIQS-QGGW----------
A0A3B3ZMX9_BCL2L1-      ---------------IVTWMTVYLDE-HIQDWIDS-QGGW----------
A0A3B5K6B9_BCL2L1-      ---------------IIEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3B5K6B9_BCL2L1-      ---------------IIEWMTVYLDN-HIQPWIQS-QGGW----------
H3CH49_BCL2L1-01        ---------------IIEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3B3TFR4_BCL2L1-      ---------------IVDWMTVYLDN-HIQPWIQT-QGGW----------
A0A3P8XYL5_BCL2L1-      ---------------IADWMTVYLDN-HIQPWIES-QGGW----------
Q90Z98_BCL2L1-02        ---------------IAEWMTVYLDN-HIQPWIQS-QGGW----------
Q90Z98_BCL2L1-01        ---------------IAEWMTVYLDN-HIQPWIQS-QGGW----------
A0A059PJI5_BCL2L1-      ---------------IAEWMTVYLDN-HIQPWIEE-QGGW----------
A0A3B4DTL9_BCL2L1-      ---------------IAEWMTVYLDN-HIQPWIQE-QGGW----------
A0A3Q2FR43_BCL2L1-      ---------------IVEWMTVYLDE-QIDPWIQS-QGGW----------
B5XAY3_BCL2L1-01        ---------------ITDWMTVYLDN-HIQPWIQS-QGGW----------
W5MG74_BCL2L1-01        ---------------IAEWMTVYLDN-NIQPWIQS-QGGW----------
A0A2U9BY16_BCL2L1-      ---------------IVEWMTVYLDN-NIQPWIQS-QGGW----------
A0A3Q3B3X5_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3B3IB64_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3P9JYH1_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3B3DHA1_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3Q0RTF8_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
I3IZK7_BCL2L1-01        ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A2U9BY16_BCL2L1-      ---------------IVEWMTVYLDN-NIQPWIQS-QGGW----------
A0A2U9BY16_BCL2L1-      ---------------IVEWMTVYLDN-NIQPWIQS-QGGW----------
A0A2U9BY16_BCL2L1-      ---------------IVEWMTVYLDN-NIQPWIQS-QGGW----------
A0A0D6DR75_BCL2L1-      ---------------IVEWMTVYLDD-HIQPWIQS-QGGW----------
A0A3Q3WIW8_BCL2L1-      ---------------IIEWMTVYLDN-QIQPWIES-QGGW----------
A0A219P0Y3_BCL2L1-      ---------------IIEWKTRYLDN-HIQPWIQS-QRGW----------
A0A3Q3MX20_BCL2L1-      ---------------IVEWMTLYLDN-HIEPWIQS-QGGW----------
A0A3Q3G2E1_BCL2L1-      ---------------IIEWMTVYLDN-RIQPWIES-QGGW----------
A0A3Q3G2E1_BCL2L1-      ---------------IIEWMTVYLDN-RIQPWIES-QGGW----------
A0A3Q3G2E1_BCL2L1-      ---------------IIEWMTVYLDN-RIQPWIES-QGGW----------
A0A3Q1GZ93_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3Q1GZ93_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3Q1GZ93_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3B4V3T1_BCL2L1-      ---------------IVEWMTVYLDN-RIQPWIQS-QGGW----------
A0A3B4XU17_BCL2L1-      ---------------IVEWMTVYLDN-RIQPWIQS-QGGW----------
A0A3P9MKK4_BCL2L1-      ---------------IAEWMTQYLDE-QISPWIHS-HGGW----------
A0A3B3I2Q5_BCL2L1-      ---------------IAEWMTQYLDE-QISPWIHS-HGGW----------
A0A3P9I2N4_BCL2L1-      ---------------IAEWMTQYLDE-QISPWIHS-HGGW----------
A0A3B4AFB7_MCL1-01      ---------------VGQEISSYLLL-DQRDWLVR-NNAW----------
B9ZYL7_BCL2-01          ---------------IVGWMTEYLNR-HLQNWIQE-Q-------------
M3Y8D1_BCL2L10-01       ---------------LVDFLCGRLTG-QHRAWLEA-HGGW----------
A0A3Q2Y539_MCL1-01      ---------------VAQEVSTYLLS-HQRTWLVQ-HNGW----------
A0A3Q3BEB7_BCL2L1-      ---------------IADWMTVYLDE-QIGPWIDS-QGGW----------
A0A3P8VMA1_BCL2L1-      ---------------IADWMTMYLDE-YIDPWIQS-QGGW----------
A0A345BSW9_BCL2L1-      ---------------IAEWMTVYLDN-HIQPWIQS-QGGW----------
A0A286MU87_BCL2L1-      ---------------IADWMTTYLDN-HIQPWIQS-QGGW----------
A0A3P8XFS0_BCL2L1-      ---------------IADWMTTYLDE-HIQPWIQI-QGGW----------
A0A3P8XFS0_BCL2L1-      ---------------IADWMTTYLDE-HIQPWIQI-QGGW----------
A0A0F7L1T6_BCL2L1-      ---------------IADWMTIYLDE-HINPWIQS-QGGW----------
H2U5I3_BCL2L1-01        ---------------IADWMTIYLDE-HINPWIQS-QGGW----------
H2U5I3_BCL2L1-02        ---------------IADWMTIYLDE-HINPWIQS-QGGW----------
A0A3Q3J5K3_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQN-QGGW----------
A0A3Q1EVP6_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGDW----------
A0A3Q1BQA0_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
A0A3P8U812_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
E6ZFR0_BCL2L1-01        ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
G3P7B4_BCL2L1-01        ---------------IADWMTTYLDE-HISAWIQS-QGGW----------
A0A3Q3X5M5_BCL2L1-      ---------------IADWMTTYLDE-HINPWIQS-QGGW----------
A0A2U9BIG9_BCL2L1-      ---------------IADWMTMYLDE-HISPWIQS-QGGW----------
D2ITA2_BCL2L1-02        ---------------VAEWMTRYLDD-HIDHWIQS-NGGW----------
A0A3B3ZMX9_BCL2L1-      ---------------IVTWMTVYLDE-HIQDWIDS-QGGW----------
G3NJY1_BCL2L1-01        ---------------IVEWMTLYLDN-HIQPWIQN-QGGW----------
A0A2U9BY16_BCL2L1-      ---------------IVEWMTVYLDN-NIQPWIQS-QGGW----------
A0A3Q3DUT7_BCL2L1-      ---------------IIEWMTVYLDN-HLQPWIES-QGGW----------
A0A3Q3DUT7_BCL2L1-      ---------------IIEWMTVYLDN-HLQPWIES-QGGW----------
A0A3Q3DUT7_BCL2L1-      ---------------IIEWMTVYLDN-HLQPWIES-QGGW----------
A0A3B1JJ42_BCL2L1-      ---------------IAEWMTVYLDN-HIQPWIQE-QGGW----------
A0A3P8UWG7_BCL2L1-      ---------------IADWMTVYLDN-HIQPWIET-QGGW----------
A0A3Q3IVF5_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQG-QGGW----------
A0A3Q1DHJ3_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
A0A3Q1DHJ3_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
A0A3Q1DHJ3_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
A0A3P8TL99_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
A0A3P8TL99_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
A0A3Q1FR00_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQG-QGGW----------
A0A3B4Z3X2_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
A0A3B4Z3X2_BCL2L1-      ---------------IVEWMTVYLDN-HIQDWIQS-QGGW----------
C3VIT1_BCL2L1-01        ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3P8P0F1_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3Q2X557_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3P9D632_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3P9D632_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3Q4N4B5_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3B4FNX1_BCL2L1-      ---------------IVEWMTVYLDN-HIQPWIQS-QGGW----------
A0A3Q2QPL9_BCL2L1-      ---------------IVEWMTVYLDE-QIDPWIQS-QGGW----------
A0A3B5PQJ0_BCL2L1-      ---------------IVEWMTVYLDE-QIEPWVES-QGGW----------
A0A087X9B7_BCL2L1-      ---------------IVEWMTVYLDE-RIEPWVES-QGGW----------
A0A3B3TUS7_BCL2L1-      ---------------IVEWMTVYLDE-RIEPWVES-QGGW----------
A0A3B3WI27_BCL2L1-      ---------------IVEWMTVYLDE-RIEPWVES-QGGW----------
A0A3P9N9Y4_BCL2L1-      ---------------IVEWMTVYLDE-RIEPWVES-QGGW----------
A0A3B3QRZ2_BCL2L1-      ---------------IADWMTVYLDS-NIQPWIQR-QGGW----------
Q564A4_BCL2-01          ---------------IAHWMTDYLNG-PLENWIEE-NGGW----------
H9GPE7_BCL2-01          ---------------IATWMTEYLNQ-YLRNWIQE-NGGW----------
A0A452I9V7_BCL2-01      ---------------IAVWMTEYLNR-HLHNWIQD-NGGW----------
W5N4F7_BCL2-01          ---------------IANWMTEYLNG-PLQNWIQE-NGGW----------
K7F5Y3_BCL2-02          ---------------IAVWMTEYLNR-HLHNWIQD-NGGW----------
A0A3Q2HRY3_BCL2-02      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
H0YUX3_BCL2-01          ---------------IATWMTEYLNR-HLHNWIQD-NGGW----------
K7F5Y3_BCL2-01          ---------------IAVWMTEYLNR-HLHNWIQD-NGGW----------
F1LNV0_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
P49950_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
G1TW27_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K5EB04_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2R8MY14_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
H2NWH5_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A096MPU7_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K5PP81_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
H0WKI0_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K5UDI5_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
P10417_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
Q7TSN8_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A3Q2HRY3_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
E2QWA1_BCL2-02          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
A0A2K6G3I7_BCL2-01      ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
Q6R755_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
Q9JJV8_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
Q923R6_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
H0W1T3_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
G1LIC9_BCL2-02          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
I3MVK9_BCL2-01          ---------------IALWMTEYLNR-HLHTWIQD-NGGW----------
                                                                          

P70345_BCL2L2-02        ---------------------------AE---------------------
G1MZW1_BCL2-01          ---------------------------DA---------------------
A0A3Q1FR00_BCL2L1-      ------------------------------E-------------------
F6VJQ0_BCL2L10-01       ------------------------------T-------------------
A0A2K5DMS4_MCL1-01      ------------------------------D-------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          ------------------------------E-------------------
K7FPN7_MCL1-01          ------------------------------E-------------------
H3AR18_MCL1-01          ------------------------------K-------------------
J7H260_MCL1-01          ------------------------------D-------------------
G1PZ39_MCL1-01          ---------------------------GFKD-------------------
Q9Z1P3_MCL1-01          ------------------------------D-------------------
A5PJR2_MCL1-01          ------------------------------D-------------------
A0A452GA25_MCL1-01      ------------------------------D-------------------
G1L3L7_MCL1-01          ------------------------------D-------------------
G1T2Q0_MCL1-01          ------------------------------D-------------------
F7AVA6_MCL1-01          ------------------------------D-------------------
A0A337S3J9_MCL1-01      ------------------------------D-------------------
A0A337S3J9_MCL1-03      ------------------------------D-------------------
Q7YRZ9_MCL1-01          ------------------------------D-------------------
F1PAP1_MCL1-01          ------------------------------D-------------------
Q8HYS5_MCL1-01          ------------------------------D-------------------
M3XZZ5_MCL1-01          ------------------------------D-------------------
A0A452RHX5_MCL1-01      ------------------------------D-------------------
H0XFB7_MCL1-01          ------------------------------D-------------------
F7GTF7_MCL1-01          ------------------------------D-------------------
A0A2K5CFH3_MCL1-01      ------------------------------D-------------------
A0A2K6V5Y3_MCL1-01      ------------------------------D-------------------
A0A2K6KRW9_MCL1-01      ------------------------------D-------------------
A0A2K5XSB2_MCL1-01      ------------------------------D-------------------
A0A0D9RZP5_MCL1-01      ------------------------------D-------------------
I7G687_MCL1-01          ------------------------------D-------------------
A0A2K5LXU8_MCL1-01      ------------------------------D-------------------
A0A2I3GJZ3_MCL1-02      ------------------------------D-------------------
H2N5Y9_MCL1-01          ------------------------------D-------------------
A0A2R9BPJ5_MCL1-01      ------------------------------D-------------------
A0A2I3RTV4_MCL1-01      ------------------------------D-------------------
A0A2I2YQH7_MCL1-01      ------------------------------D-------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
Q95KR3_MCL1-01          ------------------------------D-------------------
A0A2K5EPX0_MCL1-02      ------------------------------D-------------------
A0A2K5EPX0_MCL1-01      ------------------------------D-------------------
G3WBC5_MCL1-01          ------------------------------E-------------------
W5QI41_MCL1-01          ------------------------------D-------------------
F1MQX4_MCL1-01          ------------------------------D-------------------
A0A287BK44_MCL1-03      ------------------------------D-------------------
B4DLY8_MCL1-01          ------------------------------D-------------------
B4DG83_MCL1-01          ------------------------------D-------------------
B4E3L8_MCL1-01          ------------------------------D-------------------
H3AR18_MCL1-02          ------------------------------K-------------------
E2RS00_BCL2A1-01        ------------------------------EN------------------
B6V6J0_MCL1-01          ------------------------------D-------------------
G3PJT0_MCL1-01          ------------------------------V-------------------
H0XHA5_MCL1-01          ------------------------------D-------------------
A0A2I2YPX6_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6TM77_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K5RUN8_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6GWM6_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
W5QDH4_BCL2L2-01        ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6ME72_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6RW35_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A287ATE4_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2R8M4C0_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A452UF16_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K5MZX9_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K5HEJ9_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K5V0Q3_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
F7G4L5_BCL2L2-02        ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6EA59_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6AI25_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A1U7RC37_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2I3GEA7_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2R9A2Q3_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
H2Q805_BCL2L2-02        ------------------------------ELEAIKARVREMEEEAEKLK
A0A096NX09_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A287ATE4_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A4D6NWN1_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A1U7UJF2_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A452UF16_BCL2L2-      ------------------------------ELEAIKARVREMEEEAEKLK
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          ------------------------------D-------------------
H9GEA6_MCL1-02          ------------------------------E-------------------
H9GEA6_MCL1-01          ------------------------------H-------------------
A0A493U0E8_MCL1-01      ------------------------------E-------------------
A0A1L1RNM6_MCL1-01      ------------------------------E-------------------
A0A1L1RNM6_MCL1-02      ------------------------------E-------------------
G2HFR3_MCL1-01          ------------------------------D-------------------
F6ZMX1_MCL1-01          ------------------------------K-------------------
F6ZMX1_MCL1-03          ------------------------------E-------------------
F6ZMX1_MCL1-02          ------------------------------S-------------------
G1T2Q0_MCL1-02          ------------------------------D-------------------
F1PAP1_MCL1-02          ------------------------------D-------------------
A0A337S3J9_MCL1-04      ------------------------------D-------------------
F7AVA6_MCL1-02          ------------------------------D-------------------
A0A2K6GI15_MCL1-03      ------------------------------D-------------------
C8YZ26_MCL1-01          ------------------------------D-------------------
F7GTF7_MCL1-02          ------------------------------D-------------------
A0A2K5R5E2_MCL1-04      ------------------------------D-------------------
A0A2K6V5Y3_MCL1-03      ------------------------------D-------------------
A0A2K5LXU8_MCL1-03      ------------------------------D-------------------
A0A2K5I9I0_MCL1-03      ------------------------------D-------------------
A0A2I2YQH7_MCL1-03      ------------------------------D-------------------
Q07820_MCL1-04          ------------------------------D-------------------
A0A2K5W0W9_MCL1-03      ------------------------------D-------------------
A0A2K6ECR0_MCL1-03      ------------------------------D-------------------
A0A2K5XSB2_MCL1-03      ------------------------------D-------------------
A0A2R9BPJ5_MCL1-03      ------------------------------D-------------------
A0A2I3RTV4_MCL1-03      ------------------------------D-------------------
A0A2I3LFM0_MCL1-03      ------------------------------D-------------------
A0A2K6PPI3_MCL1-03      ------------------------------D-------------------
A0A286Y1M5_MCL1-01      ------------------------------D-------------------
B4DU51_MCL1-01          ------------------------------D-------------------
A0A287DCH9_MCL1-02      ------------------------------D-------------------
P97287_MCL1-01          ------------------------------D-------------------
A0A452GA25_MCL1-02      ------------------------------D-------------------
A0A287DCH9_MCL1-01      ------------------------------D-------------------
G3T756_MCL1-01          ------------------------------D-------------------
A0A1S3F3I1_MCL1-01      ------------------------------D-------------------
G1L3L7_MCL1-02          ------------------------------D-------------------
A0A287BK44_MCL1-01      ------------------------------D-------------------
A0A287BK44_MCL1-02      ------------------------------D-------------------
A2BF68_MCL1-02          ---------------------------DG---------------------
G1QEX2_BCL2L10-01       ---------------------------DG---------------------
I3KXG5_MCL1-01          ---------------------------DG---------------------
H0ZCL9_BCL2A1-01        --------------------------ENG---------------------
U3JTB2_BCL2A1-01        --------------------------ENG---------------------
A0A218V8Z6_BCL2A1-      --------------------------ENG---------------------
Q9W6F2_BCL2A1-01        --------------------------ENG---------------------
A0A493SSZ7_BCL2A1-      --------------------------ENG---------------------
G1N8C5_BCL2A1-01        --------------------------ENG---------------------
A0A452J3N6_BCL2A1-      --------------------------ENG---------------------
K7G130_BCL2A1-01        --------------------------ENG---------------------
F7CP56_BCL2A1-02        KRISIFLSMQDEIETEEIIRDIFQQGKTC---------------------
F7CP56_BCL2A1-01        KRISIFLSMQDEIETEEIIRDIFQQGKTC---------------------
F6SFL4_BCL2A1-01        --------------------------ENG---------------------
G3WSP8_BCL2A1-01        --------------------------ENG---------------------
A0A2K5PYQ3_BCL2A1-      --------------------------GK----------------------
A0A2K5PYQ3_BCL2A1-      --------------------------ENG---------------------
F6S8G3_BCL2A1-01        --------------------------ENG---------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------EDG---------------------
Q925A9_BCL2A1-01        --------------------------EDG---------------------
Q07440_BCL2A1-01        --------------------------EDG---------------------
O55179_BCL2A1-01        --------------------------EDG---------------------
O55177_BCL2A1-02        --------------------------EDG---------------------
Q497M6_BCL2A1-01        --------------------------EDG---------------------
Q8K164_BCL2A1-01        --------------------------EDG---------------------
Q4FK02_BCL2A1-01        --------------------------EDG---------------------
A0A452SIR9_BCL2A1-      --------------------------EDG---------------------
M3YVH4_BCL2A1-01        --------------------------EDG---------------------
U6CQS8_BCL2A1-01        --------------------------EDG---------------------
I3MCZ7_BCL2A1-01        --------------------------ENG---------------------
G3T8E6_BCL2A1-01        --------------------------ENG---------------------
H0WZ23_BCL2A1-01        --------------------------EHG---------------------
A0A2I3HBP6_BCL2A1-      --------------------------ENG---------------------
A0A2K5D2I1_BCL2A1-      --------------------------AK----------------------
B4E1X9_BCL2A1-01        --------------------------VC----------------------
A0A2I2YML2_BCL2A1-      --------------------------GK----------------------
A0A2R8ZJX9_BCL2A1-      --------------------------GK----------------------
A0A2I3HBP6_BCL2A1-      --------------------------GK----------------------
A0A2K6PHF2_BCL2A1-      --------------------------GK----------------------
A0A2K6LV19_BCL2A1-      --------------------------GK----------------------
A0A2K5TMD1_BCL2A1-      --------------------------GK----------------------
A0A2K5KAA3_BCL2A1-      --------------------------GK----------------------
A0A2K6DS18_BCL2A1-      --------------------------GK----------------------
A0A096NMX5_BCL2A1-      --------------------------GK----------------------
A0A2K6AD27_BCL2A1-      --------------------------GK----------------------
A0A2K6TLJ5_BCL2A1-      --------------------------DL----------------------
F7HXW0_BCL2A1-01        --------------------------GK----------------------
A0A2K6TLJ5_BCL2A1-      --------------------------GK----------------------
A0A2K6EKG1_BCL2A1-      --------------------------EHG---------------------
A0A452EK63_BCL2A1-      --------------------------ENG---------------------
W5Q0N6_BCL2A1-01        --------------------------ENG---------------------
L8IZT5_BCL2A1-01        --------------------------ENG---------------------
Q3C2I0_BCL2A1-01        --------------------------ENG---------------------
F7CP56_BCL2A1-04        --------------------------ENG---------------------
C7F841_BCL2A1-01        --------------------------ENG---------------------
A0A2K5D2I1_BCL2A1-      --------------------------ENG---------------------
H2NNZ9_BCL2A1-01        --------------------------ENG---------------------
A0A2I2YML2_BCL2A1-      --------------------------ENG---------------------
A0A2K6LV19_BCL2A1-      --------------------------ENG---------------------
A0A2K6PHF2_BCL2A1-      --------------------------ENG---------------------
A0A2K5KHH8_BCL2A1-      --------------------------ENG---------------------
A0A2K5KHH8_BCL2A1-      --------------------------ENG---------------------
A0A2K5KAA3_BCL2A1-      --------------------------ENG---------------------
A0A2K5TMD1_BCL2A1-      --------------------------ENG---------------------
F7E8V5_BCL2A1-01        --------------------------ENG---------------------
A0A2K6DS18_BCL2A1-      --------------------------ENG---------------------
A0A2K6AD27_BCL2A1-      --------------------------ENG---------------------
A0A096NMX5_BCL2A1-      --------------------------ENG---------------------
A0A0D9RRC3_BCL2A1-      --------------------------ENG---------------------
Q16548_BCL2A1-01        --------------------------ENG---------------------
A0A2R8ZJX9_BCL2A1-      --------------------------ENG---------------------
W5MMB7_MCL1-01          ---------------------------DG---------------------
A0A3B3SG34_MCL1-01      ---------------------------DG---------------------
Q4SW32_MCL1-01          ---------------------------DG---------------------
D2ITA0_MCL1-03          ---------------------------EG---------------------
D2ITA0_MCL1-04          ---------------------------EG---------------------
A0A3P9ILF6_MCL1-01      ---------------------------DG---------------------
A0A3P9ILF6_MCL1-02      ---------------------------DG---------------------
Q0KFR9_MCL1-01          ---------------------------NG---------------------
A0A3P8Y1W8_MCL1-02      ---------------------------DG---------------------
A0A3P8Y1W8_MCL1-01      ---------------------------DG---------------------
A0A3Q2XZL8_MCL1-01      ---------------------------DG---------------------
A0A3B4AFB7_MCL1-02      ---------------------------DG---------------------
A0A3B3VM25_MCL1-01      ---------------------------EG---------------------
A0A3Q0R633_MCL1-01      ---------------------------DG---------------------
A0A3Q0R633_MCL1-03      ---------------------------DG---------------------
A0A3B4T8L9_MCL1-02      ---------------------------DG---------------------
A0A3B4T8L9_MCL1-01      ---------------------------DG---------------------
A0A3Q1EQB9_MCL1-02      ---------------------------DG---------------------
A0A3B4ZKP6_MCL1-01      ---------------------------DG---------------------
A0A3Q1BKL8_MCL1-02      ---------------------------DG---------------------
A0A3Q1EQB9_MCL1-01      ---------------------------DG---------------------
A0A3Q1BKL8_MCL1-01      ---------------------------DG---------------------
A0A3P8RQX7_MCL1-01      ---------------------------DG---------------------
A0A3P8RQX7_MCL1-02      ---------------------------DG---------------------
A0A3Q3VP02_MCL1-01      ---------------------------DG---------------------
A0A3B5K5B3_MCL1-01      ---------------------------EG---------------------
A0A3B3IJ04_MCL1-01      ---------------------------DG---------------------
A0A3P9L1F3_MCL1-01      ---------------------------DG---------------------
A0A3B3IJ04_MCL1-02      ---------------------------DG---------------------
A0A3P9L1F3_MCL1-02      ---------------------------DG---------------------
A0A3B3CEX1_MCL1-02      ---------------------------DG---------------------
A0A3B3CEX1_MCL1-01      ---------------------------DG---------------------
A0A3Q3B4P5_MCL1-01      ---------------------------SG---------------------
A0A3Q3B4P5_MCL1-02      ---------------------------SG---------------------
A0A3Q2EDX8_MCL1-01      ---------------------------NG---------------------
A0A3Q2P7X9_MCL1-01      ---------------------------DG---------------------
A0A3Q2P7X9_MCL1-02      ---------------------------DG---------------------
A0A3B5PQ55_MCL1-02      ---------------------------EG---------------------
A0A3B5PQ55_MCL1-01      ---------------------------EG---------------------
A0A3P9Q4I8_MCL1-02      ---------------------------EG---------------------
A0A3P9Q4I8_MCL1-01      ---------------------------EG---------------------
A0A087X830_MCL1-01      ---------------------------EG---------------------
A0A3B3YCD0_MCL1-01      ---------------------------EG---------------------
I3JHR5_MCL1-01          ---------------------------DG---------------------
A0A3Q4HLQ8_MCL1-01      ---------------------------DG---------------------
A0A3P8NP63_MCL1-02      ---------------------------DG---------------------
A0A3Q2VNL8_MCL1-01      ---------------------------DG---------------------
A0A3P8NP63_MCL1-01      ---------------------------DG---------------------
A0A3P9BVM3_MCL1-01      ---------------------------DG---------------------
A0A3B4G4Z6_MCL1-01      ---------------------------DG---------------------
A0A2U9CJ81_MCL1-01      ---------------------------EG---------------------
A0A3P8VKM5_MCL1-05      ---------------------------DG---------------------
A0A3P8VKM5_MCL1-04      ---------------------------DG---------------------
A0A3P8VKM5_MCL1-03      ---------------------------DG---------------------
A0A3Q3IZW0_MCL1-01      ---------------------------DG---------------------
A0A3Q1GX28_MCL1-02      ---------------------------DG---------------------
A0A3Q1GX28_MCL1-01      ---------------------------DG---------------------
A0A3B4XKA5_MCL1-01      ---------------------------DG---------------------
A0A3Q3GP42_MCL1-01      ---------------------------DG---------------------
A0A3Q3M6G2_MCL1-01      ---------------------------DG---------------------
A0A3Q3M6G2_MCL1-02      ---------------------------DG---------------------
A0A3B1IEV7_MCL1-01      ---------------------------DG---------------------
A0A3B4CGU9_MCL1-03      ---------------------------GG---------------------
A0A3B4CGU9_MCL1-02      ---------------------------GG---------------------
Q8UWD6_MCL1-01          ---------------------------DG---------------------
A2BF68_MCL1-01          ---------------------------DG---------------------
Q568W5_MCL1-01          ---------------------------DG---------------------
A0A3B1K5R1_MCL1-01      ---------------------------DG---------------------
A0A3B4C6H5_MCL1-01      ---------------------------DG---------------------
A0A3B4C6H5_MCL1-03      ---------------------------DG---------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
R4JQR8_BCL2L1-01        ---------------------------QG---------------------
A0A346RRN1_BCL2L1-      ---------------------------QG---------------------
A0A3Q4MN81_BCL2L10      ---------------------------EG---------------------
A0A3B4ETX9_BCL2L10      ---------------------------EG---------------------
D2IT42_BCL2L10-02       ---------------------------EG---------------------
A0A3Q0S9R1_BCL2L10      ---------------------------EG---------------------
I3J363_BCL2L10-01       ---------------------------EG---------------------
A0A3Q2UUN9_BCL2L10      ---------------------------EG---------------------
A0A3P8PVZ8_BCL2L10      ---------------------------EG---------------------
A0A3Q2UUN9_BCL2L10      ---------------------------EG---------------------
A0A3P9BLI0_BCL2L10      ---------------------------EG---------------------
A0A3Q2PJS5_BCL2L10      ---------------------------DG---------------------
A0A3Q2GL87_BCL2L10      ---------------------------DG---------------------
A0A3B5MJ12_BCL2L10      ---------------------------EG---------------------
M4AUW7_BCL2L10-01       ---------------------------EG---------------------
A0A096ME02_BCL2L10      ---------------------------DG---------------------
A0A3B3TYN4_BCL2L10      ---------------------------DG---------------------
A0A3B3YT99_BCL2L10      ---------------------------DG---------------------
A0A3P9NE65_BCL2L10      ---------------------------DG---------------------
A0A3P9IIZ2_BCL2L10      ---------------------------EG---------------------
A0A3P9LM07_BCL2L10      ---------------------------EG---------------------
H2MBQ3_BCL2L10-01       ---------------------------EG---------------------
A0A3B4AAV4_BCL2L10      ---------------------------VG---------------------
A0A3Q3EZT5_BCL2L10      ---------------------------EG---------------------
A0A3Q3EZT5_BCL2L10      ---------------------------EG---------------------
A0A3Q3JQ78_BCL2L10      ---------------------------EG---------------------
A0A3B4TIY6_BCL2L10      ---------------------------EG---------------------
A0A3B4WGF4_BCL2L10      ---------------------------EG---------------------
A0A3Q3KZW1_BCL2L10      ---------------------------EG---------------------
A0A3B5KD08_BCL2L10      ---------------------------EG---------------------
A0A3Q3VI28_BCL2L10      ---------------------------EG---------------------
A0A3Q1GM98_BCL2L10      ---------------------------EG---------------------
A0A3Q1D2L0_BCL2L10      ---------------------------EG---------------------
A0A3P8RL82_BCL2L10      ---------------------------EG---------------------
A0A3B4ZFS0_BCL2L10      ---------------------------EG---------------------
A0A3B3C5I4_BCL2L10      ---------------------------EG---------------------
A0A3Q1IAB0_BCL2L10      ---------------------------EG---------------------
A0A3P8W7K5_BCL2L10      ---------------------------EG---------------------
H3AAS7_BCL2L2-02        ---------------------------SA---------------------
H3AAS7_BCL2L2-01        ---------------------------SA---------------------
G1Q051_BCL2L2-01        ---------------------------AE---------------------
G3WPT1_BCL2L2-01        ---------------------------AE---------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      ---------------------------RS---------------------
W5QDH4_BCL2L2-02        ---------------------------AE---------------------
Q7TS60_BCL2L2-01        ---------------------------AE---------------------
G1LMC3_BCL2L2-01        ---------------------------AE---------------------
M3Y5X5_BCL2L2-01        ---------------------------AE---------------------
G1P3J2_BCL2L2-01        ---------------------------AE---------------------
G3WPT1_BCL2L2-02        ---------------------------AE---------------------
G1TV33_BCL2L2-01        ---------------------------AE---------------------
P70345_BCL2L2-01        ---------------------------AE---------------------
O88996_BCL2L2-01        ---------------------------AE---------------------
A0A3Q9B4M8_BCL2L2-      ---------------------------AE---------------------
H0XR82_BCL2L2-01        ---------------------------AE---------------------
A0A250YBR2_BCL2L2-      ---------------------------AE---------------------
A0A250YBR2_BCL2L2-      ---------------------------AE---------------------
L8HP19_BCL2L2-02        ---------------------------AE---------------------
L8HP19_BCL2L2-01        ---------------------------AE---------------------
Q1RMX3_BCL2L2-01        ---------------------------AE---------------------
A0A452ECF0_BCL2L2-      ---------------------------AE---------------------
A0A286XQQ9_BCL2L2-      ---------------------------AE---------------------
A0A2K5RUN8_BCL2L2-      ---------------------------AE---------------------
A0A2K5MZX9_BCL2L2-      ---------------------------AE---------------------
A0A0D9RU30_BCL2L2-      ---------------------------AE---------------------
A0A2K5HEJ9_BCL2L2-      ---------------------------AE---------------------
A0A1S3FYD8_BCL2L2-      ---------------------------AE---------------------
A0A2I2UAE3_BCL2L2-      ---------------------------AE---------------------
A0A2I2YPX6_BCL2L2-      ---------------------------AE---------------------
A0A287D9B3_BCL2L2-      ---------------------------AE---------------------
A0A2K5V0Q3_BCL2L2-      ---------------------------AE---------------------
F7G4L5_BCL2L2-01        ---------------------------AE---------------------
A0A2K6EA59_BCL2L2-      ---------------------------AE---------------------
A0A2K6AI25_BCL2L2-      ---------------------------AE---------------------
A0A1U7RC37_BCL2L2-      ---------------------------AE---------------------
A0A2I3GEA7_BCL2L2-      ---------------------------AE---------------------
A0A2R9A2Q3_BCL2L2-      ---------------------------AE---------------------
H2Q805_BCL2L2-01        ---------------------------AE---------------------
A0A096NX09_BCL2L2-      ---------------------------AE---------------------
A0A2K6GWM6_BCL2L2-      ---------------------------AE---------------------
A0A2K6ME72_BCL2L2-      ---------------------------AE---------------------
A0A2K6RW35_BCL2L2-      ---------------------------AE---------------------
A0A2K6RW35_BCL2L2-      ---------------------------AE---------------------
A0A2K6TM77_BCL2L2-      ---------------------------AE---------------------
A0A287ATE4_BCL2L2-      ---------------------------AE---------------------
A0A1U7UJF2_BCL2L2-      ---------------------------AE---------------------
A0A452SHI1_BCL2L2-      ---------------------------AE---------------------
Q05KI8_BCL2L2-01        ---------------------------AE---------------------
Q568V1_MCL1-01          ---------------------------HG---------------------
Q1L8X3_MCL1-01          ---------------------------HG---------------------
Q9I9N3_MCL1-01          ---------------------------HG---------------------
A0A286XUI2_BCL2A1-      ---------------------------D----------------------
A0A452U285_BCL2A1-      ---------------------------E----------------------
A0A452U285_BCL2A1-      ---------------------------SL---------------------
A0A3B3R4U0_MCL1-01      ---------------------------EG---------------------
F7CP56_BCL2A1-03        ---------------------------TLAL-------------------
Q2TAP5_BCL2L1-01        ---------------------------EA---------------------
Q91828_BCL2L1-01        ---------------------------EA---------------------
I7GKS6_BCL2L1-01        ---------------------------DT---------------------
A0A2K5EBP4_BCL2L1-      ---------------------------DT---------------------
A0A2K5Q6R6_BCL2L1-      ---------------------------DT---------------------
A0A2K6UWY8_BCL2L1-      ---------------------------DT---------------------
A0A3P8V8T6_MCL1-01      ---------------------------DG---------------------
A0A3P8YNB4_BCL2-01      ---------------------------EA---------------------
A0A3P8WUE9_BCL2-01      ---------------------------DA---------------------
A0A3B4A3G8_BCL2-01      ---------------------------EA---------------------
A0A3Q3G1D7_BCL2-01      ---------------------------DA---------------------
A0A3Q2XQX2_BCL2-02      ---------------------------DA---------------------
A0A3Q2XQX2_BCL2-01      ---------------------------DA---------------------
A0A3Q3B0R2_BCL2-01      ---------------------------DA---------------------
A0A3Q2PN77_BCL2-01      ---------------------------DA---------------------
A0A3P9J8Y9_BCL2-01      ---------------------------DA---------------------
A0A3Q0S5Z7_BCL2-01      ---------------------------DA---------------------
A0A3P8QVM8_BCL2-01      ---------------------------DA---------------------
A0A3P9DIG5_BCL2-01      ---------------------------DA---------------------
A0A3Q2UYW8_BCL2-01      ---------------------------DA---------------------
A0A3B4G3K4_BCL2-01      ---------------------------DA---------------------
A0A2U9BJ09_BCL2-01      ---------------------------DA---------------------
A0A3Q1I5N1_BCL2-01      ---------------------------DA---------------------
A0A3Q3K1K1_BCL2-01      ---------------------------DA---------------------
A0A3Q3MEY1_BCL2-01      ---------------------------DA---------------------
A0A1X9JZA1_BCL2-01      ---------------------------DA---------------------
A0A4D6FTA2_BCL2-01      ---------------------------DA---------------------
A0A3Q1FLK7_BCL2-01      ---------------------------DA---------------------
A0A3Q1B8C3_BCL2-01      ---------------------------DA---------------------
A0A3P8S9L3_BCL2-01      ---------------------------DA---------------------
A0A3B5BBQ0_BCL2-01      ---------------------------DA---------------------
A0A3B4TX71_BCL2-01      ---------------------------DA---------------------
A0A3B4YAG2_BCL2-01      ---------------------------DA---------------------
Q5XGJ4_BCL2L2-01        ---------------------------NG---------------------
F7G6M3_BCL2L2-01        ---------------------------AE---------------------
A0A2K5CWY6_BCL2L2-      ---------------------------AE---------------------
A0A2K5CWY6_BCL2L2-      ---------------------------AE---------------------
G3TMU7_BCL2L2-01        ---------------------------AE---------------------
G1TW27_BCL2-02          ---------------------------ADKS-------------------
E2RS00_BCL2A1-02        ---------------------------EN---------------------
A0A2K5M8B1_BCL2L1-      ---------------------------DT---------------------
A0A2K5H963_BCL2L1-      ---------------------------DT---------------------
A0A2K5VPG2_BCL2L1-      ---------------------------DT---------------------
A0A2K5YR37_BCL2L1-      ---------------------------DT---------------------
A0A2R8Z9D7_BCL2L1-      ---------------------------DT---------------------
A0A096NV05_BCL2L1-      ---------------------------DT---------------------
A0A2K6QFA2_BCL2L1-      ---------------------------DT---------------------
A0A1U7T4L4_BCL2L1-      ---------------------------DT---------------------
A0A2K6G3C5_BCL2L1-      ---------------------------DT---------------------
A0A3Q1LRT3_BCL2L1-      ---------------------------DT---------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        ---------------LRLHTSTTQLPSTI---------------------
A0A493TIA6_BCL2L1-      ---------------------------VRGC-------------------
Q07816_BCL2L1-03        ---------------------------ER---------------------
Q07816_BCL2L1-02        ---------------------------ER---------------------
Q07816_BCL2L1-01        ---------------------------ER---------------------
G1N5N5_BCL2L1-01        ---------------------------ER---------------------
A0A452ILL8_BCL2L1-      ---------------------------ER---------------------
A0A452ILL8_BCL2L1-      ---------------------------ER---------------------
K7F655_BCL2L1-01        ---------------------------ER---------------------
A0A452E1B1_BCL2L1-      ---------------------------DI---------------------
W5PSA5_BCL2L1-01        ---------------------------DI---------------------
P53563_BCL2L1-02        ---------------------------VR---------------------
P53563_BCL2L1-03        ---------------------------VR---------------------
A0A287CZ07_BCL2L1-      ---------------------------DT---------------------
A0A3Q2H0F6_BCL2L1-      ---------------KETALGTFCYFVSS---------------------
F6WA14_BCL2L1-01        ---------------------------DT---------------------
G3WKX6_BCL2L1-01        ---------------------------DT---------------------
M3XA94_BCL2L1-01        ------------------------VVIEH---------------------
M3XA94_BCL2L1-02        ---------------------------DT---------------------
H0X6V2_BCL2L1-01        ------------------------WRCQA---------------------
G3SPN0_BCL2L1-01        ---------------------------VR---------------------
Q2PFS6_BCL2L1-01        ---------------------------DT---------------------
O35843_BCL2L1-01        ---------------------------GV---------------------
M3XA94_BCL2L1-03        ---------------------------VW---------------------
G1RER8_BCL2L1-01        ---------------------------DT---------------------
A0A1S2ZQT6_BCL2L1-      ---------------------------DT---------------------
Q64373_BCL2L1-09        ---------------------------DT---------------------
Q64373_BCL2L1-01        ---------------------------DT---------------------
P53563_BCL2L1-01        ---------------------------DT---------------------
O77737_BCL2L1-01        ---------------------------DT---------------------
Q9MYW4_BCL2L1-01        ---------------------------DT---------------------
A0A3Q2H0F6_BCL2L1-      ---------------------------DT---------------------
L8J061_BCL2L1-01        ---------------------------DT---------------------
Q05KJ0_BCL2L1-02        ---------------------------DT---------------------
Q05KJ0_BCL2L1-01        ---------------------------DT---------------------
E2IV76_BCL2L1-01        ---------------------------DT---------------------
A0A2K6G3C5_BCL2L1-      ---------------------------DT---------------------
B2Z3Z4_BCL2L1-01        ---------------------------DT---------------------
G3HEA7_BCL2L1-02        ---------------------------DT---------------------
G3HEA7_BCL2L1-01        ---------------------------DT---------------------
A0A1U7T4L4_BCL2L1-      ---------------------------DT---------------------
M3Z2H9_BCL2L1-01        ---------------------------DT---------------------
A0A1U7QU73_BCL2L1-      ---------------------------DT---------------------
A0A0D9RJZ8_BCL2L1-      ---------------------------DT---------------------
A0A286Y5D6_BCL2L1-      ---------------------------DT---------------------
A0A250YD48_BCL2L1-      ---------------------------DT---------------------
A0A1L5BWY3_BCL2L1-      ---------------------------DT---------------------
I3MUP5_BCL2L1-01        ---------------------------DT---------------------
I3MUP5_BCL2L1-02        ---------------------------DT---------------------
I3MUP5_BCL2L1-03        ---------------------------DT---------------------
G1P9D2_BCL2L1-01        ---------------------------DT---------------------
A0A2K5EBP4_BCL2L1-      ---------------------------DT---------------------
E2IV75_BCL2L1-01        ---------------------------DT---------------------
F7IT34_BCL2L1-01        ---------------------------DT---------------------
Q76LT7_BCL2L1-01        ---------------------------DT---------------------
A0A2K5Q6R6_BCL2L1-      ---------------------------DT---------------------
A0A2K5Q6R6_BCL2L1-      ---------------------------DT---------------------
A0A2K5M8B1_BCL2L1-      ---------------------------DT---------------------
A0A2K5H963_BCL2L1-      ---------------------------DT---------------------
Q8SQ42_BCL2L1-01        ---------------------------DT---------------------
A0A2K5VPG2_BCL2L1-      ---------------------------DT---------------------
A0A2K5YR37_BCL2L1-      ---------------------------DT---------------------
A0A2R8Z9D7_BCL2L1-      ---------------------------DT---------------------
A0A096NV05_BCL2L1-      ---------------------------DT---------------------
A0A2J8VIH3_BCL2L1-      ---------------------------DT---------------------
A0A2K6QFA2_BCL2L1-      ---------------------------DT---------------------
A0A2K6QFA2_BCL2L1-      ---------------------------DT---------------------
A0A2K6UWY8_BCL2L1-      ---------------------------DT---------------------
E2IV77_BCL2L1-01        ---------------------------DT---------------------
A0A452SDS4_BCL2L1-      ---------------------------DT---------------------
A0A384D3U1_BCL2L1-      ---------------------------DT---------------------
A0A452FWV3_BCL2L1-      ---------------------------DT---------------------
Q9MZS7_BCL2L1-01        ---------------------------DT---------------------
A0A3B3TCS4_BCL2-01      ---------------------------DA---------------------
A0A0U3DHY6_BCL2-01      ---------------------------DA---------------------
A0A3P9AAB2_BCL2-01      ---------------------------DA---------------------
F6YNL8_BCL2-01          ---------------------------VG---------------------
A0A218UQA0_BCL2-01      ---------------------------DA---------------------
Q00709_BCL2-01          ---------------------------DA---------------------
A0A493T1X3_BCL2-01      ---------------------------DA---------------------
U3KEW4_BCL2-01          ---------------------------DA---------------------
G3WZW9_BCL2-01          ---------------------------GT---------------------
A0A452R110_BCL2-02      ---------------------------AH---------------------
E2QWA1_BCL2-01          ---------------------------DA---------------------
G1LIC9_BCL2-01          ---------------------------DA---------------------
A0A452R110_BCL2-01      ---------------------------DA---------------------
M3YYK3_BCL2-01          ---------------------------PA---------------------
A0A2K6R2I5_BCL2-02      ---------------------------RT---------------------
A0A2R9APW6_BCL2-01      ---------------------------DA---------------------
M3X1R9_BCL2-02          ---------------------------LI---------------------
G3SLZ1_BCL2-01          ---------------------------DA---------------------
Q75SV7_BCL2-01          ---------------------------DA---------------------
M3X1R9_BCL2-01          ---------------------------DA---------------------
Q8I008_BCL2-01          ---------------------------DA---------------------
A0A076FU27_BCL2-01      ---------------------------DA---------------------
A0A4P8GLJ2_BCL2-01      ---------------------------DA---------------------
F6R2C4_BCL2-01          ---------------------------DA---------------------
O02718_BCL2-01          ---------------------------DA---------------------
A0A076FZV9_BCL2-01      ---------------------------DA---------------------
A0A452EV13_BCL2-01      ---------------------------DA---------------------
A0A250YD83_BCL2-01      ---------------------------DA---------------------
A9QXG9_BCL2-01          ---------------------------DA---------------------
A0A2K5NZS5_BCL2-01      ---------------------------DA---------------------
A0A0D9S017_BCL2-01      ---------------------------DA---------------------
A0A2K6CIX3_BCL2-01      ---------------------------DA---------------------
A0A2K5XRD4_BCL2-01      ---------------------------DA---------------------
A0A2K6KHG1_BCL2-01      ---------------------------DA---------------------
A0A2K6R2I5_BCL2-01      ---------------------------DA---------------------
A0A2K5HK49_BCL2-01      ---------------------------DA---------------------
G3QES9_BCL2-01          ---------------------------DA---------------------
H2QEM8_BCL2-01          ---------------------------DA---------------------
A0A2I3GZF9_BCL2-01      ---------------------------DA---------------------
A0A2K6UEL3_BCL2-01      ---------------------------DA---------------------
G3WZW9_BCL2-02          ---------------------------VG---------------------
G3SLZ1_BCL2-02          ---------------------------VG---------------------
A0A452T603_BCL2-01      ---------------------------VG---------------------
H3ANS8_BCL2L1-01        ---------------------------AT---------------------
A0A452FHY1_BCL2L1-      ---------------------------DT---------------------
A0A452FHY1_BCL2L1-      ---------------------------DT---------------------
A0A1S3EPX7_BCL2L1-      ---------------------------DT---------------------
A0A218USB3_BCL2L1-      ---------------------------ER---------------------
H0Z8G3_BCL2L1-01        ---------------------------ER---------------------
A0A218USB3_BCL2L1-      ---------------------------ER---------------------
U3JSL7_BCL2L1-01        ---------------------------ER---------------------
A0A218USB3_BCL2L1-      ---------------------------ER---------------------
A0A218USB3_BCL2L1-      ---------------------------ER---------------------
Q4U2V6_BCL2L1-01        ---------------------------ER---------------------
X4ZGI8_BCL2-01          ---------------------------DA---------------------
A0A3B3E2W4_BCL2L1-      ---------------------------DC---------------------
A0A3B3I2Q5_BCL2L1-      ---------------------------DC---------------------
A0A3P9I2N4_BCL2L1-      ---------------------------DC---------------------
A0A3P9MKK4_BCL2L1-      ---------------------------DC---------------------
A0A3B5B4X7_BCL2L1-      ---------------------------EC---------------------
A0A3B4BFZ8_BCL2L1-      ---------------------------AS---------------------
A0A3Q3FUB6_BCL2L1-      ---------------------------DC---------------------
A0A3B5MGS2_BCL2L1-      ---------------------------DR---------------------
M4A558_BCL2L1-01        ---------------------------DR---------------------
A0A3P9QFB3_BCL2L1-      ---------------------------DH---------------------
A0A087YBW4_BCL2L1-      ---------------------------DR---------------------
A0A3B3VWI7_BCL2L1-      ---------------------------DR---------------------
A0A3B3XN57_BCL2L1-      ---------------------------DR---------------------
A0A3Q2C6K4_BCL2L1-      ---------------------------DC---------------------
A0A3Q2NRP4_BCL2L1-      ---------------------------EC---------------------
A0A0B4KJI5_BCL2L1-      ---------------------------DS---------------------
A0A3Q1JZ46_BCL2L1-      ---------------------------DC---------------------
A0A3Q1JZ46_BCL2L1-      ---------------------------DC---------------------
A0A3Q3NFM4_BCL2L1-      ---------------------------DC---------------------
A0A3Q3NFM4_BCL2L1-      ---------------------------DC---------------------
A0A3B4V9K8_BCL2L1-      ---------------------------DC---------------------
A0A3B4XS24_BCL2L1-      ---------------------------DC---------------------
C1BLI0_BCL2L1-01        ---------------------------DR---------------------
C0HAD8_BCL2L1-01        ---------------------------DR---------------------
A0A3B3ZMX9_BCL2L1-      ---------------------------AR---------------------
A0A3B5K6B9_BCL2L1-      ---------------------------VR---------------------
A0A3B5K6B9_BCL2L1-      ---------------------------VR---------------------
H3CH49_BCL2L1-01        ---------------------------ER---------------------
A0A3B3TFR4_BCL2L1-      ---------------------------DR---------------------
A0A3P8XYL5_BCL2L1-      ---------------------------DR---------------------
Q90Z98_BCL2L1-02        ---------------------------ER---------------------
Q90Z98_BCL2L1-01        ---------------------------ER---------------------
A0A059PJI5_BCL2L1-      ---------------------------ER---------------------
A0A3B4DTL9_BCL2L1-      ---------------------------ER---------------------
A0A3Q2FR43_BCL2L1-      ---------------------------ER---------------------
B5XAY3_BCL2L1-01        ---------------------------DR---------------------
W5MG74_BCL2L1-01        ---------------------------DR---------------------
A0A2U9BY16_BCL2L1-      ---------------------------TF---------------------
A0A3Q3B3X5_BCL2L1-      ---------------------------ER---------------------
A0A3B3IB64_BCL2L1-      ---------------------------ER---------------------
A0A3P9JYH1_BCL2L1-      ---------------------------ER---------------------
A0A3B3DHA1_BCL2L1-      ---------------------------ER---------------------
A0A3Q0RTF8_BCL2L1-      ---------------------------ER---------------------
I3IZK7_BCL2L1-01        ---------------------------ER---------------------
A0A2U9BY16_BCL2L1-      ---------------------------EH---------------------
A0A2U9BY16_BCL2L1-      ---------------------------EH---------------------
A0A2U9BY16_BCL2L1-      ---------------------------EH---------------------
A0A0D6DR75_BCL2L1-      ---------------------------EH---------------------
A0A3Q3WIW8_BCL2L1-      ---------------------------QR---------------------
A0A219P0Y3_BCL2L1-      ---------------------------ER---------------------
A0A3Q3MX20_BCL2L1-      ---------------------------EH---------------------
A0A3Q3G2E1_BCL2L1-      ---------------------------ER---------------------
A0A3Q3G2E1_BCL2L1-      ---------------------------ER---------------------
A0A3Q3G2E1_BCL2L1-      ---------------------------ER---------------------
A0A3Q1GZ93_BCL2L1-      ---------------------------ER---------------------
A0A3Q1GZ93_BCL2L1-      ---------------------------ER---------------------
A0A3Q1GZ93_BCL2L1-      ---------------------------ER---------------------
A0A3B4V3T1_BCL2L1-      ---------------------------ER---------------------
A0A3B4XU17_BCL2L1-      ---------------------------ER---------------------
A0A3P9MKK4_BCL2L1-      ---------------------------DC---------------------
A0A3B3I2Q5_BCL2L1-      ---------------------------DC---------------------
A0A3P9I2N4_BCL2L1-      ---------------------------DC---------------------
A0A3B4AFB7_MCL1-01      ---------------------------DG---------------------
B9ZYL7_BCL2-01          ---------------------------DA---------------------
M3Y8D1_BCL2L10-01       ---------------------------DG---------------------
A0A3Q2Y539_MCL1-01      ---------------------------DG---------------------
A0A3Q3BEB7_BCL2L1-      ---------------------------DS---------------------
A0A3P8VMA1_BCL2L1-      ---------------------------DR---------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      ---------------------------DR---------------------
A0A3P8XFS0_BCL2L1-      ---------------------------DR---------------------
A0A0F7L1T6_BCL2L1-      ---------------------------DC---------------------
H2U5I3_BCL2L1-01        ---------------------------DC---------------------
H2U5I3_BCL2L1-02        ---------------------------DC---------------------
A0A3Q3J5K3_BCL2L1-      ---------------------------DC---------------------
A0A3Q1EVP6_BCL2L1-      ---------------------------EC---------------------
A0A3Q1BQA0_BCL2L1-      ---------------------------EC---------------------
A0A3P8U812_BCL2L1-      ---------------------------EC---------------------
E6ZFR0_BCL2L1-01        ---------------------------DC---------------------
G3P7B4_BCL2L1-01        ---------------------------DC---------------------
A0A3Q3X5M5_BCL2L1-      ---------------------------GC---------------------
A0A2U9BIG9_BCL2L1-      ---------------------------GC---------------------
D2ITA2_BCL2L1-02        ---------------------------KH---------------------
A0A3B3ZMX9_BCL2L1-      ---------------------------AR---------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      ---------------------------EH---------------------
A0A3Q3DUT7_BCL2L1-      ---------------------------QR---------------------
A0A3Q3DUT7_BCL2L1-      ---------------------------QR---------------------
A0A3Q3DUT7_BCL2L1-      ---------------------------QR---------------------
A0A3B1JJ42_BCL2L1-      ---------------------------ER---------------------
A0A3P8UWG7_BCL2L1-      ---------------------------EH---------------------
A0A3Q3IVF5_BCL2L1-      ---------------------------ER---------------------
A0A3Q1DHJ3_BCL2L1-      ---------------------------ER---------------------
A0A3Q1DHJ3_BCL2L1-      ---------------------------ER---------------------
A0A3Q1DHJ3_BCL2L1-      ---------------------------ER---------------------
A0A3P8TL99_BCL2L1-      ---------------------------ER---------------------
A0A3P8TL99_BCL2L1-      ---------------------------ER---------------------
A0A3Q1FR00_BCL2L1-      ---------------------------ER---------------------
A0A3B4Z3X2_BCL2L1-      ---------------------------DR---------------------
A0A3B4Z3X2_BCL2L1-      ---------------------------DR---------------------
C3VIT1_BCL2L1-01        ---------------------------ER---------------------
A0A3P8P0F1_BCL2L1-      ---------------------------ER---------------------
A0A3Q2X557_BCL2L1-      ---------------------------ER---------------------
A0A3P9D632_BCL2L1-      ---------------------------ER---------------------
A0A3P9D632_BCL2L1-      ---------------------------ER---------------------
A0A3Q4N4B5_BCL2L1-      ---------------------------EH---------------------
A0A3B4FNX1_BCL2L1-      ---------------------------ER---------------------
A0A3Q2QPL9_BCL2L1-      ---------------------------ER---------------------
A0A3B5PQJ0_BCL2L1-      ---------------------------ER---------------------
A0A087X9B7_BCL2L1-      ---------------------------DR---------------------
A0A3B3TUS7_BCL2L1-      ---------------------------DR---------------------
A0A3B3WI27_BCL2L1-      ---------------------------DR---------------------
A0A3P9N9Y4_BCL2L1-      ---------------------------ER---------------------
A0A3B3QRZ2_BCL2L1-      ---------------------------DR---------------------
Q564A4_BCL2-01          ---------------------------DA---------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          ---------------------------DA---------------------
K7F5Y3_BCL2-02          ---------------------------AG---------------------
A0A3Q2HRY3_BCL2-02      ---------------------------QL---------------------
H0YUX3_BCL2-01          ---------------------------DA---------------------
K7F5Y3_BCL2-01          ---------------------------DA---------------------
F1LNV0_BCL2-01          ---------------------------DA---------------------
P49950_BCL2-01          ---------------------------DA---------------------
G1TW27_BCL2-01          ---------------------------DA---------------------
A0A2K5EB04_BCL2-01      ---------------------------DA---------------------
A0A2R8MY14_BCL2-01      ---------------------------DA---------------------
H2NWH5_BCL2-01          ---------------------------DA---------------------
A0A096MPU7_BCL2-01      ---------------------------DA---------------------
A0A2K5PP81_BCL2-01      ---------------------------DA---------------------
H0WKI0_BCL2-01          ---------------------------DA---------------------
A0A2K5UDI5_BCL2-01      ---------------------------DA---------------------
P10417_BCL2-01          ---------------------------DA---------------------
Q7TSN8_BCL2-01          ---------------------------DA---------------------
A0A3Q2HRY3_BCL2-01      ---------------------------DA---------------------
E2QWA1_BCL2-02          ---------------------------DA---------------------
A0A2K6G3I7_BCL2-01      ---------------------------DA---------------------
Q6R755_BCL2-01          ---------------------------DA---------------------
Q9JJV8_BCL2-01          ---------------------------DA---------------------
Q923R6_BCL2-01          ---------------------------DA---------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
F1PAP1_MCL1-01          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K5XSB2_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
A0A2R9BPJ5_MCL1-01      --------------------------------------------------
A0A2I3RTV4_MCL1-01      --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-03      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6TM77_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5RUN8_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6GWM6_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
W5QDH4_BCL2L2-01        ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6ME72_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6RW35_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A287ATE4_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2R8M4C0_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A452UF16_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5MZX9_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5HEJ9_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5V0Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
F7G4L5_BCL2L2-02        ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6EA59_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6AI25_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A1U7RC37_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGATAEE
A0A2I3GEA7_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2R9A2Q3_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
H2Q805_BCL2L2-02        ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A096NX09_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A287ATE4_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A4D6NWN1_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A1U7UJF2_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A452UF16_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          --------------------------------------------------
H9GEA6_MCL1-01          --------------------------------------------------
A0A493U0E8_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-03          --------------------------------------------------
F6ZMX1_MCL1-02          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
A0A1S3F3I1_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-02          --------------------------------------------------
A0A287BK44_MCL1-01      --------------------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3B5K5B3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      ---------------