Dataset for protein BCL-2-like of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

726 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-01          --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
F7AVA6_MCL1-01          --------------------------------------------------
A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      --------------------------------------------------
Q7YRZ9_MCL1-01          --------------------------------------------------
F1PAP1_MCL1-01          --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
M3XZZ5_MCL1-01          --------------------------------------------------
A0A452RHX5_MCL1-01      --------------------------------------------------
H0XFB7_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
A0A2K5CFH3_MCL1-01      --------------------------------------------------
A0A2K6V5Y3_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K5XSB2_MCL1-01      --------------------------------------------------
A0A0D9RZP5_MCL1-01      --------------------------------------------------
I7G687_MCL1-01          --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-02      --------------------------------------------------
H2N5Y9_MCL1-01          --------------------------------------------------
A0A2R9BPJ5_MCL1-01      --------------------------------------------------
A0A2I3RTV4_MCL1-01      --------------------------------------------------
A0A2I2YQH7_MCL1-01      --------------------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        --------------------------------------------------
B6V6J0_MCL1-01          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-01          --------------------------------------------------
H9GEA6_MCL1-02          --------------------------------------------------
A0A493U0E8_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-02      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-02          --------------------------------------------------
F6ZMX1_MCL1-03          --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          --------------------------------------------------
A0A452GA25_MCL1-02      --------------------------------------------------
G3T756_MCL1-01          --------------------------------------------------
A0A1S3F3I1_MCL1-01      --------------------------------------------------
G1L3L7_MCL1-02          --------------------------------------------------
A0A287BK44_MCL1-02      --------------------------------------------------
A0A287BK44_MCL1-01      --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      --------------------------------------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-02          --------------------------------------------------
I3JHR5_MCL1-03          --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P8PVZ8_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P9BLI0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------MFQLSWGLFLLEAESADK
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        ------------------------------MPSARNSPLPRQSAAPQPCC
A0A2K5CWY6_BCL2L2-      ------------------------------MPLLVLCPYIHASLSSLPL-
A0A2K5CWY6_BCL2L2-      ------------------------------------------HLSSLPL-
G3TMU7_BCL2L2-01        --------------------------------------YIHVSLSSLTL-
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
F7CP56_BCL2A1-03        -----------------------------------------------MTD
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
G3TVG9_MCL1-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------MTDCEFGYIHMLAQDYLK
H0ZCL9_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
U3JTB2_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
A0A218V8Z6_BCL2A1-      --------------------------------METAEFYYVYYLAQDYLQ
Q9W6F2_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
A0A493SSZ7_BCL2A1-      --------------------------------METAEFYYVYYLAQDYLQ
G1N8C5_BCL2A1-01        --------------------------------METAEFYYVYYLAQDYLQ
A0A452J3N6_BCL2A1-      --------------------------------MESSEYCYVYYLVQDYLK
K7G130_BCL2A1-01        --------------------------------MESSEFRYVYYLVQDYLK
A0A2K5PYQ3_BCL2A1-      --------------------------------MTDSEFGYIHNLTQDYLW
A0A2K5PYQ3_BCL2A1-      --------------------------------MTDSEFGYIHNLTQDYLW
F6SFL4_BCL2A1-01        --------------------------------MDDYEFHYVHMLARDYLK
G3WSP8_BCL2A1-01        --------------------------------MADCEFHYVHMLAQDYLK
F6S8G3_BCL2A1-01        --------------------------------MDDGVFWSVRALALDYLD
O55178_BCL2A1-01        --------------------------------MAEYELMHIHSLAEHYLQ
Q0P538_BCL2A1-01        --------------------------------MAEYELMHIHSLAEHYLQ
G3V977_BCL2A1-01        --------------------------------MTDCEFMYIHSLAENYLQ
Q925A9_BCL2A1-01        --------------------------------MTDCEFMYIHSLAENYLQ
Q07440_BCL2A1-01        --------------------------------MAESELMHIHSLAEHYLQ
O55179_BCL2A1-01        --------------------------------MSEYEFMYIHSLAEHYLQ
O55177_BCL2A1-02        --------------------------------MAEYEFMYIHSLAEHYLQ
Q497M6_BCL2A1-01        --------------------------------MAEYEFMYIHSLAEHYLQ
Q8K164_BCL2A1-01        --------------------------------MAEYEFMYIHSLAEHYLQ
Q4FK02_BCL2A1-01        --------------------------------MSEYEFMYIHSLAEHYLQ
A0A452SIR9_BCL2A1-      --------------------------------MTDCEFGYTLTLAQDYVK
M3YVH4_BCL2A1-01        --------------------------------MTDSEFGYTLSLAQDYVR
U6CQS8_BCL2A1-01        --------------------------------MTDGEFGYTLSLAQDYVR
I3MCZ7_BCL2A1-01        --------------------------------MNDCEFRFIHTLAQDYLQ
G3T8E6_BCL2A1-01        --------------------------------MTDCEFGYIYKLVQDYLK
H0WZ23_BCL2A1-01        --------------------------------MTDCEFGYIHRLAQDYLQ
A0A2K6TLJ5_BCL2A1-      --------------------------------MTDHEFGYIHNLTQDYLR
A0A2K5D2I1_BCL2A1-      --------------------------------MTDCEFGYIHNLTQDYLR
B4E1X9_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2I2YML2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2R8ZJX9_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2I3HBP6_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6PHF2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6LV19_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5TMD1_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KAA3_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6DS18_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A096NMX5_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6AD27_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
F7HXW0_BCL2A1-01        --------------------------------MTDSEFGYIHNLTQDYLQ
A0A2K6TLJ5_BCL2A1-      --------------------------------MTDHEFGYIHNLTQDYLR
A0A2I3HBP6_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6EKG1_BCL2A1-      --------------------------------MTDCEFGYTHRLVQDYLQ
A0A452EK63_BCL2A1-      --------------------------------MTDTEFDYVHKLAEDYLK
W5Q0N6_BCL2A1-01        --------------------------------MTDTEFDYVHKLAEDYLK
L8IZT5_BCL2A1-01        --------------------------------MTDTEFGYVHGLAEDYLK
Q3C2I0_BCL2A1-01        --------------------------------MTDTEFGYVHGLAEDYLK
F7CP56_BCL2A1-04        --------------------------------MTDCEFGYIHMLAQDYLK
C7F841_BCL2A1-01        --------------------------------MTDDEFGYIHMLAQDYLK
A0A2K5D2I1_BCL2A1-      --------------------------------MTDCEFGYIHNLTQDYLR
H2NNZ9_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2I2YML2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6LV19_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6PHF2_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KHH8_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KHH8_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5KAA3_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K5TMD1_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
F7E8V5_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6DS18_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2K6AD27_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A096NMX5_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
A0A0D9RRC3_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
Q16548_BCL2A1-01        --------------------------------MTDCEFGYIYRLAQDYLQ
A0A2R8ZJX9_BCL2A1-      --------------------------------MTDCEFGYIYRLAQDYLQ
G1QEX2_BCL2L10-01       ----------------------------------DELKLRTRRLLTEFLE
A0A3Q1FR00_BCL2L1-      ---------------------------MFRRHVKASYYVIGRQGRADVGG
F6VJQ0_BCL2L10-01       ------------------------------MDYKCALREETARLVTDYLE
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          -----------------------------------MFG-LQRNAVIGLNL
A0A2K5EPX0_MCL1-02      -----------------------------------SQS-YNNLKIT----
A0A2K5EPX0_MCL1-01      -----------------------------------NAS-CSRPACF----
Q9Z1P3_MCL1-01          -----------------------------------MFG-LRRNAVIGLNL
A5PJR2_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
A0A452GA25_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
G1L3L7_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
G1T2Q0_MCL1-01          ---------------------------------MAMFS-LRRNAVIGLNL
F7AVA6_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
A0A337S3J9_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A337S3J9_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
Q7YRZ9_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
F1PAP1_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
Q8HYS5_MCL1-01          -----------------------------------MFG-LKRNAVIRTQL
M3XZZ5_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
A0A452RHX5_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
H0XFB7_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
F7GTF7_MCL1-01          -----------------------------------MFG-LQRNAVIGLNL
A0A2K5CFH3_MCL1-01      -----------------------------------MFG-LQRNAVIGLNL
A0A2K6V5Y3_MCL1-01      -----------------------------------MFG-LQRNAVIGLNL
A0A2K6KRW9_MCL1-01      -----------------------------------MFG-FKRNAVIGLNL
A0A2K5XSB2_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A0D9RZP5_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
I7G687_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
A0A2K5LXU8_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2I3GJZ3_MCL1-02      -----------------------------------MFG-LRRNAVIGLNL
H2N5Y9_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
A0A2R9BPJ5_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2I3RTV4_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2I2YQH7_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2K5C7L5_MCL1-01      -----------------------------------MFG-LQRNALIGLNL
A0A2K5I9I0_MCL1-02      -----------------------------------MFG-LKRNAVIGLNL
A0A2K6GI15_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2I3GJZ3_MCL1-01      -----------------------------------MFG-LRRNAVIGLNL
A0A2K5CFH3_MCL1-03      -----------------------------------MFG-LQRNAVIGLNL
A0A2K5R5E2_MCL1-03      -----------------------------------MFG-LQRNAVIGLNL
A0A2K5W0W9_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2K6ECR0_MCL1-02      -----------------------------------MFG-LKRNAVIGLNL
A0A2I3LFM0_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
A0A2K6KRW9_MCL1-02      -----------------------------------MFG-FKRNAVIGLNL
A0A2K6PPI3_MCL1-02      -----------------------------------MFG-FKRNAVIGLNL
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      -----------------------------------MFG---FQVVIRLNL
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        -----------------MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPG
B6V6J0_MCL1-01          ----------------------------MMHQSVIAKQRPSTSFLIPCQF
A0A3L7HT14_BCL2A1-      --MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFM-YIHSLAEDYLQ
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K6TM77_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K5RUN8_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K6GWM6_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
W5QDH4_BCL2L2-01        MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAP-DTRALVADFVG
A0A2K6ME72_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K6RW35_BCL2L2-      ------------------------------MATPASAP-DTRALVADFLG
A0A287ATE4_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2R8M4C0_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K5MZX9_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K5HEJ9_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K5V0Q3_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
F7G4L5_BCL2L2-02        ------------------------------MATPASAP-DTRALVADFVG
A0A2K6EA59_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K6AI25_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A1U7RC37_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2I3GEA7_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2R9A2Q3_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
H2Q805_BCL2L2-02        ------------------------------MATPASAP-DTRALVADFVG
A0A096NX09_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A287ATE4_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A4D6NWN1_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A1U7UJF2_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A452UF16_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A452UF16_BCL2L2-      ------------------------------MATPASAP-DTRALVADFVG
A0A2K6F6N9_MCL1-01      ------------------------------------------DLWINLGI
G1QAV8_MCL1-01          -----------------------------------MFG-PKRNAFIGLNL
H9GEA6_MCL1-01          -----------------------------------MFNKKSMVLVCGGAP
H9GEA6_MCL1-02          --------------------------------------------------
A0A493U0E8_MCL1-01      --------------------------------------------------
A0A1L1RNM6_MCL1-01      -----------------------------------MFA-VKRNAVIGFNL
A0A1L1RNM6_MCL1-02      -----------------------------------MFA-VKRNAVIGFNL
G2HFR3_MCL1-01          ------------------------------MDICRLSAAMREFYIVHLDI
F6ZMX1_MCL1-01          -----------------------------------MLGPFKKNAVIGLNL
F6ZMX1_MCL1-02          -----------------------------------MLGPFKKNAVIGLNL
F6ZMX1_MCL1-03          -----------------------------------MLGPFKKNAVIGLNL
G1T2Q0_MCL1-02          -----------------------------------MFS-LRRNAVIGLNL
F1PAP1_MCL1-02          -----------------------------------MFG-LKRNAVIGLNL
A0A337S3J9_MCL1-04      -----------------------------------MFG-LKRNAVIGLNL
F7AVA6_MCL1-02          -----------------------------------MFG-LKRNAVIGLNL
A0A2K6GI15_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
C8YZ26_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
F7GTF7_MCL1-02          -----------------------------------MFG-LQRNAVIGLNL
A0A2K5R5E2_MCL1-04      -----------------------------------MFG-LQRNAVIGLNL
A0A2K6V5Y3_MCL1-03      -----------------------------------MFG-LQRNAVIGLNL
A0A2K5LXU8_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2K5I9I0_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2I2YQH7_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
Q07820_MCL1-04          -----------------------------------MFG-LKRNAVIGLNL
A0A2K5W0W9_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2K6ECR0_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2K5XSB2_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2R9BPJ5_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2I3RTV4_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2I3LFM0_MCL1-03      -----------------------------------MFG-LKRNAVIGLNL
A0A2K6PPI3_MCL1-03      -----------------------------------MFG-FKRNAVIGLNL
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          -----------------------------------MFG-LRRNAVIGLNL
A0A452GA25_MCL1-02      -----------------------------------MFG-LKRNAVIGLNL
G3T756_MCL1-01          -----------------------------------MFG-FKRNAVIGLNL
A0A1S3F3I1_MCL1-01      -----------------------------------MFG-LRRNAVIGLNF
G1L3L7_MCL1-02          -----------------------------------MFG-LKRNAVIGLNL
A0A287BK44_MCL1-02      -----------------------------------MFG-LQRNAVIGLNL
A0A287BK44_MCL1-01      -----------------------------------MFG-LQRNAVIGLNL
B4DU51_MCL1-01          -----------------------------------MFG-LKRNAVIGLNL
A0A287DCH9_MCL1-02      -----------------------------------MFG-LKRNAVIGLNL
A0A287DCH9_MCL1-01      -----------------------------------MFG-LKRNAVIGLNL
W5MMB7_MCL1-01          --------------------------------------MSLSSLKRTSAS
A0A3B3SG34_MCL1-01      --------------------------------MNPQSLKSYAPIMVSMNY
Q4SW32_MCL1-01          -----------------------------------MSVIANRTAIDTMNV
Q0KFR9_MCL1-01          -------------------------------------MSLSNSITRATTT
A0A3P8Y1W8_MCL1-02      -------------------------------------MNLSKSLTRATTT
A0A3P8Y1W8_MCL1-01      -------------------------------------MNLSKSLTRATTT
D2ITA0_MCL1-03          -------------------------------MLSQKLTSNYGTSLVQTCW
D2ITA0_MCL1-04          -------------------------------MLSQKLTSNYGTSLVQTCW
A0A3P9ILF6_MCL1-02      ----------------------------------------MFPLQKQMVN
A0A3P9ILF6_MCL1-01      ----------------------------------------MFPLQKQMVN
A0A3Q2XZL8_MCL1-01      --------------------------------MSMVQ--PTSQVLKPQGR
A0A3B4AFB7_MCL1-02      --------------------------------MNIINSPKRTALKLSTMG
A0A3B3VM25_MCL1-01      ---------------------------------------MTANSTTALNY
I3KXG5_MCL1-01          --------------------------------------------MFSLNC
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      -------------------------------MNTCTMRNCRMGSYKNVMD
A0A3B4T8L9_MCL1-02      --------------------------------MNLIQ-SPKPTAFTAMNY
A0A3B4T8L9_MCL1-01      --------------------------------MNLIQ-SPKPTAFTAMNY
A0A3Q1EQB9_MCL1-02      --------------------------------MNMIP--TKRTTL--MNC
A0A3B4ZKP6_MCL1-01      --------------------------------MNIIP-TTKRTAL--MSC
A0A3Q1BKL8_MCL1-02      --------------------------------MNMIPTTTKRTAF--MNY
A0A3Q1EQB9_MCL1-01      --------------------------------MNMIP--TKRTTL--MNC
A0A3Q1BKL8_MCL1-01      --------------------------------MNMIPTTTKRTAF--MNY
A0A3P8RQX7_MCL1-02      --------------------------------MNMIPTTTKRTAF--MNY
A0A3P8RQX7_MCL1-01      --------------------------------MNMIPTTTKRTAF--MNY
G3PJT0_MCL1-01          ------------------------------MNIIQRPKLAALNMTGVMSC
A0A3B3IJ04_MCL1-01      ---------------------------------------MFPLQKQMVNS
A0A3P9L1F3_MCL1-01      ---------------------------------------MFPLQKQMVNS
A0A3B3IJ04_MCL1-02      ---------------------------------------MFPLQKQMVNS
A0A3P9L1F3_MCL1-02      ---------------------------------------MFPLQKQMVNS
A0A3B3CEX1_MCL1-01      ---------------------------------------MLPLQKHMVNS
A0A3B3CEX1_MCL1-02      ---------------------------------------MLPLQKHMVNS
A0A3Q3VP02_MCL1-01      -------------------------------------------------M
A0A3Q3B4P5_MCL1-01      -----------------------------------------MFPKPKPSY
A0A3Q3B4P5_MCL1-02      -----------------------------------------MFPKPKPSY
A0A3Q2EDX8_MCL1-01      -----------------------------------------------MSY
A0A3Q2P7X9_MCL1-01      --------------------------------------MSKAPTSTQLVN
A0A3Q2P7X9_MCL1-02      --------------------------------------MSKAPTSTQLVN
A0A3B5PQ55_MCL1-01      ---------------------------------------MTANSTNALNY
A0A3B5PQ55_MCL1-02      ---------------------------------------MTANSTNALNY
A0A3P9Q4I8_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3P9Q4I8_MCL1-02      ---------------------------------------MTANSTTALNY
A0A087X830_MCL1-01      ---------------------------------------MTANSTTALNY
A0A3B3YCD0_MCL1-01      ---------------------------------------MTANSTTALNY
I3JHR5_MCL1-02          ----------------------------MTNFLMS-KRNQCT-----FID
I3JHR5_MCL1-03          ----------------------------MTNFLMS-KRNQCT-----FID
I3JHR5_MCL1-01          ----------------------------MTNFLMS-KRNQCT-----FID
A0A3Q4HLQ8_MCL1-01      ----------------------------MTNYMMS-KRNQCT-----FID
A0A3P8NP63_MCL1-02      ----------------------------MANYMML-KRNQCT-----LME
A0A3Q2VNL8_MCL1-01      ----------------------------MANYMML-KRNQCT-----LME
A0A3P8NP63_MCL1-01      ----------------------------MANYMML-KRNQCT-----LME
A0A3P9BVM3_MCL1-01      ----------------------------MANYMML-KRNQCT-----LME
A0A3B4G4Z6_MCL1-01      ----------------------------MANYMML-KRNQCT-----LME
A0A2U9CJ81_MCL1-01      -----------------------------MNIIPSTKRAAFNVTTGVMGC
A0A3P8VKM5_MCL1-03      -----------------------------MNIIKN-NQAKLNVATGVLGC
A0A3P8VKM5_MCL1-04      -----------------------------MNIIKN-NQAKLNVATGVLGC
A0A3P8VKM5_MCL1-05      -----------------------------MNIIKN-NQAKLNVATGVLGC
A0A3Q3IZW0_MCL1-01      -----------------------------MNIITS-KKWADVNVTTEIMS
A0A3Q1GX28_MCL1-02      ------------------------------MLPSG-RTAMKL-ATGGMSC
A0A3Q1GX28_MCL1-01      ------------------------------MLPSG-RTAMKL-ATGGMSC
A0A3B4XKA5_MCL1-01      -----------------------------MNLIQA-PKQAAL-T--AVNY
A0A3Q3GP42_MCL1-01      -----------------------------MDIINM-KRAAVS-VSAGVMS
A0A3Q3M6G2_MCL1-01      -----------------------------MSFIPS-TRRAAL-IP-GVM-
A0A3Q3M6G2_MCL1-02      -----------------------------MSFIPS-TRRAAL-IP-GVM-
A0A3B1IEV7_MCL1-01      ---------------------------------------------MNPTA
A0A3B4CGU9_MCL1-03      ---------------------------------------------MESAA
A0A3B4CGU9_MCL1-02      ---------------------------------------------ME---
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
Q9Z0F3_BCL2L10-01       -----------------------------MADSQDPLHERTRRLLSDYIF
E1B9B3_BCL2L10-01       --------------------------MTEGGAMVDPFRERTARLLMDYLE
A0A1U7QVA0_BCL2L10      --------------------------------MADPLRVRTRLLLTDYLT
F1RZB9_BCL2L10-01       --------------------------------MADAFRERTARLLTDYLE
F1MV39_BCL2L10-01       -----------------------------VADGQESLVERTARLLMDYLE
W5QIG4_BCL2L10-01       -----------------------GRPPGRGGAMVDPFRERTARLLMDWLE
Q99M66_BCL2L10-01       --------------------------------MGDPLQDRTRRLLTDYIL
F6ZPD4_BCL2L10-01       -------------------------------AVAEALRERTALLLIDYLQ
A0A2K6F2Q2_BCL2L10      --------------------------------MGDRFRERTERLLADYLE
H0WZ06_BCL2L10-01       --------------------------------MADPLRERTERLLTDYLE
A0A1U7UZD8_BCL2L10      --------------------------------MADPLEERTARLLADYLE
G1T264_BCL2L10-01       --------------------------------MADALEERTARLLTDYLE
A0A0D9RG38_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5RIU7_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K5F974_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K6TIT7_BCL2L10      --------------------------------MADPLQQRTEQLVADYLE
F7CT87_BCL2L10-01       --------------------------------MADPLRQRTEQLVTDYLE
A0A096NM44_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K6R5T5_BCL2L10      --------------------------------MADPLRERTERLLADYLG
Q9HD36_BCL2L10-02       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
G1R3W6_BCL2L10-01       --------------------------------MVDQLRERTERLLADYLG
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K6M5H5_BCL2L10      ----------------------MADPLRERTTVADPLRERTERLLADYLG
A0A2K5TKG9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
F7H6U5_BCL2L10-01       --------------------------------MADPLRERTERLLADYLG
A0A2K6B2D9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5MMZ4_BCL2L10      --------------------------------MADPLRERTERLLADYLG
H2NN92_BCL2L10-01       ----------------------MVDQLRERTITADLLRERTERLLADYLG
A0A2R9BCD9_BCL2L10      ----------------------MVDQWRERTTMADPLRERTERLLADYLG
H2Q9G4_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
G3QLU6_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
A0A337RYG8_BCL2L10      --------------------------------MADALRERTAQLLTDYLE
G1LKR4_BCL2L10-01       --------------------------------MADALRG-TARLLTDYLE
A0A452QJG0_BCL2L10      --------------------------------MADALRERTARLLTDYLE
A0A3Q4MN81_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3B4ETX9_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2PJS5_BCL2L10      -------------------MCREPSHIAGRK-MSCGLWKETVAVAEDYMR
A0A3Q2GL87_BCL2L10      -------------------MCREPLHITGRK-MSCGLWKETVAVAEDYMR
A0A3B5MJ12_BCL2L10      --------------------------------MSCGLWKETVVVAEDYIR
M4AUW7_BCL2L10-01       --------------------------------MSCGLWKETVVVAEDYIR
A0A096ME02_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIH
A0A3B3TYN4_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIR
A0A3B3YT99_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIH
A0A3P9NE65_BCL2L10      ---------MRRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIH
A0A3P9IIZ2_BCL2L10      --------------------------------MSCGLRKETLAVALDYLS
A0A3P9LM07_BCL2L10      --------------------------------MSCGLRKETLAVALDYLS
H2MBQ3_BCL2L10-01       --------------------------------MSCGLRKETLAVALDYLS
A0A3B4AAV4_BCL2L10      --------------------------------MSCGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRK-MSCGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRK-MSCGLWKETLALAEDYLS
A0A3Q3JQ78_BCL2L10      -------------------MCREHLDIAGRK-MSCGLWKDTLALAEDYLS
A0A3B4TIY6_BCL2L10      --------------------------------MSCGLWKETRAVAEDYLY
A0A3B4WGF4_BCL2L10      --------------------------------MSCGLWKETRAVAEDYLF
A0A3Q3KZW1_BCL2L10      --------------------------------MSCGLWKETLALAEDYLS
A0A3B5KD08_BCL2L10      --------------------------------MSCGLWKETLALAEDYLS
A0A3Q3VI28_BCL2L10      --------------------------------MSCGLWKETLALAQDYLS
A0A3Q1GM98_BCL2L10      --------------------------------MSCGLWKETVVLAEDYLS
A0A3Q1D2L0_BCL2L10      --------------------------------MSCGLWKETLVLAEDYLS
A0A3P8RL82_BCL2L10      --------------------------------MSCGLWKETLVLAEDYLS
A0A3B4ZFS0_BCL2L10      --------------------------------MSCGLWKETLVVAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P8PVZ8_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P9BLI0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q0S9R1_BCL2L10      --------------------------------MVPGLWKETLGLAEDYLS
D2IT42_BCL2L10-02       --------------------------------MSCRLWKETLALSEDYLL
A0A3B3C5I4_BCL2L10      -----------------------MDGFSAQK-MSCGLRKETLAVALDYLS
A0A3Q1IAB0_BCL2L10      CADAEGKLRVHRGSPSAVRMCREQTDIAGRK-MSCGLWKDTLALAEDYLS
A0A3P8W7K5_BCL2L10      --------MCNSASPSAVSTSSEQSDIAGRK-MSCGLWKETLAVAEDYLS
H3AAS7_BCL2L2-02        ----------------------------------MDSLYSNRGVVEDFIY
H3AAS7_BCL2L2-01        ----------------------------------MDSLYSNRGVVEDFIY
G1Q051_BCL2L2-01        -----MNEFSLDNFMLYSFDSVDIRPKVLGPKSSQPQAPDTQALVADFVG
G3WPT1_BCL2L2-01        ---------------HSSSPIFFSLPFIASQMATPASAPDTRALVADFVG
A0A287D9B3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A482LX62_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
W5QDH4_BCL2L2-02        -MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVG
Q7TS60_BCL2L2-01        -----MSLFGLCQYFSYIYVSLSSLPLSAARMATPASTPDTRALVADFVG
G1LMC3_BCL2L2-01        ---------------PYIHASLSSLTLTAARMATPASAPDTRALVADFVG
M3Y5X5_BCL2L2-01        -----KPEAPLLAFQPYIHASLSSLTLTAARMATPASAPDTRALVADFVG
G1P3J2_BCL2L2-01        -----PEMLHSVSLTKYTHASLLSLTFTAARMATPASAPDTRALVADFVG
G3WPT1_BCL2L2-02        -------------------------------MATPASAPDTRALVADFVG
G1TV33_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
P70345_BCL2L2-01        -------------------------------MATPASTPDTRALVADFVG
O88996_BCL2L2-01        -------------------------------MATPASTPDTRALVADFVG
A0A3Q9B4M8_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
H0XR82_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A250YBR2_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A250YBR2_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
L8HP19_BCL2L2-02        -------------------------------MATPASAPDTRALVADFVG
L8HP19_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
Q1RMX3_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A452ECF0_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A286XQQ9_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5RUN8_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5MZX9_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A0D9RU30_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5HEJ9_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A1S3FYD8_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2I2UAE3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2I2YPX6_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A287D9B3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K5V0Q3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
F7G4L5_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A2K6EA59_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6AI25_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A1U7RC37_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2I3GEA7_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2R9A2Q3_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
H2Q805_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
A0A096NX09_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6GWM6_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6ME72_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A2K6RW35_BCL2L2-      -------------------------------MATPASAPDTRALVADFLG
A0A2K6RW35_BCL2L2-      -------------------------------MATPASAPDTRALVADFLG
A0A2K6TM77_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A287ATE4_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A1U7UJF2_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
A0A452SHI1_BCL2L2-      -------------------------------MATPASAPDTRALVADFVG
Q05KI8_BCL2L2-01        -------------------------------MATPASAPDTRALVADFVG
Q2TAP5_BCL2L1-01        ------------------------------------MEGSSRDLVEKFVS
Q91828_BCL2L1-01        ------------------------------------MEGSSRDLVEKFVS
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        ---------------------------------MAQSELGSRALVEDFVR
F7G6M3_BCL2L2-01        LAPCPSRPPGSPPDAPPRPPPPRCPAAPRMATPAPASVSDTRALVADFVG
A0A2K5CWY6_BCL2L2-      -------------------------IAARMATPASA--PDTRALVADFVG
A0A2K5CWY6_BCL2L2-      -------------------------IAARMATPASA--PDTRALVADFVG
G3TMU7_BCL2L2-01        -------------------------AAARMATPASA--PDTRALVADFVG
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
H9GHK7_BCL2L1-01        ------------------------------------MSSSNRALVVDFLS
Q07816_BCL2L1-04        ------------------------------------MSSSNRELVIDFVS
A0A493TIA6_BCL2L1-      ------------------------------------MSSGNRELVIDFVS
Q07816_BCL2L1-02        ------------------------------------MSSSNRELVIDFVS
Q07816_BCL2L1-03        ------------------------------------MSSSNRELVIDFVS
Q07816_BCL2L1-01        ------------------------------------MSSSNRELVIDFVS
G1N5N5_BCL2L1-01        ------------------------------------MSSSNRELVIDFVS
A0A452ILL8_BCL2L1-      ------------------------------------MSNTNRELVIDFLS
A0A452ILL8_BCL2L1-      ------------------------------------MSNTNRELVIDFLS
K7F655_BCL2L1-01        ------------------------------------MSNTNRELVIDFLS
A0A452E1B1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
W5PSA5_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
P53563_BCL2L1-03        ------------------------------------MSQSNRELVVDFLS
P53563_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
A0A287CZ07_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
F6WA14_BCL2L1-01        ------------------------------------MSHSNRELVIDFLS
G3WKX6_BCL2L1-01        ------------------------------------MSHSNRELVVDFLS
M3XA94_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
M3XA94_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
A0A3Q2H0F6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
H0X6V2_BCL2L1-01        ------------------------------------MSQSNRELVVDFIS
G3SPN0_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
M3XA94_BCL2L1-03        ------------------------------------MSQSNRELVVDFLS
G1RER8_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A1S2ZQT6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
Q64373_BCL2L1-09        ------------------------------------MSQSNRELVVDFLS
Q64373_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
P53563_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
O77737_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q9MYW4_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A3Q2H0F6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
L8J061_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q05KJ0_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q05KJ0_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
E2IV76_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K6G3C5_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
B2Z3Z4_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
G3HEA7_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
G3HEA7_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
A0A1U7T4L4_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
M3Z2H9_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A1U7QU73_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A0D9RJZ8_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A286Y5D6_BCL2L1-      ------------------------------------MSQSNWELVVDFLS
A0A250YD48_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A1L5BWY3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
I3MUP5_BCL2L1-02        ------------------------------------MSQSNRELVVDFLS
I3MUP5_BCL2L1-03        ------------------------------------MSQSNRELVVDFLS
I3MUP5_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
G1P9D2_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K5EBP4_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
E2IV75_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
F7IT34_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
Q76LT7_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K5Q6R6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5Q6R6_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5M8B1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5H963_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
Q8SQ42_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A2K5VPG2_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K5YR37_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2R8Z9D7_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A096NV05_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2J8VIH3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K6QFA2_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K6QFA2_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A2K6UWY8_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
E2IV77_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A452SDS4_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A384D3U1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A452FWV3_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
Q9MZS7_BCL2L1-01        ------------------------------------MSQSNRELVVDFLS
A0A3B3E2W4_BCL2L1-      ------------------------------------MSHCNRELVQFYLG
A0A3B3I2Q5_BCL2L1-      ------------------------------------MSHCNRELVRFYLA
A0A3P9I2N4_BCL2L1-      ------------------------------------MSHCNRELVRFYLA
A0A3P9MKK4_BCL2L1-      ------------------------------------MSHCNRELVRFYLA
A0A3B5B4X7_BCL2L1-      ---------------------------------MEIMSYSNRELVEFFIS
A0A3B4BFZ8_BCL2L1-      ------------------------------------MSPSNRELVEFFIS
A0A3Q3FUB6_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3B5MGS2_BCL2L1-      ------------------------------------MAYSNRELVEFYIS
M4A558_BCL2L1-01        ------------------------------------MAYSNRELVEFYIS
A0A3P9QFB3_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A087YBW4_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3B3VWI7_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3B3XN57_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3Q2C6K4_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A3Q2NRP4_BCL2L1-      ------------------------------------MSYSNRELVEFYIS
A0A0B4KJI5_BCL2L1-      ------------------------------------MSYSNRELVESFLS
A0A3Q1JZ46_BCL2L1-      ---------------------------------MEEMSNSNRELVEFFIM
A0A3Q1JZ46_BCL2L1-      ---------------------------------MEEMSNSNRELVEFFIM
A0A3Q3NFM4_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3Q3NFM4_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3B4V9K8_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A3B4XS24_BCL2L1-      ------------------------------------MSYSNRELVEFFIS
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
C1BLI0_BCL2L1-01        ------------------------------------MSYSNRELVVFFIS
C0HAD8_BCL2L1-01        ------------------------------------MSYSNRELVVFFIS
A0A3B3ZMX9_BCL2L1-      -------------------------------------MSLNRELVEFYIQ
A0A3B3TFR4_BCL2L1-      ------------------------------------MSYSNRELVEYFVS
H3CH49_BCL2L1-01        ----------------------RSHPGAKSKGASTQRMSLNRELVIFYIK
A0A3Q2FR43_BCL2L1-      -------------------------------------MSQNRELVLFYIK
A0A3P8XYL5_BCL2L1-      ------------------------------------MTYNNKELVAYYIT
Q90Z98_BCL2L1-02        ------------------------------------MSYYNRELVVFFIK
Q90Z98_BCL2L1-01        ------------------------------------MSYYNRELVVFFIK
A0A059PJI5_BCL2L1-      ------------------------------------MSYYNRELVVYFIK
A0A3B4DTL9_BCL2L1-      ------------------------------------MSYYNRELVVYFIK
B5XAY3_BCL2L1-01        -----------------------------------MMTYNNRELVVYYIT
W5MG74_BCL2L1-01        -----------------------------------KMSYSNRDLVVYYIN
A0A3Q3B3X5_BCL2L1-      -------------------------------------MSQNKELVLFYIM
A0A3B3IB64_BCL2L1-      -------------------------------------MSRNRELVVFYVK
A0A3P9JYH1_BCL2L1-      -------------------------------------MSRNRELVVFYVK
A0A3B3DHA1_BCL2L1-      -------------------------------------MSRNRELVVFYVK
A0A3Q0RTF8_BCL2L1-      -------------------------------------MSQNRELVLFYIT
I3IZK7_BCL2L1-01        -------------------------------------MSQNRELVLFYIR
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A2U9BY16_BCL2L1-      -------------------------------------MSQNKELVVFYIQ
A0A0D6DR75_BCL2L1-      -------------------------------------MSQNRELVVYYIT
A0A3Q3WIW8_BCL2L1-      -------------------------------------MSVNRELVAYYIN
A0A219P0Y3_BCL2L1-      -------------------------------------MCQNRELVVCYIK
A0A3Q3MX20_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q3G2E1_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q3G2E1_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q3G2E1_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q1GZ93_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q1GZ93_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3Q1GZ93_BCL2L1-      -------------------------------------MSQNRELVVFYIT
A0A3B4V3T1_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3B4XU17_BCL2L1-      -------------------------------------MSQNRELVVFYIK
H3ANS8_BCL2L1-01        ------------------------------------KMSFNRLLVVDHIS
A0A452FHY1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A452FHY1_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A1S3EPX7_BCL2L1-      ------------------------------------MSQSNRELVVDFLS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
U3JSL7_BCL2L1-01        ------------------------------------MYSSNRELVIDFVS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
A0A218USB3_BCL2L1-      ------------------------------------MYSSNRELVIDFVS
H0Z8G3_BCL2L1-01        ------------------------------------MYSSNRELVIDFVS
Q4U2V6_BCL2L1-01        ------------------------------------MSSSNRELVIDFVS
R4JQR8_BCL2L1-01        -----------------------------------MNQFSSRYLVADFIN
A0A346RRN1_BCL2L1-      -----------------------------------MNQYSSRYLVVDFVN
Q568V1_MCL1-01          ---------------------------------------------MSFLA
Q1L8X3_MCL1-01          ---------------------------------MALSLDFRRTATMSFFA
Q9I9N3_MCL1-01          ---------------------------------MALSLDFRRTATMSFFA
A0A286XUI2_BCL2A1-      -------------------------MGHILLSATAGSLDLREPAAGCCL-
A0A452U285_BCL2A1-      -------------------------MHTEIPPASARPMSHRPSPAGARLI
A0A452U285_BCL2A1-      -------------------------MHTEIPPASARPMSHRPSPAGARLI
A0A3B3R4U0_MCL1-01      --------------------------------MNLINRTTATGLFCPGIK
F7CP56_BCL2A1-03        CILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQ
A0A3P8V8T6_MCL1-01      ---------------------LDMVLISSVCLTLCTLENDTRQLICDFLK
A0A3P8YNB4_BCL2-01      -----------------------------------MADDDNRFIVEKYIC
A0A3P8WUE9_BCL2-01      --------------------------MYLVPNSAGMASECNRYIVEKYIC
A0A3B4A3G8_BCL2-01      -----------------------------------MANDCNRNIVEKYIC
A0A3Q3G1D7_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3Q2XQX2_BCL2-02      -----------------------------------MANERNRTIVENYIC
A0A3Q2XQX2_BCL2-01      -----------------------------------MANERNRTIVENYIC
A0A3Q3B0R2_BCL2-01      -------------------------------------MEVNRFIVENYIC
A0A3Q2PN77_BCL2-01      -----------------------------------MANDCNRDIVENYIF
A0A3P9J8Y9_BCL2-01      -----------------------------------MANVSNRSIVEKYIC
A0A3Q0S5Z7_BCL2-01      -----------------------------------MANEYNRNIVEKYIC
A0A3P8QVM8_BCL2-01      -----------------------------------MENEYNRNIVEKYIC
A0A3P9DIG5_BCL2-01      -----------------------------------MENEYNRNIVEKYIC
A0A3Q2UYW8_BCL2-01      -----------------------------------MANEYNRNIVEKYIC
A0A3B4G3K4_BCL2-01      -----------------------------------MANEYNRNIVEKYIC
A0A2U9BJ09_BCL2-01      -----------------------------------MASECNRNIVEKYIC
A0A3Q1I5N1_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3Q3K1K1_BCL2-01      -----------------------------------MANECNRNVVEKYIC
A0A3Q3MEY1_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A1X9JZA1_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A4D6FTA2_BCL2-01      -----------------------------------MANERNRNIVEKYIC
A0A3Q1FLK7_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3Q1B8C3_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3P8S9L3_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3B5BBQ0_BCL2-01      -----------------------------------MANECNRNIVEKYIC
A0A3B4TX71_BCL2-01      -----------------------------------MASEYNRNIVEKYIC
A0A3B4YAG2_BCL2-01      -----------------------------------MASEYNRNIVEKYIC
G1TW27_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
E2RS00_BCL2A1-02        ------------------------------MSHLFGGSYDAQRCSGER--
A0A3B3TCS4_BCL2-01      --------------------------------MANDVPYDSRNIVEIYIY
A0A0U3DHY6_BCL2-01      --------------------------------MANENPYDSRFIVEKYIH
A0A3P9AAB2_BCL2-01      --------------------------------MANENPYDSRVIVENYIY
X4ZGI8_BCL2-01          --------------------------------MANEIRYDNRNIVEKYLN
A0A3P9MKK4_BCL2L1-      ---------------------------------------MTKWKKSWHLT
A0A3B3I2Q5_BCL2L1-      ---------------------------------------MTKWKKSWHLT
A0A3P9I2N4_BCL2L1-      ---------------------------------------MTKWKKSWHLT
A0A3B4AFB7_MCL1-01      ------------------DTTCLQGVLTPPLGTAHICGSPHPRPTALVMK
G3TVG9_MCL1-01          -----------------------------GAQGPSVTATPARPMLFASIP
B9ZYL7_BCL2-01          ------------------------------MAHPRRGGYDHRDIVVKYIH
A0A3L7HT14_BCL2A1-      ---MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQ
F6YNL8_BCL2-01          -----------------------------MMAHPGRRGYDNREIVMKYIH
A0A218UQA0_BCL2-01      ------------------------------MAHPGRRGYDNREIVLKYIH
Q00709_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
A0A493T1X3_BCL2-01      ------------------------------MAHPGRRGYDNREIVLKYIH
U3KEW4_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
G3WZW9_BCL2-01          ------------------------------MAHPGRRGYDNREIVMKYIH
M3YYK3_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
M3X1R9_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6R2I5_BCL2-02      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2R9APW6_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
G3SLZ1_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
Q75SV7_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
M3X1R9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
Q8I008_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A076FU27_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
A0A4P8GLJ2_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
F6R2C4_BCL2-01          ------------------------------MAHAGGTGYDNREIVMKYIH
O02718_BCL2-01          ------------------------------MAHAGGTGYDNREIVMKYIH
A0A076FZV9_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
A0A452EV13_BCL2-01      ------------------------------MAHAGGTGYDNREIVMKYIH
A0A250YD83_BCL2-01      ------------------------------MAQAGRTGYDNREIVMKYIH
A9QXG9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5NZS5_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A0D9S017_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6CIX3_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5XRD4_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6KHG1_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6R2I5_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5HK49_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
G3QES9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
H2QEM8_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2I3GZF9_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6UEL3_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
A0A452R110_BCL2-02      --------------MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLP
G3WZW9_BCL2-02          --------------PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIH
G3SLZ1_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A452T603_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLE
A0A3Q2Y539_MCL1-01      -------------------------------------MPESKRFPLYNFK
A0A3Q3BEB7_BCL2L1-      ------------------------------------MSHSNRDLVQFYIS
A0A3P8VMA1_BCL2L1-      ------------------------------------MSCSNRELVKFFLG
A0A345BSW9_BCL2L1-      ------------------------------------MSYYNRELVVFFIK
A0A286MU87_BCL2L1-      ------------------------------------MSYSNRELVVFFIS
A0A3P8XFS0_BCL2L1-      ------------------------------------MSYSNRELVVFFIN
A0A3P8XFS0_BCL2L1-      ------------------------------------MSYSNRELVVFFIN
A0A0F7L1T6_BCL2L1-      ------------------------------------MSYNNRELVEHFLR
H2U5I3_BCL2L1-01        ------------------------------------MSYNNRELVEHFLR
A0A3Q3J5K3_BCL2L1-      ------------------------------------MSYSHRELVEFYIS
A0A3Q1EVP6_BCL2L1-      ------------------------------------MSCSNRELVEFFIS
A0A3Q1BQA0_BCL2L1-      ------------------------------------MSYSNRELVEFFVS
A0A3P8U812_BCL2L1-      ------------------------------------MSYSNRELVEFFVS
E6ZFR0_BCL2L1-01        ------------------------------------MSYSNRELVEFFIS
G3P7B4_BCL2L1-01        ------------------------------------MANINRELVEFFLS
A0A3Q3X5M5_BCL2L1-      ------------------------------------MSHSNRELVEFFIS
A0A2U9BIG9_BCL2L1-      ------------------------------------MSDSNRELVEFFIG
D2ITA2_BCL2L1-02        ------------------------------MSIDTSMSISNRELVFFFLS
A0A3B3ZMX9_BCL2L1-      -------------------------------------MSLNRELVEFYIQ
G3NJY1_BCL2L1-01        -------------------------------------MSQNRELVVFYIN
A0A2U9BY16_BCL2L1-      ---------------------------DARQRFCGEHHSRPEWIRQLFCR
A0A3Q3DUT7_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q3DUT7_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q3DUT7_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3B1JJ42_BCL2L1-      -----------------------------------VMSYYNRELVVYFIK
A0A3P8UWG7_BCL2L1-      ----------------------------------TLTFNINRKLVVDYIQ
A0A3Q3IVF5_BCL2L1-      -------------------------------------MSQNKELVVFYIT
A0A3Q1DHJ3_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q1DHJ3_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q1DHJ3_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3P8TL99_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3P8TL99_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3Q1FR00_BCL2L1-      -------------------------------------MSQNRELVVFYIK
A0A3B4Z3X2_BCL2L1-      -------------------------------------MSQNRELVVYYIK
A0A3B4Z3X2_BCL2L1-      -------------------------------------MSQNRELVVYYIK
C3VIT1_BCL2L1-01        -------------------------------------MSQNRELVVFYIK
A0A3P8P0F1_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q2X557_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3P9D632_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3P9D632_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q4N4B5_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3B4FNX1_BCL2L1-      -------------------------------------MSQNRELVLFYIR
A0A3Q2QPL9_BCL2L1-      -------------------------------------MSQNRELVLSYVK
A0A3B5PQJ0_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A087X9B7_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3B3TUS7_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3B3WI27_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3P9N9Y4_BCL2L1-      -------------------------------------MSRNRELVLFYIK
A0A3B3QRZ2_BCL2L1-      ------------------------------------MSYSNRELVMDFIT
Q564A4_BCL2-01          --------------------------------MANEISYDNRNIVEKYLK
H9GPE7_BCL2-01          ------------------------------MAHPGIRGYDNREIVLRYIH
A0A452I9V7_BCL2-01      -----------MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIH
W5N4F7_BCL2-01          -------------------------------MANNEAPYDTRNIVTKYIH
K7F5Y3_BCL2-02          ------------------------------MAHPGRRGYDNREIVLKYIH
A0A3Q2HRY3_BCL2-02      ------------------------------MAHAGRTGYDNREIVMKYIH
K7F5Y3_BCL2-01          ------------------------------MAHPGRRGYDNREIVLKYIH
F1LNV0_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
P49950_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
G1TW27_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5EB04_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2R8MY14_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
H2NWH5_BCL2-01          ------------------------------MAHAGTTGYDNREIVDEXIH
A0A096MPU7_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5PP81_BCL2-01      ------------------------------MAQAGRTGYDNREIVMKYIH
H0WKI0_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K5UDI5_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
P10417_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
Q7TSN8_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
A0A3Q2HRY3_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
E2QWA1_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
A0A2K6G3I7_BCL2-01      ------------------------------MAHAGRTGYDNREIVMKYIH
Q6R755_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
Q9JJV8_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
Q923R6_BCL2-01          ------------------------------MAQAGRTGYDNREIVMKYIH
H0W1T3_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
G1LIC9_BCL2-02          ------------------------------MAHAGRTGYDNREIVMKYIH
I3MVK9_BCL2-01          ------------------------------MAHAGRTGYDNREIVMKYIH
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        Y------------------------VLQIPQPGSGPS-------------
H0ZCL9_BCL2A1-01        Y------------------------VLQESHLGPAQT-------------
U3JTB2_BCL2A1-01        Y------------------------VLQESHLGPAQT-------------
A0A218V8Z6_BCL2A1-      Y------------------------VLQESHLGPAQT-------------
Q9W6F2_BCL2A1-01        Y------------------------VLQESHLGPAQT-------------
A0A493SSZ7_BCL2A1-      Y------------------------VLQESHLGPAQT-------------
G1N8C5_BCL2A1-01        Y------------------------VLQESRLGPAQT-------------
A0A452J3N6_BCL2A1-      Y------------------------VLQEPQLGPAPS-------------
K7G130_BCL2A1-01        Y------------------------ILQEPELGPAPS-------------
A0A2K5PYQ3_BCL2A1-      Y------------------------VLQIPQSGTGPS-------------
A0A2K5PYQ3_BCL2A1-      Y------------------------VLQIPQSGTGPS-------------
F6SFL4_BCL2A1-01        H------------------------VQQTPPLGSCLN-------------
G3WSP8_BCL2A1-01        H------------------------VQQMPRLGSCLH-------------
F6S8G3_BCL2A1-01        D------------------------VLQTPRLGTVPS-------------
O55178_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
Q0P538_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
G3V977_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
Q925A9_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
Q07440_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
O55179_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
O55177_BCL2A1-02        Y------------------------VLQVPAFESAPS-------------
Q497M6_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
Q8K164_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
Q4FK02_BCL2A1-01        Y------------------------VLQVPAFESAPS-------------
A0A452SIR9_BCL2A1-      H------------------------VLQIPQPGSAPS-------------
M3YVH4_BCL2A1-01        H------------------------VLQIPQPSPAAS-------------
U6CQS8_BCL2A1-01        H------------------------VLQIPQPGPAAS-------------
I3MCZ7_BCL2A1-01        H------------------------VLQVPQRGSSPS-------------
G3T8E6_BCL2A1-01        Y------------------------VLQIPQPAAGSS-------------
H0WZ23_BCL2A1-01        Y------------------------VLQIQQCGSGPS-------------
A0A2K6TLJ5_BCL2A1-      Y------------------------VLQIPQSGTGPS-------------
A0A2K5D2I1_BCL2A1-      Y------------------------VLQIPQSGTGPS-------------
B4E1X9_BCL2A1-01        C------------------------VLQIPQPGSGPS-------------
A0A2I2YML2_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2R8ZJX9_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2I3HBP6_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6PHF2_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6LV19_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K5TMD1_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K5KAA3_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6DS18_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A096NMX5_BCL2A1-      Y------------------------VLQIPQPGLGPS-------------
A0A2K6AD27_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
F7HXW0_BCL2A1-01        Y------------------------VLQIPQSGMGPS-------------
A0A2K6TLJ5_BCL2A1-      Y------------------------VLQIPQSGTGPS-------------
A0A2I3HBP6_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6EKG1_BCL2A1-      Y------------------------VLRVPQPGSGPS-------------
A0A452EK63_BCL2A1-      Y------------------------VLQIQQPGSKPS-------------
W5Q0N6_BCL2A1-01        Y------------------------VLQIQQPGSKPS-------------
L8IZT5_BCL2A1-01        Y------------------------VLQIQQPGSKPS-------------
Q3C2I0_BCL2A1-01        Y------------------------VLQIQQPGSKPS-------------
F7CP56_BCL2A1-04        Y------------------------VLQIPQPGSGPS-------------
C7F841_BCL2A1-01        Y------------------------VLQIPQPGSGPS-------------
A0A2K5D2I1_BCL2A1-      Y------------------------VLQIPQSGTGPS-------------
H2NNZ9_BCL2A1-01        Y------------------------VLQIPQPGSGPS-------------
A0A2I2YML2_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6LV19_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6PHF2_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K5KHH8_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K5KHH8_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K5KAA3_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K5TMD1_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
F7E8V5_BCL2A1-01        Y------------------------VLQIPQPGSGPS-------------
A0A2K6DS18_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A2K6AD27_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
A0A096NMX5_BCL2A1-      Y------------------------VLQIPQPGLGPS-------------
A0A0D9RRC3_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
Q16548_BCL2A1-01        C------------------------VLQIPQPGSGPS-------------
A0A2R8ZJX9_BCL2A1-      Y------------------------VLQIPQPGSGPS-------------
G1QEX2_BCL2L10-01       H------------------------RTRRRGT------------------
A0A3Q1FR00_BCL2L1-      Y------------------------V---------RAHTLVNTKWMCDIL
F6VJQ0_BCL2L10-01       Y------------------------C------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          Y------------------------C---------GGAGLG---------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          Y------------------------C---------GGASLG---------
A5PJR2_MCL1-01          Y------------------------C---------GGAGLG---------
A0A452GA25_MCL1-01      Y------------------------C---------GGAGLG---------
G1L3L7_MCL1-01          Y------------------------C---------GGAGLG---------
G1T2Q0_MCL1-01          Y------------------------L---------GGPGLG---------
F7AVA6_MCL1-01          Y------------------------C---------GGAGLG---------
A0A337S3J9_MCL1-01      Y------------------------C---------GGAGLA---------
A0A337S3J9_MCL1-03      Y------------------------C---------GGAGLA---------
Q7YRZ9_MCL1-01          Y------------------------C---------GGAGLA---------
F1PAP1_MCL1-01          Y------------------------C---------GGAGLG---------
Q8HYS5_MCL1-01          Y------------------------C---------GGAGLG---------
M3XZZ5_MCL1-01          Y------------------------C---------GGAGLG---------
A0A452RHX5_MCL1-01      Y------------------------C---------GGAGLG---------
H0XFB7_MCL1-01          Y------------------------C---------GGAGLG---------
F7GTF7_MCL1-01          Y------------------------C---------GGAGLG---------
A0A2K5CFH3_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K6V5Y3_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K6KRW9_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K5XSB2_MCL1-01      Y------------------------C---------GGAGLG---------
A0A0D9RZP5_MCL1-01      Y------------------------C---------GGAGLG---------
I7G687_MCL1-01          Y------------------------C---------GGAGLG---------
A0A2K5LXU8_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2I3GJZ3_MCL1-02      Y------------------------C---------GGAGLG---------
H2N5Y9_MCL1-01          Y------------------------C---------GGAGLG---------
A0A2R9BPJ5_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2I3RTV4_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2I2YQH7_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K5C7L5_MCL1-01      Y------------------------C---------EWAGLG---------
A0A2K5I9I0_MCL1-02      Y------------------------C---------GGAGLG---------
A0A2K6GI15_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2I3GJZ3_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K5CFH3_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K5R5E2_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K5W0W9_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K6ECR0_MCL1-02      Y------------------------C---------GGAGLG---------
A0A2I3LFM0_MCL1-01      Y------------------------C---------GGAGLG---------
A0A2K6KRW9_MCL1-02      Y------------------------C---------GGAGLG---------
A0A2K6PPI3_MCL1-02      Y------------------------C---------GGAGLG---------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      Y------------------------C------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          -----------------------------------GYNADG---------
E2RS00_BCL2A1-01        W------------------------EARLRDPEGSTRPPPGPQGLPGTLM
B6V6J0_MCL1-01          Y------------------------C---------SGGGSS---------
A0A3L7HT14_BCL2A1-      Y------------------------VLKVPTFESAPS-------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6TM77_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K5RUN8_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6GWM6_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
W5QDH4_BCL2L2-01        Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6ME72_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6RW35_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A287ATE4_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2R8M4C0_BCL2L2-      Y------------------------KLRQKGYVCGTGPGEG---------
A0A2K5MZX9_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K5HEJ9_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K5V0Q3_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
F7G4L5_BCL2L2-02        Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6EA59_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6AI25_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A1U7RC37_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2I3GEA7_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2R9A2Q3_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
H2Q805_BCL2L2-02        Y------------------------KLRQKGYVCGAGPGEG---------
A0A096NX09_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A287ATE4_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A4D6NWN1_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A1U7UJF2_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A452UF16_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A452UF16_BCL2L2-      Y------------------------KLRQKGYVCGAGPGEG---------
A0A2K6F6N9_MCL1-01      S------------------------C---------GRADLG---------
G1QAV8_MCL1-01          H------------------------C---------GGAVGGLWRQRSLHL
H9GEA6_MCL1-01          S------------------------MAPNTPASPGAGGGVG---------
H9GEA6_MCL1-02          -------------------------MAPNTPASPGAGGGVG---------
A0A493U0E8_MCL1-01      -------------------------------------GGWG---------
A0A1L1RNM6_MCL1-01      Y------------------------C---------GGGSPG---------
A0A1L1RNM6_MCL1-02      Y------------------------C---------GGGSPG---------
G2HFR3_MCL1-01          Y-------------------------------------------------
F6ZMX1_MCL1-01          Y------------------------C---------GGAGMG---------
F6ZMX1_MCL1-02          Y------------------------C---------GGAGMG---------
F6ZMX1_MCL1-03          Y------------------------C---------GGAGMG---------
G1T2Q0_MCL1-02          Y------------------------L---------GGPGLG---------
F1PAP1_MCL1-02          Y------------------------C---------GGAGLG---------
A0A337S3J9_MCL1-04      Y------------------------C---------GGAGLA---------
F7AVA6_MCL1-02          Y------------------------C---------GGAGLG---------
A0A2K6GI15_MCL1-03      Y------------------------C---------GGAGLG---------
C8YZ26_MCL1-01          Y------------------------C---------GGAGLG---------
F7GTF7_MCL1-02          Y------------------------C---------GGAGLG---------
A0A2K5R5E2_MCL1-04      Y------------------------C---------GGAGLG---------
A0A2K6V5Y3_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K5LXU8_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K5I9I0_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2I2YQH7_MCL1-03      Y------------------------C---------GGAGLG---------
Q07820_MCL1-04          Y------------------------C---------GGAGLG---------
A0A2K5W0W9_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K6ECR0_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K5XSB2_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2R9BPJ5_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2I3RTV4_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2I3LFM0_MCL1-03      Y------------------------C---------GGAGLG---------
A0A2K6PPI3_MCL1-03      Y------------------------C---------GGAGLG---------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          Y------------------------C---------GGASLG---------
A0A452GA25_MCL1-02      Y------------------------C---------GGAGLG---------
G3T756_MCL1-01          Y------------------------C---------GGAGLG---------
A0A1S3F3I1_MCL1-01      Y------------------------C---------GGAGLG---------
G1L3L7_MCL1-02          Y------------------------C---------GGAGLG---------
A0A287BK44_MCL1-02      Y------------------------C---------GGAGLG---------
A0A287BK44_MCL1-01      Y------------------------C---------GGAGLG---------
B4DU51_MCL1-01          Y------------------------C---------GGAGLG---------
A0A287DCH9_MCL1-02      Y------------------------C---------G--------------
A0A287DCH9_MCL1-01      Y------------------------C---------GGAGLG---------
W5MMB7_MCL1-01          A------------------------VIQLYCPNATTIHPGL---------
A0A3B3SG34_MCL1-01      H------------------------RPLHHGVLGKSILQC----------
Q4SW32_MCL1-01          M------------------------F--QNGVGD----------------
Q0KFR9_MCL1-01          M------------------------LHFQNGGSSYLADDAR---------
A0A3P8Y1W8_MCL1-02      M------------------------LNVQNGVVGSLYSGA----------
A0A3P8Y1W8_MCL1-01      M------------------------LNVQNGVVGSLYSGA----------
D2ITA0_MCL1-03          F------------------------NSPQNGGEERNMDFH----------
D2ITA0_MCL1-04          F------------------------NSPQNGGEERNMDFH----------
A0A3P9ILF6_MCL1-02      S------------------------YITSNCGFTGHILGR----------
A0A3P9ILF6_MCL1-01      S------------------------YITSNCGFTGHILGR----------
A0A3Q2XZL8_MCL1-01      P------------------------MRPQNGVAEGLLQCN----------
A0A3B4AFB7_MCL1-02      L------------------------FLPQNGLAEGDMHCG----------
A0A3B3VM25_MCL1-01      L------------------------IFSQNGVGDGQTHYD----------
I3KXG5_MCL1-01          C------------------------L----------SEWC----------
A0A3Q0R633_MCL1-01      -----------------------------------SLPF-----------
A0A3Q0R633_MCL1-03      L------------------------FLPQNGVVDGTMHYG----------
A0A3B4T8L9_MCL1-02      C------------------------ICRQNGGLETWTD-G----------
A0A3B4T8L9_MCL1-01      C------------------------ICRQNGGLETWTD-G----------
A0A3Q1EQB9_MCL1-02      L------------------------IFPQNGVVEGPMHYG----------
A0A3B4ZKP6_MCL1-01      F------------------------ILPQNGVVEGQMHYG----------
A0A3Q1BKL8_MCL1-02      L------------------------IFPQNGVVEGPMHYG----------
A0A3Q1EQB9_MCL1-01      L------------------------IFPQNGVVEGPMHYG----------
A0A3Q1BKL8_MCL1-01      L------------------------IFPQNGVVEGPMHYG----------
A0A3P8RQX7_MCL1-02      L------------------------IFPQNGVVEGPMHYG----------
A0A3P8RQX7_MCL1-01      L------------------------IFPQNGVVEGPMHYG----------
G3PJT0_MCL1-01          I------------------------ILPQNGVAP----------------
A0A3B3IJ04_MCL1-01      Y------------------------ITSNCGFTGHILGSR----------
A0A3P9L1F3_MCL1-01      Y------------------------ITSNCGFTGHILGSR----------
A0A3B3IJ04_MCL1-02      Y------------------------ITSNCGFTGHILGSR----------
A0A3P9L1F3_MCL1-02      Y------------------------ITSNCGFTGHILGSR----------
A0A3B3CEX1_MCL1-01      Y------------------------ITPSCGCTALFGG------------
A0A3B3CEX1_MCL1-02      Y------------------------ITPSCGCTALFGG------------
A0A3Q3VP02_MCL1-01      N------------------------VLFQNGVVSGPTR------------
A0A3Q3B4P5_MCL1-01      I------------------------FFLQNGVVDGLHR------------
A0A3Q3B4P5_MCL1-02      I------------------------FFLQNGVVDGLHR------------
A0A3Q2EDX8_MCL1-01      L------------------------ILPQNGVVDGQTHYS----------
A0A3Q2P7X9_MCL1-01      C------------------------LISQNGVGDGQPHYR----------
A0A3Q2P7X9_MCL1-02      C------------------------LISQNGVGDGQPHYR----------
A0A3B5PQ55_MCL1-01      L------------------------IFSQNGVGNGQTHYD----------
A0A3B5PQ55_MCL1-02      L------------------------IFSQNGVGNGQTHYD----------
A0A3P9Q4I8_MCL1-01      L------------------------IFSQNGVGNGQTHYD----------
A0A3P9Q4I8_MCL1-02      L------------------------IFSQNGVGNGQTHYD----------
A0A087X830_MCL1-01      L------------------------IFSQNGVGDGQTHYD----------
A0A3B3YCD0_MCL1-01      L------------------------IFSQNGVGDGQTHYD----------
I3JHR5_MCL1-02          Y------------------------LLPQNGVLEGPMHYG----------
I3JHR5_MCL1-03          Y------------------------LLPQNGVLEGPMHYG----------
I3JHR5_MCL1-01          Y------------------------LLPQNGVLEGPMHYG----------
A0A3Q4HLQ8_MCL1-01      Y------------------------LIPQNGVLEGPMHYG----------
A0A3P8NP63_MCL1-02      Y------------------------LIPQNGVLEGPMHYG----------
A0A3Q2VNL8_MCL1-01      Y------------------------LIPQNGVLEGPMHYG----------
A0A3P8NP63_MCL1-01      Y------------------------LIPQNGVLEGPMHYG----------
A0A3P9BVM3_MCL1-01      Y------------------------LIPQNGVLEGPMHYG----------
A0A3B4G4Z6_MCL1-01      Y------------------------LIPQNGVLEGPMHYG----------
A0A2U9CJ81_MCL1-01      L------------------------ILPQNGVVEGAMHYG----------
A0A3P8VKM5_MCL1-03      F------------------------IVPQNGVVNGTMHYG----------
A0A3P8VKM5_MCL1-04      F------------------------IVPQNGVVNGTMHYG----------
A0A3P8VKM5_MCL1-05      F------------------------IVPQNGVVNGTMHYG----------
A0A3Q3IZW0_MCL1-01      L------------------------ILPQNGVVEGSMHCG----------
A0A3Q1GX28_MCL1-02      L------------------------MLPQNGVVE----YS----------
A0A3Q1GX28_MCL1-01      L------------------------MLPQNGVVE----YS----------
A0A3B4XKA5_MCL1-01      C------------------------ICRQNGGLE-TWRDS----------
A0A3Q3GP42_MCL1-01      F------------------------MMPQNGVGKGQMHYG----------
A0A3Q3M6G2_MCL1-01      I------------------------VLPQDGVLEGPVHYD----------
A0A3Q3M6G2_MCL1-02      I------------------------VLPQDGVLEGPVHYD----------
A0A3B1IEV7_MCL1-01      I------------------------SLLCDGTSPVLYRTE----------
A0A3B4CGU9_MCL1-03      I------------------------SLFCNGAGRIPFNKG----------
A0A3B4CGU9_MCL1-02      ----------------------------AHGGVQINMAAH----------
Q8UWD6_MCL1-01          ---------------------------------MFAGRNN----------
A2BF68_MCL1-01          ---------------------------------MFAGRNN----------
Q568W5_MCL1-01          ---------------------------------MFAGRNN----------
A0A3B1K5R1_MCL1-01      -------------------------MMSPQDMCSYNKKTA----------
A0A3B4C6H5_MCL1-03      -------------------------MMMSPKEMYFDKKTV----------
A0A3B4C6H5_MCL1-01      ---------------------------LFSFVWEFSRKWP----------
Q9Z0F3_BCL2L10-01       F------------------------CAREPDT------------------
E1B9B3_BCL2L10-01       F------------------------CAREPGT------------------
A0A1U7QVA0_BCL2L10      F------------------------CAREPGD------------------
F1RZB9_BCL2L10-01       Y------------------------CAREPGT------------------
F1MV39_BCL2L10-01       F------------------------CAREPGT------------------
W5QIG4_BCL2L10-01       F------------------------CAREPGT------------------
Q99M66_BCL2L10-01       F------------------------CARAPNT------------------
F6ZPD4_BCL2L10-01       R------------------------RAREPAT------------------
A0A2K6F2Q2_BCL2L10      Y------------------------CTREPGA------------------
H0WZ06_BCL2L10-01       Y------------------------CARDPTA------------------
A0A1U7UZD8_BCL2L10      Y------------------------CARPPGS------------------
G1T264_BCL2L10-01       C------------------------CAREPGT------------------
A0A0D9RG38_BCL2L10      C------------------------CAREPGT------------------
A0A2K5RIU7_BCL2L10      Y------------------------CSREPGT------------------
A0A2K5F974_BCL2L10      Y------------------------CSQEPGT------------------
A0A2K6TIT7_BCL2L10      Y------------------------CSREPGT------------------
F7CT87_BCL2L10-01       Y------------------------CSREPGT------------------
A0A096NM44_BCL2L10      C------------------------CAREPGT------------------
A0A2K6R5T5_BCL2L10      C------------------------CAREPGT------------------
Q9HD36_BCL2L10-02       Y------------------------CAREPGT------------------
G1R3W6_BCL2L10-01       C------------------------CAREPGT------------------
A0A2K5K3B0_BCL2L10      C------------------------CAREPGT------------------
A0A2K6M5H5_BCL2L10      C------------------------CAREPGT------------------
A0A2K5TKG9_BCL2L10      C------------------------CAREPGT------------------
F7H6U5_BCL2L10-01       C------------------------CAREPGT------------------
A0A2K6B2D9_BCL2L10      C------------------------CAREPGT------------------
A0A2K5MMZ4_BCL2L10      C------------------------CAREPGT------------------
H2NN92_BCL2L10-01       C------------------------CAREPGT------------------
A0A2R9BCD9_BCL2L10      Y------------------------CAREPGT------------------
H2Q9G4_BCL2L10-01       Y------------------------CAREPGT------------------
G3QLU6_BCL2L10-01       Y------------------------CAREPGT------------------
A0A337RYG8_BCL2L10      Y------------------------CAREPGS------------------
G1LKR4_BCL2L10-01       Y------------------------CAREPGT------------------
A0A452QJG0_BCL2L10      Y------------------------CAREPGT------------------
A0A3Q4MN81_BCL2L10      F------------------------CCTSP-H------------------
A0A3B4ETX9_BCL2L10      F------------------------CCTSP-H------------------
A0A3Q2PJS5_BCL2L10      L------------------------RCSSP-H------------------
A0A3Q2GL87_BCL2L10      L------------------------RCSSP-L------------------
A0A3B5MJ12_BCL2L10      L------------------------RCSSP-H------------------
M4AUW7_BCL2L10-01       L------------------------RCSSP-H------------------
A0A096ME02_BCL2L10      L------------------------RCSSP-H------------------
A0A3B3TYN4_BCL2L10      L------------------------CCSSP-H------------------
A0A3B3YT99_BCL2L10      L------------------------RCSSP-H------------------
A0A3P9NE65_BCL2L10      L------------------------RCSNP-H------------------
A0A3P9IIZ2_BCL2L10      L------------------------SCRSP-L------------------
A0A3P9LM07_BCL2L10      L------------------------SCRSP-L------------------
H2MBQ3_BCL2L10-01       L------------------------SCRSP-L------------------
A0A3B4AAV4_BCL2L10      L------------------------CCSGP-Q------------------
A0A3Q3EZT5_BCL2L10      L------------------------CCTSP-R------------------
A0A3Q3EZT5_BCL2L10      L------------------------CCTSP-R------------------
A0A3Q3JQ78_BCL2L10      L------------------------CCTSS-R------------------
A0A3B4TIY6_BCL2L10      L------------------------CCTSP-Q------------------
A0A3B4WGF4_BCL2L10      L------------------------CCTSP-Q------------------
A0A3Q3KZW1_BCL2L10      L------------------------CCTSP-Q------------------
A0A3B5KD08_BCL2L10      L------------------------CSTSQ-C------------------
A0A3Q3VI28_BCL2L10      L------------------------CCTSQ-R------------------
A0A3Q1GM98_BCL2L10      L------------------------CCAGP-H------------------
A0A3Q1D2L0_BCL2L10      L------------------------CCASP-H------------------
A0A3P8RL82_BCL2L10      L------------------------CCASP-H------------------
A0A3B4ZFS0_BCL2L10      L------------------------CCTSP-H------------------
A0A3Q2UUN9_BCL2L10      F------------------------CCTSP-H------------------
A0A3P8PVZ8_BCL2L10      F------------------------CCTSP-H------------------
A0A3Q2UUN9_BCL2L10      F------------------------CCTSP-H------------------
A0A3P9BLI0_BCL2L10      F------------------------CCTSP-H------------------
A0A3Q0S9R1_BCL2L10      L------------------------CCTSP-H------------------
D2IT42_BCL2L10-02       S------------------------CTAST-G------------------
A0A3B3C5I4_BCL2L10      L------------------------SCRSPVL------------------
A0A3Q1IAB0_BCL2L10      L------------------------CCTSP-W------------------
A0A3P8W7K5_BCL2L10      L------------------------CCSSP-R------------------
H3AAS7_BCL2L2-02        Y------------------------KLGQKGY------------------
H3AAS7_BCL2L2-01        Y------------------------KLGQKGY------------------
G1Q051_BCL2L2-01        Y------------------------KLRQKGY------------------
G3WPT1_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A287D9B3_BCL2L2-      Y------------------------KLRQKGY------------------
A0A482LX62_BCL2L2-      Y------------------------KLRQKGY------------------
W5QDH4_BCL2L2-02        Y------------------------KLRQKGY------------------
Q7TS60_BCL2L2-01        Y------------------------KLRQKGY------------------
G1LMC3_BCL2L2-01        Y------------------------KLRQKGY------------------
M3Y5X5_BCL2L2-01        Y------------------------KLRQKGY------------------
G1P3J2_BCL2L2-01        Y------------------------KLRQKGY------------------
G3WPT1_BCL2L2-02        Y------------------------KLRQKGY------------------
G1TV33_BCL2L2-01        Y------------------------KLRQKGY------------------
P70345_BCL2L2-01        Y------------------------KLRQKGY------------------
O88996_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A3Q9B4M8_BCL2L2-      Y------------------------KMRQKGY------------------
H0XR82_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A250YBR2_BCL2L2-      Y------------------------KLRQKGY------------------
A0A250YBR2_BCL2L2-      Y------------------------KLRQKGY------------------
L8HP19_BCL2L2-02        Y------------------------KLRQKGY------------------
L8HP19_BCL2L2-01        Y------------------------KLRQKGY------------------
Q1RMX3_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A452ECF0_BCL2L2-      Y------------------------KLRQKGY------------------
A0A286XQQ9_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K5RUN8_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K5MZX9_BCL2L2-      Y------------------------KLRQKGY------------------
A0A0D9RU30_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K5HEJ9_BCL2L2-      Y------------------------KLRQKGY------------------
A0A1S3FYD8_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2I2UAE3_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2I2YPX6_BCL2L2-      Y------------------------KLRQKGY------------------
A0A287D9B3_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K5V0Q3_BCL2L2-      Y------------------------KLRQKGY------------------
F7G4L5_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A2K6EA59_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K6AI25_BCL2L2-      Y------------------------KLRQKGY------------------
A0A1U7RC37_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2I3GEA7_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2R9A2Q3_BCL2L2-      Y------------------------KLRQKGY------------------
H2Q805_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A096NX09_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K6GWM6_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K6ME72_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K6RW35_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K6RW35_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K6TM77_BCL2L2-      Y------------------------KLRQKGY------------------
A0A287ATE4_BCL2L2-      Y------------------------KLRQKGY------------------
A0A1U7UJF2_BCL2L2-      Y------------------------KLRQKGY------------------
A0A452SHI1_BCL2L2-      Y------------------------KLRQKGY------------------
Q05KI8_BCL2L2-01        Y------------------------KLRQKGY------------------
Q2TAP5_BCL2L1-01        K------------------------KLSQNEA------------------
Q91828_BCL2L1-01        K------------------------KLSQNEA------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        Y------------------------KLCQRSL------------------
F7G6M3_BCL2L2-01        Y------------------------KLRQKGF------------------
A0A2K5CWY6_BCL2L2-      Y------------------------KLRQKGY------------------
A0A2K5CWY6_BCL2L2-      Y------------------------KLRQKGY------------------
G3TMU7_BCL2L2-01        Y------------------------KLRQKGY------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      Y------------------------KLSQKGY------------------
H9GHK7_BCL2L1-01        Y------------------------KLSQRGH------------------
Q07816_BCL2L1-04        Y------------------------KLSQRGH------------------
A0A493TIA6_BCL2L1-      Y------------------------KLSQKGY------------------
Q07816_BCL2L1-02        Y------------------------KLSQRGH------------------
Q07816_BCL2L1-03        Y------------------------KLSQRGH------------------
Q07816_BCL2L1-01        Y------------------------KLSQRGH------------------
G1N5N5_BCL2L1-01        Y------------------------KLSQKGH------------------
A0A452ILL8_BCL2L1-      Y------------------------KLSQRGY------------------
A0A452ILL8_BCL2L1-      Y------------------------KLSQRGY------------------
K7F655_BCL2L1-01        Y------------------------KLSQRGH------------------
A0A452E1B1_BCL2L1-      Y------------------------KFFQKGY------------------
W5PSA5_BCL2L1-01        Y------------------------KFFQKGY------------------
P53563_BCL2L1-03        Y------------------------KLSQKGY------------------
P53563_BCL2L1-02        Y------------------------KLSQKGY------------------
A0A287CZ07_BCL2L1-      Y------------------------KLSQKGY------------------
F6WA14_BCL2L1-01        Y------------------------KLSQKGY------------------
G3WKX6_BCL2L1-01        Y------------------------KLSQKGY------------------
M3XA94_BCL2L1-01        Y------------------------KLSQKGY------------------
M3XA94_BCL2L1-02        Y------------------------KLSQKGY------------------
A0A3Q2H0F6_BCL2L1-      Y------------------------KLSQKGY------------------
H0X6V2_BCL2L1-01        Y------------------------KLSQKGY------------------
G3SPN0_BCL2L1-01        Y------------------------KLSQKGY------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        Y------------------------KLSQKGY------------------
M3XA94_BCL2L1-03        Y------------------------KLSQKGY------------------
G1RER8_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A1S2ZQT6_BCL2L1-      Y------------------------KLSQKGY------------------
Q64373_BCL2L1-09        Y------------------------KLSQKGY------------------
Q64373_BCL2L1-01        Y------------------------KLSQKGY------------------
P53563_BCL2L1-01        Y------------------------KLSQKGY------------------
O77737_BCL2L1-01        Y------------------------KLSQKGY------------------
Q9MYW4_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A3Q2H0F6_BCL2L1-      Y------------------------KLSQKGY------------------
L8J061_BCL2L1-01        Y------------------------KLSQKGY------------------
Q05KJ0_BCL2L1-01        Y------------------------KLSQKGY------------------
Q05KJ0_BCL2L1-02        Y------------------------KLSQKGY------------------
E2IV76_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A2K6G3C5_BCL2L1-      Y------------------------KLSQKGY------------------
B2Z3Z4_BCL2L1-01        Y------------------------KFSQKGY------------------
G3HEA7_BCL2L1-01        Y------------------------KLSQKGY------------------
G3HEA7_BCL2L1-02        Y------------------------KLSQKGY------------------
A0A1U7T4L4_BCL2L1-      Y------------------------KLSQKGY------------------
M3Z2H9_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A1U7QU73_BCL2L1-      Y------------------------KLSQKGY------------------
A0A0D9RJZ8_BCL2L1-      Y------------------------KLSQKGY------------------
A0A286Y5D6_BCL2L1-      Y------------------------KLSQKGY------------------
A0A250YD48_BCL2L1-      Y------------------------KLSQKGY------------------
A0A1L5BWY3_BCL2L1-      Y------------------------KLSQKGY------------------
I3MUP5_BCL2L1-02        Y------------------------KLSQKGY------------------
I3MUP5_BCL2L1-03        Y------------------------KLSQKGY------------------
I3MUP5_BCL2L1-01        Y------------------------KLSQKGY------------------
G1P9D2_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A2K5EBP4_BCL2L1-      Y------------------------KLSQKGY------------------
E2IV75_BCL2L1-01        Y------------------------KLSQKGY------------------
F7IT34_BCL2L1-01        Y------------------------KLSQKGY------------------
Q76LT7_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A2K5Q6R6_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K5Q6R6_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K5M8B1_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K5H963_BCL2L1-      Y------------------------KLSQKGY------------------
Q8SQ42_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A2K5VPG2_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K5YR37_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2R8Z9D7_BCL2L1-      Y------------------------KLSQKGY------------------
A0A096NV05_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2J8VIH3_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K6QFA2_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K6QFA2_BCL2L1-      Y------------------------KLSQKGY------------------
A0A2K6UWY8_BCL2L1-      Y------------------------KLSQKGY------------------
E2IV77_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A452SDS4_BCL2L1-      Y------------------------KLSQKGY------------------
A0A384D3U1_BCL2L1-      Y------------------------KLSQKGY------------------
A0A452FWV3_BCL2L1-      Y------------------------KLSQKGY------------------
Q9MZS7_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A3B3E2W4_BCL2L1-      Y------------------------KMSSRDY------------------
A0A3B3I2Q5_BCL2L1-      Y------------------------KMSCRDY------------------
A0A3P9I2N4_BCL2L1-      Y------------------------KMSCRDY------------------
A0A3P9MKK4_BCL2L1-      Y------------------------KMSCRDY------------------
A0A3B5B4X7_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B4BFZ8_BCL2L1-      Y------------------------KLSQKNY------------------
A0A3Q3FUB6_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B5MGS2_BCL2L1-      Y------------------------KLSQRNY------------------
M4A558_BCL2L1-01        Y------------------------KLSQRNY------------------
A0A3P9QFB3_BCL2L1-      Y------------------------KLSQRNY------------------
A0A087YBW4_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B3VWI7_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B3XN57_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3Q2C6K4_BCL2L1-      Y------------------------KLSQTNC------------------
A0A3Q2NRP4_BCL2L1-      Y------------------------KLSQTNC------------------
A0A0B4KJI5_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3Q1JZ46_BCL2L1-      Y------------------------KLSQRNH------------------
A0A3Q1JZ46_BCL2L1-      Y------------------------KLSQRNH------------------
A0A3Q3NFM4_BCL2L1-      Y------------------------KLSQKNY------------------
A0A3Q3NFM4_BCL2L1-      Y------------------------KLSQKNY------------------
A0A3B4V9K8_BCL2L1-      Y------------------------KLSQSNC------------------
A0A3B4XS24_BCL2L1-      Y------------------------KLSQSNC------------------
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY------------------
C1BLI0_BCL2L1-01        Y------------------------KLSQRNY------------------
C0HAD8_BCL2L1-01        Y------------------------RLSQRNY------------------
A0A3B3ZMX9_BCL2L1-      Y------------------------KLSQRDC------------------
A0A3B3TFR4_BCL2L1-      Y------------------------KLAQKNY------------------
H3CH49_BCL2L1-01        Y------------------------KLSQRNY------------------
A0A3Q2FR43_BCL2L1-      F------------------------KLSQRNY------------------
A0A3P8XYL5_BCL2L1-      Y------------------------KLSQRNY------------------
Q90Z98_BCL2L1-02        Y------------------------KLSQRNY------------------
Q90Z98_BCL2L1-01        Y------------------------KLSQRNY------------------
A0A059PJI5_BCL2L1-      Y------------------------KLSQKNY------------------
A0A3B4DTL9_BCL2L1-      Y------------------------KLSQRNY------------------
B5XAY3_BCL2L1-01        Y------------------------KLSQRDY------------------
W5MG74_BCL2L1-01        Y------------------------KLSQKNY------------------
A0A3Q3B3X5_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B3IB64_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3P9JYH1_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B3DHA1_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3Q0RTF8_BCL2L1-      Y------------------------KLSQRNY------------------
I3IZK7_BCL2L1-01        Y------------------------KLSQRNY------------------
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY------------------
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY------------------
A0A2U9BY16_BCL2L1-      Y------------------------KLSQRKY------------------
A0A0D6DR75_BCL2L1-      Y------------------------KLSEKNY------------------
A0A3Q3WIW8_BCL2L1-      Y------------------------KLSHRGC------------------
A0A219P0Y3_BCL2L1-      Y------------------------KLTQRNY------------------
A0A3Q3MX20_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3Q3G2E1_BCL2L1-      Y------------------------KFSQRNY------------------
A0A3Q3G2E1_BCL2L1-      Y------------------------KFSQRNY------------------
A0A3Q3G2E1_BCL2L1-      Y------------------------KFSQRNY------------------
A0A3Q1GZ93_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3Q1GZ93_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3Q1GZ93_BCL2L1-      Y------------------------KLSQRNY------------------
A0A3B4V3T1_BCL2L1-      H------------------------KLSQRNY------------------
A0A3B4XU17_BCL2L1-      Y------------------------KLSQRNY------------------
H3ANS8_BCL2L1-01        Q------------------------KLMQRGY------------------
A0A452FHY1_BCL2L1-      Y------------------------KLSQKGF------------------
A0A452FHY1_BCL2L1-      Y------------------------KLSQKGF------------------
A0A1S3EPX7_BCL2L1-      Y------------------------KLSQKGY------------------
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY------------------
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY------------------
U3JSL7_BCL2L1-01        Y------------------------KLSQKGY------------------
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY------------------
A0A218USB3_BCL2L1-      Y------------------------KLSQKGY------------------
H0Z8G3_BCL2L1-01        Y------------------------KLSQKGY------------------
Q4U2V6_BCL2L1-01        Y------------------------KLSQKGY------------------
R4JQR8_BCL2L1-01        D------------------------RLRKHGM---RWDN-----------
A0A346RRN1_BCL2L1-      D------------------------RLRKNGL---QWEN-----------
Q568V1_MCL1-01          Q------------------------GVQTPTL------------------
Q1L8X3_MCL1-01          Q------------------------GVQTPTL------------------
Q9I9N3_MCL1-01          Q------------------------GVQTPTL------------------
A0A286XUI2_BCL2A1-      -------------PPRMIDLEFRYTQALAQDYLLHVLQV-----------
A0A452U285_BCL2A1-      WPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQI-----------
A0A452U285_BCL2A1-      WPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQI-----------
A0A3B3R4U0_MCL1-01      N------------------------GVKQNGFYSFVSAS-----------
F7CP56_BCL2A1-03        Y------------------------QKSKRISIFLSMQD-----------
A0A3P8V8T6_MCL1-01      D---------------------FTTKSTQRLVESKALST-----------
A0A3P8YNB4_BCL2-01      H------------------------KLLKRGY---AWDF-----------
A0A3P8WUE9_BCL2-01      H------------------------KLAKRGY---VWEH-----------
A0A3B4A3G8_BCL2-01      H------------------------KLSKRGF---AWGFHE---------
A0A3Q3G1D7_BCL2-01      H------------------------KLSKRGY---EWGF-----------
A0A3Q2XQX2_BCL2-02      H------------------------KLSKRGY---AWGF-----------
A0A3Q2XQX2_BCL2-01      H------------------------KLSKRGY---AWGF-----------
A0A3Q3B0R2_BCL2-01      H------------------------KLSKRGY---AWGS-----------
A0A3Q2PN77_BCL2-01      H------------------------KLSKRGY---AWRF-----------
A0A3P9J8Y9_BCL2-01      H------------------------KLSKRGY---VCGL-----------
A0A3Q0S5Z7_BCL2-01      H------------------------KLSKRGY---AWGF-----------
A0A3P8QVM8_BCL2-01      H------------------------KLSKRGF---VWGF-----------
A0A3P9DIG5_BCL2-01      H------------------------KLSKRGF---VWGF-----------
A0A3Q2UYW8_BCL2-01      H------------------------KLSKRGF---VWGF-----------
A0A3B4G3K4_BCL2-01      H------------------------KLSKRGF---VWGF-----------
A0A2U9BJ09_BCL2-01      H------------------------KLSKRGY---VWGF-----------
A0A3Q1I5N1_BCL2-01      H------------------------KLSKRGY---AWGF-----------
A0A3Q3K1K1_BCL2-01      H------------------------KLSKRGY---VWGF-----------
A0A3Q3MEY1_BCL2-01      H------------------------KLSKRGY---VWGF-----------
A0A1X9JZA1_BCL2-01      H------------------------KLSKQGY---EWGF-----------
A0A4D6FTA2_BCL2-01      H------------------------KLSKQGY---VWGF-----------
A0A3Q1FLK7_BCL2-01      H------------------------KLSKRGY---VWGF-----------
A0A3Q1B8C3_BCL2-01      H------------------------KLSKRGY---VWGF-----------
A0A3P8S9L3_BCL2-01      H------------------------KLSKRGY---VWGF-----------
A0A3B5BBQ0_BCL2-01      H------------------------KLSKRGY---AWGF-----------
A0A3B4TX71_BCL2-01      H------------------------KLSKQGY---VWGF-----------
A0A3B4YAG2_BCL2-01      H------------------------KLSKRGY---VWGF-----------
G1TW27_BCL2-02          Y------------------------KLSQRGY---EWDA-----------
E2RS00_BCL2A1-02        -------------------------RLPAVGF-MFLWPT-----------
A0A3B3TCS4_BCL2-01      H------------------------KLLKTGY---VWEF-----------
A0A0U3DHY6_BCL2-01      N------------------------KLLKKGF---VWEF-----------
A0A3P9AAB2_BCL2-01      D------------------------KLLKNGF---VWEF-----------
X4ZGI8_BCL2-01          H------------------------KLSKKGY---EWKF-----------
A0A3P9MKK4_BCL2L1-      Y------------------------KMSCRDYPVSLLKP-----------
A0A3B3I2Q5_BCL2L1-      Y------------------------KMSCRDYPVSLLKP-----------
A0A3P9I2N4_BCL2L1-      Y------------------------KMSCRDYPVSLLKP-----------
A0A3B4AFB7_MCL1-01      N------------------------ELLNKNTREEDYEN-----------
G3TVG9_MCL1-01          C----------------------------------TSPP-----------
B9ZYL7_BCL2-01          Y------------------------KLSQKGY---AWEE-----------
A0A3L7HT14_BCL2A1-      Y------------------------VLKVPTF------------------
F6YNL8_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A218UQA0_BCL2-01      Y------------------------KLSQRGY---DWAA-----------
Q00709_BCL2-01          Y------------------------KLSQRGY---DWAA-----------
A0A493T1X3_BCL2-01      Y------------------------KLSQRGY---DWAA-----------
U3KEW4_BCL2-01          Y------------------------KLSQRGY---DWAA-----------
G3WZW9_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
M3YYK3_BCL2-01          Y------------------------KLSQRG-------------------
M3X1R9_BCL2-02          Y------------------------KLSQRGY---EWDA-----------
A0A2K6R2I5_BCL2-02      Y------------------------KLSQRGY---EWDA-----------
A0A2R9APW6_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
G3SLZ1_BCL2-01          Y------------------------KLSQRGY---EWEA-----------
Q75SV7_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
M3X1R9_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
Q8I008_BCL2-01          Y------------------------ELPQRGY---EWDA-----------
A0A076FU27_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A4P8GLJ2_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
F6R2C4_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
O02718_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A076FZV9_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A452EV13_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A250YD83_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A9QXG9_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A2K5NZS5_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A0D9S017_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K6CIX3_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K5XRD4_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K6KHG1_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K6R2I5_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K5HK49_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
G3QES9_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
H2QEM8_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A2I3GZF9_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K6UEL3_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      -------------------------------------MP-----------
A0A452R110_BCL2-02      P------------------------PAAPAAA---A--------------
G3WZW9_BCL2-02          Y------------------------KLSQRGY---D--------------
G3SLZ1_BCL2-02          Y------------------------KLSQRGY---EWEA-----------
A0A452T603_BCL2-01      Y------------------------KLSQRGY---D--------------
M3Y8D1_BCL2L10-01       Y--------------------------CARG-------------------
A0A3Q2Y539_MCL1-01      VGLVDAL------------------MLPPKAVVQGSMAS-----------
A0A3Q3BEB7_BCL2L1-      Y------------------------KLSQRNCSKSLLMP-----------
A0A3P8VMA1_BCL2L1-      Y------------------------KLSQRNYPESLLML-----------
A0A345BSW9_BCL2L1-      Y------------------------KLSQRNYPCNHIGL-----------
A0A286MU87_BCL2L1-      Y------------------------RLSQRNYSCCQLGL-----------
A0A3P8XFS0_BCL2L1-      Y------------------------KLSQRNYSCCELEL-----------
A0A3P8XFS0_BCL2L1-      Y------------------------KLSQRNYSCCELEL-----------
A0A0F7L1T6_BCL2L1-      Y------------------------KLSQRNYPSSLLRP-----------
H2U5I3_BCL2L1-01        Y------------------------KLSQRNYPTSLLRP-----------
A0A3Q3J5K3_BCL2L1-      Y------------------------KLSQRNYSTSLLRP-----------
A0A3Q1EVP6_BCL2L1-      Y------------------------KLSQRNYPMSLLRP-----------
A0A3Q1BQA0_BCL2L1-      D------------------------KLSQRNYPTSLLRP-----------
A0A3P8U812_BCL2L1-      Y------------------------KLSQRNYPTSLLRP-----------
E6ZFR0_BCL2L1-01        Y------------------------KLSQRNHPTSLLRP-----------
G3P7B4_BCL2L1-01        Y------------------------KLSQKNHPTSLLRP-----------
A0A3Q3X5M5_BCL2L1-      Y------------------------KLTQKNYPTSLLRP-----------
A0A2U9BIG9_BCL2L1-      Y------------------------KLSQRNYPTSLLRP-----------
D2ITA2_BCL2L1-02        H------------------------KLSQRNYRPIPFQP-----------
A0A3B3ZMX9_BCL2L1-      Y------------------------KLSQRDC---PLQH-----------
G3NJY1_BCL2L1-01        Y------------------------KLSQRNL---PLNH-----------
A0A2U9BY16_BCL2L1-      FGFHPQSLLWISADHGCLNRGKQGDSLAQRAF---TLT------------
A0A3Q3DUT7_BCL2L1-      Y------------------------KLSQKNY---PLNH-----------
A0A3Q3DUT7_BCL2L1-      Y------------------------KLSQKNY---PLNH-----------
A0A3Q3DUT7_BCL2L1-      Y------------------------KLSQKNY---PLNH-----------
A0A3B1JJ42_BCL2L1-      Y------------------------KLSQRNY---PTNH-----------
A0A3P8UWG7_BCL2L1-      Y------------------------KLSQRNF---PVHH-----------
A0A3Q3IVF5_BCL2L1-      Y------------------------KLSQKNY---PLSH-----------
A0A3Q1DHJ3_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3Q1DHJ3_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3Q1DHJ3_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3P8TL99_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3P8TL99_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3Q1FR00_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3B4Z3X2_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3B4Z3X2_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
C3VIT1_BCL2L1-01        Y------------------------KLSQRNY---PLNH-----------
A0A3P8P0F1_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3Q2X557_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3P9D632_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3P9D632_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3Q4N4B5_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3B4FNX1_BCL2L1-      Y------------------------KLSQRNY---PLNH-----------
A0A3Q2QPL9_BCL2L1-      F------------------------KLSQRNY---PVNH-----------
A0A3B5PQJ0_BCL2L1-      F------------------------KLSQRNY---PIQH-----------
A0A087X9B7_BCL2L1-      F------------------------KLSQRNY---PIQH-----------
A0A3B3TUS7_BCL2L1-      F------------------------KLSQRNY---PIQH-----------
A0A3B3WI27_BCL2L1-      F------------------------KLSQRNY---PIQH-----------
A0A3P9N9Y4_BCL2L1-      F------------------------KLSQRNY---PIQH-----------
A0A3B3QRZ2_BCL2L1-      Y------------------------KLSQRNY---N--------------
Q564A4_BCL2-01          H------------------------KLSKRGY---VWKC-----------
H9GPE7_BCL2-01          Y------------------------KLSQKGY---DWVA-----------
A0A452I9V7_BCL2-01      Y------------------------KLSQRGY---DWAA-----------
W5N4F7_BCL2-01          H------------------------KLLKKGY---VWES-----------
K7F5Y3_BCL2-02          Y------------------------KLSQRGY---DWAA-----------
A0A3Q2HRY3_BCL2-02      Y------------------------KLSQRGY---EWDA-----------
K7F5Y3_BCL2-01          Y------------------------KLSQRGY---DWAA-----------
F1LNV0_BCL2-01          Y------------------------KLSQRGY---EWDT-----------
P49950_BCL2-01          Y------------------------KLSQRGY---EWDT-----------
G1TW27_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A2K5EB04_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2R8MY14_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
H2NWH5_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A096MPU7_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
A0A2K5PP81_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
H0WKI0_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A2K5UDI5_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
P10417_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
Q7TSN8_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
A0A3Q2HRY3_BCL2-01      Y------------------------KLSQRGY---EWDA-----------
E2QWA1_BCL2-02          Y------------------------KLSQRGY---EWDA-----------
A0A2K6G3I7_BCL2-01      Y------------------------KLAQRGY---EWDA-----------
Q6R755_BCL2-01          Y------------------------KLSQRGY---EWDV-----------
Q9JJV8_BCL2-01          Y------------------------KLSQRGY---EWDV-----------
Q923R6_BCL2-01          Y------------------------KLSQRGY---EWDV-----------
H0W1T3_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
G1LIC9_BCL2-02          Y------------------------KLSQRGY---EWDA-----------
I3MVK9_BCL2-01          Y------------------------KLSQRGY---EWDA-----------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q1FR00_BCL2L1-      VELDSFLCAPSDRRTGDSVTERRTASRESRAFVSVLAGPELVCQPCVGLV
F6VJQ0_BCL2L10-01       CRREGVQELPAPT-------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          ---------MGGSL------------------------------------
G1PZ39_MCL1-01          --------------------------------------------------
Q95KR3_MCL1-01          PGSG----------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          AG--GGSP-AGTRLAA--EEAKARRE-GGGEA------------------
A5PJR2_MCL1-01          QGS-GASS-PGGRLLAAGKEATARREVGGGEAGTVIGGSAG---------
A0A452GA25_MCL1-01      QGS-GASS-PGGRLLAAGKEATARREVGGGEAGTVIGGSAG---------
G1L3L7_MCL1-01          AGSGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG---------
G1T2Q0_MCL1-01          AGGGGVAP-PAERLLAAEKEAAARLEVGGGEAGAVIGGSPG---------
F7AVA6_MCL1-01          AGGGGASS-PGGRLLAAGKEATARREGGGGEAGAVIGGSAG---------
A0A337S3J9_MCL1-01      AGSGGASS-SGGRLVAVGKEATARREVGGGEAGAVIGGSAG---------
A0A337S3J9_MCL1-03      AGSGGASS-SGGRLVAVGKEATARREVGGGEAGAVIGGSAG---------
Q7YRZ9_MCL1-01          AGSGGASS-SGGRLVAVGKEATARREVGGGEAGAVIGGSAG---------
F1PAP1_MCL1-01          AGSGGASS-SGGRLLASGKEATTRREGGGGEAGAVIGGSAG---------
Q8HYS5_MCL1-01          AGSGGASS-SGGRLLASGREATTRREGGGGEAGAVIGGSAG---------
M3XZZ5_MCL1-01          AGTGGASS-SGGRLLASGKEATARREVGGGEAGAVIGGSAG---------
A0A452RHX5_MCL1-01      AGSGGAAS-SGGRLLASGKEATARREVGGGEAGAVIGGSAG---------
H0XFB7_MCL1-01          AGSGGATP-PGGRLLAAEKEAAARREAGGGEAGEVIGGSPG---------
F7GTF7_MCL1-01          AGSGGATP-PGGRLLATEKEASAQREVGGGEAGAVTGGSAG---------
A0A2K5CFH3_MCL1-01      AGSGGATP-PGGRLLATEKEASAQREVGGGEAGAVIGGSAG---------
A0A2K6V5Y3_MCL1-01      AGSGGATP-PGGRLLAAEKEASAQREVGGGEAGAVIGGSAG---------
A0A2K6KRW9_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGESAG---------
A0A2K5XSB2_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
A0A0D9RZP5_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
I7G687_MCL1-01          AGSSGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
A0A2K5LXU8_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
A0A2I3GJZ3_MCL1-02      AGSGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------
H2N5Y9_MCL1-01          AGSGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------
A0A2R9BPJ5_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------
A0A2I3RTV4_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------
A0A2I2YQH7_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------
A0A2K5C7L5_MCL1-01      TGSGGTTP-PGGRLLATEKEASAQREVGGGEAGVVIGGSAG---------
A0A2K5I9I0_MCL1-02      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
A0A2K6GI15_MCL1-01      AGSSGATP-PGGRLLAAEKEATARREVGGGEDGTVIGGSPG---------
A0A2I3GJZ3_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGAVIGGSAG---------
A0A2K5CFH3_MCL1-03      AGSGGATP-PGGRLLATEKEASAQREVGGGEAGAVIGGSAG---------
A0A2K5R5E2_MCL1-03      AGSGGATP-PGGRLLATEKEASAQREVGGGEAGAVIGGSVG---------
A0A2K5W0W9_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
A0A2K6ECR0_MCL1-02      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGSAG---------
A0A2I3LFM0_MCL1-01      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGGTAG---------
A0A2K6KRW9_MCL1-02      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGESAG---------
A0A2K6PPI3_MCL1-02      AGSGGATP-PGGRLLATEKEASARREIGGGEAGTVIGESAG---------
G3WBC5_MCL1-01          --------------------------------------------------
W5QI41_MCL1-01          --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
A0A2K5DMS4_MCL1-01      -----GAIPPGPRLL-----------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        TNVSIGKERKKDWRFSLFLPGRLADPEGTAGWGWQQNPQDLPAQRFRKVN
B6V6J0_MCL1-01          ---EKTLSARGASPW-----------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K6TM77_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K5RUN8_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K6GWM6_BCL2L2-      ---------PAADPL-----------------------------------
W5QDH4_BCL2L2-01        ---------PAADPL-----------------------------------
A0A2K6ME72_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K6RW35_BCL2L2-      ---------PAADPL-----------------------------------
A0A287ATE4_BCL2L2-      ---------PAADPL-----------------------------------
A0A2R8M4C0_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K5MZX9_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K5HEJ9_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K5V0Q3_BCL2L2-      ---------PAADPL-----------------------------------
F7G4L5_BCL2L2-02        ---------PAADPL-----------------------------------
A0A2K6EA59_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K6AI25_BCL2L2-      ---------PAADPL-----------------------------------
A0A1U7RC37_BCL2L2-      ---------PAADPL-----------------------------------
A0A2I3GEA7_BCL2L2-      ---------PAADPL-----------------------------------
A0A2R9A2Q3_BCL2L2-      ---------PAADPL-----------------------------------
H2Q805_BCL2L2-02        ---------PAADPL-----------------------------------
A0A096NX09_BCL2L2-      ---------PAADPL-----------------------------------
A0A287ATE4_BCL2L2-      ---------PAADPL-----------------------------------
A0A4D6NWN1_BCL2L2-      ---------PAADPL-----------------------------------
A0A1U7UJF2_BCL2L2-      ---------PAADPL-----------------------------------
A0A452UF16_BCL2L2-      ---------PAADPL-----------------------------------
A0A452UF16_BCL2L2-      ---------PAADPL-----------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          LQEGGPCPQESG------------------------AGRETGTVIGWSAG
H9GEA6_MCL1-01          ESSGGNNNDGGGVSV-----------------------------------
H9GEA6_MCL1-02          ESSGGNNNDGGGVSV-----------------------------------
A0A493U0E8_MCL1-01      TESWRNTSWPSKGPARSDHLGSV---------------LWKSEASSQGPA
A0A1L1RNM6_MCL1-01      LVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAP-
A0A1L1RNM6_MCL1-02      LVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAP-
G2HFR3_MCL1-01          -----PPPECTIHML-----------------------------------
F6ZMX1_MCL1-01          AGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIR
F6ZMX1_MCL1-02          AGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIR
F6ZMX1_MCL1-03          AGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIR
G1T2Q0_MCL1-02          AGGGGVAP-PAERLL-----------------------------------
F1PAP1_MCL1-02          AGSGGASS-SGGRLL-----------------------------------
A0A337S3J9_MCL1-04      AGSGGASS-SGGRLV-----------------------------------
F7AVA6_MCL1-02          AGGGGASS-PGGRLL-----------------------------------
A0A2K6GI15_MCL1-03      AGSSGATP-PGGRLL-----------------------------------
C8YZ26_MCL1-01          AGSGGATR-PGGRLL-----------------------------------
F7GTF7_MCL1-02          AGSGGATP-PGGRLL-----------------------------------
A0A2K5R5E2_MCL1-04      AGSGGATP-PGGRLL-----------------------------------
A0A2K6V5Y3_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2K5LXU8_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2K5I9I0_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2I2YQH7_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
Q07820_MCL1-04          AGSGGATR-PGGRLL-----------------------------------
A0A2K5W0W9_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2K6ECR0_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2K5XSB2_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2R9BPJ5_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2I3RTV4_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2I3LFM0_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A2K6PPI3_MCL1-03      AGSGGATP-PGGRLL-----------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          AGGGSPA---GARLVA--EEAKARREGGGE--------------------
A0A452GA25_MCL1-02      QGSGASSP--GGRLLAAGKEATAR---------------AG---------
G3T756_MCL1-01          A--GGCATPPGGRLPAPGKEATARQEVGGGD--------AG---------
A0A1S3F3I1_MCL1-01      AGSGAAAA-PGGRLL-TAEEASARREAGGGEAGAGIGGSAG---------
G1L3L7_MCL1-02          AGSGGGXS--GGRLLASGKEATARREIGGGEAGAVIGGSAG---------
A0A287BK44_MCL1-02      PGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG---------
A0A287BK44_MCL1-01      PGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAG---------
B4DU51_MCL1-01          AGSGG---------------------------------------------
A0A287DCH9_MCL1-02      --------------------------------------------------
A0A287DCH9_MCL1-01      ASGGATPP--GAQLLAAEKEAAARREAGGGE-------------------
W5MMB7_MCL1-01          --------------------------------------------------
A0A3B3SG34_MCL1-01      --------------------------------------------------
Q4SW32_MCL1-01          --------------------------------------------------
Q0KFR9_MCL1-01          --------------------------------------------------
A0A3P8Y1W8_MCL1-02      --------------------------------------------------
A0A3P8Y1W8_MCL1-01      --------------------------------------------------
D2ITA0_MCL1-03          --------------------------------------------------
D2ITA0_MCL1-04          --------------------------------------------------
A0A3P9ILF6_MCL1-02      --------------------------------------------------
A0A3P9ILF6_MCL1-01      --------------------------------------------------
A0A3Q2XZL8_MCL1-01      --------------------------------------------------
A0A3B4AFB7_MCL1-02      --------------------------------------------------
A0A3B3VM25_MCL1-01      --------------------------------------------------
I3KXG5_MCL1-01          --------------------------------------------------
A0A3Q0R633_MCL1-01      --------------------------------------------------
A0A3Q0R633_MCL1-03      --------------------------------------------------
A0A3B4T8L9_MCL1-02      --------------------------------------------------
A0A3B4T8L9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      --------------------------------------------------
A0A3B4ZKP6_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-02      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1BKL8_MCL1-01      --------------------------------------------------
A0A3P8RQX7_MCL1-02      --------------------------------------------------
A0A3P8RQX7_MCL1-01      --------------------------------------------------
G3PJT0_MCL1-01          --------------------------------------------------
A0A3B3IJ04_MCL1-01      --------------------------------------------------
A0A3P9L1F3_MCL1-01      --------------------------------------------------
A0A3B3IJ04_MCL1-02      --------------------------------------------------
A0A3P9L1F3_MCL1-02      --------------------------------------------------
A0A3B3CEX1_MCL1-01      --------------------------------------------------
A0A3B3CEX1_MCL1-02      --------------------------------------------------
A0A3Q3VP02_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-01      --------------------------------------------------
A0A3Q3B4P5_MCL1-02      --------------------------------------------------
A0A3Q2EDX8_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-01      --------------------------------------------------
A0A3Q2P7X9_MCL1-02      --------------------------------------------------
A0A3B5PQ55_MCL1-01      --------------------------------------------------
A0A3B5PQ55_MCL1-02      --------------------------------------------------
A0A3P9Q4I8_MCL1-01      --------------------------------------------------
A0A3P9Q4I8_MCL1-02      --------------------------------------------------
A0A087X830_MCL1-01      --------------------------------------------------
A0A3B3YCD0_MCL1-01      --------------------------------------------------
I3JHR5_MCL1-02          --------------------------------------------------
I3JHR5_MCL1-03          --------------------------------------------------
I3JHR5_MCL1-01          --------------------------------------------------
A0A3Q4HLQ8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-02      --------------------------------------------------
A0A3Q2VNL8_MCL1-01      --------------------------------------------------
A0A3P8NP63_MCL1-01      --------------------------------------------------
A0A3P9BVM3_MCL1-01      --------------------------------------------------
A0A3B4G4Z6_MCL1-01      --------------------------------------------------
A0A2U9CJ81_MCL1-01      --------------------------------------------------
A0A3P8VKM5_MCL1-03      --------------------------------------------------
A0A3P8VKM5_MCL1-04      --------------------------------------------------
A0A3P8VKM5_MCL1-05      --------------------------------------------------
A0A3Q3IZW0_MCL1-01      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A3B4XKA5_MCL1-01      --------------------------------------------------
A0A3Q3GP42_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-01      --------------------------------------------------
A0A3Q3M6G2_MCL1-02      --------------------------------------------------
A0A3B1IEV7_MCL1-01      --------------------------------------------------
A0A3B4CGU9_MCL1-03      --------------------------------------------------
A0A3B4CGU9_MCL1-02      --------------------------------------------------
Q8UWD6_MCL1-01          --------------------------------------------------
A2BF68_MCL1-01          --------------------------------------------------
Q568W5_MCL1-01          --------------------------------------------------
A0A3B1K5R1_MCL1-01      --------------------------------------------------
A0A3B4C6H5_MCL1-03      --------------------------------------------------
A0A3B4C6H5_MCL1-01      --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------------------
Q91828_BCL2L1-01        --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
H9GHK7_BCL2L1-01        --------------------------------------------------
Q07816_BCL2L1-04        --------------------------------------------------
A0A493TIA6_BCL2L1-      --------------------------------------------------
Q07816_BCL2L1-02        --------------------------------------------------
Q07816_BCL2L1-03        --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
G1N5N5_BCL2L1-01        --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
A0A452ILL8_BCL2L1-      --------------------------------------------------
K7F655_BCL2L1-01        --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
W5PSA5_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-03        --------------------------------------------------
P53563_BCL2L1-02        --------------------------------------------------
A0A287CZ07_BCL2L1-      --------------------------------------------------
F6WA14_BCL2L1-01        --------------------------------------------------
G3WKX6_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
H0X6V2_BCL2L1-01        --------------------------------------------------
G3SPN0_BCL2L1-01        --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A1S2ZQT6_BCL2L1-      --------------------------------------------------
Q64373_BCL2L1-09        --------------------------------------------------
Q64373_BCL2L1-01        --------------------------------------------------
P53563_BCL2L1-01        --------------------------------------------------
O77737_BCL2L1-01        --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
L8J061_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
E2IV76_BCL2L1-01        --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
M3Z2H9_BCL2L1-01        --------------------------------------------------
A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A0D9RJZ8_BCL2L1-      --------------------------------------------------
A0A286Y5D6_BCL2L1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A1L5BWY3_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
G1P9D2_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
E2IV75_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
E2IV77_BCL2L1-01        --------------------------------------------------
A0A452SDS4_BCL2L1-      --------------------------------------------------
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
Q9MZS7_BCL2L1-01        --------------------------------------------------
A0A3B3E2W4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B5B4X7_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
A0A3Q3FUB6_BCL2L1-      --------------------------------------------------
A0A3B5MGS2_BCL2L1-      --------------------------------------------------
M4A558_BCL2L1-01        --------------------------------------------------
A0A3P9QFB3_BCL2L1-      --------------------------------------------------
A0A087YBW4_BCL2L1-      --------------------------------------------------
A0A3B3VWI7_BCL2L1-      --------------------------------------------------
A0A3B3XN57_BCL2L1-      --------------------------------------------------
A0A3Q2C6K4_BCL2L1-      --------------------------------------------------
A0A3Q2NRP4_BCL2L1-      --------------------------------------------------
A0A0B4KJI5_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A3B4V9K8_BCL2L1-      --------------------------------------------------
A0A3B4XS24_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
C1BLI0_BCL2L1-01        --------------------------------------------------
C0HAD8_BCL2L1-01        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
A0A3B3TFR4_BCL2L1-      --------------------------------------------------
H3CH49_BCL2L1-01        --------------------------------------------------
A0A3Q2FR43_BCL2L1-      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
Q90Z98_BCL2L1-02        --------------------------------------------------
Q90Z98_BCL2L1-01        --------------------------------------------------
A0A059PJI5_BCL2L1-      --------------------------------------------------
A0A3B4DTL9_BCL2L1-      --------------------------------------------------
B5XAY3_BCL2L1-01        --------------------------------------------------
W5MG74_BCL2L1-01        --------------------------------------------------
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3B3IB64_BCL2L1-      --------------------------------------------------
A0A3P9JYH1_BCL2L1-      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      --------------------------------------------------
A0A3Q0RTF8_BCL2L1-      --------------------------------------------------
I3IZK7_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A0D6DR75_BCL2L1-      --------------------------------------------------
A0A3Q3WIW8_BCL2L1-      --------------------------------------------------
A0A219P0Y3_BCL2L1-      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q3G2E1_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3B4V3T1_BCL2L1-      --------------------------------------------------
A0A3B4XU17_BCL2L1-      --------------------------------------------------
H3ANS8_BCL2L1-01        --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A452FHY1_BCL2L1-      --------------------------------------------------
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
U3JSL7_BCL2L1-01        --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
A0A218USB3_BCL2L1-      --------------------------------------------------
H0Z8G3_BCL2L1-01        --------------------------------------------------
Q4U2V6_BCL2L1-01        --------------------------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q568V1_MCL1-01          --------------------------------------------------
Q1L8X3_MCL1-01          --------------------------------------------------
Q9I9N3_MCL1-01          --------------------------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          --------------------------------------------------
E2RS00_BCL2A1-02        --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B4AFB7_MCL1-01      --------------------------------------------------
G3TVG9_MCL1-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
A0A3P8VMA1_BCL2L1-      --------------------------------------------------
A0A345BSW9_BCL2L1-      --------------------------------------------------
A0A286MU87_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A0F7L1T6_BCL2L1-      --------------------------------------------------
H2U5I3_BCL2L1-01        --------------------------------------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        --------------------------------------------------
G3P7B4_BCL2L1-01        --------------------------------------------------
A0A3Q3X5M5_BCL2L1-      --------------------------------------------------
A0A2U9BIG9_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      --------------------------------------------------
G3NJY1_BCL2L1-01        --------------------------------------------------
A0A2U9BY16_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3Q3DUT7_BCL2L1-      --------------------------------------------------
A0A3B1JJ42_BCL2L1-      --------------------------------------------------
A0A3P8UWG7_BCL2L1-      --------------------------------------------------
A0A3Q3IVF5_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3Q1DHJ3_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3P8TL99_BCL2L1-      --------------------------------------------------
A0A3Q1FR00_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
A0A3B4Z3X2_BCL2L1-      --------------------------------------------------
C3VIT1_BCL2L1-01        --------------------------------------------------
A0A3P8P0F1_BCL2L1-      --------------------------------------------------
A0A3Q2X557_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3P9D632_BCL2L1-      --------------------------------------------------
A0A3Q4N4B5_BCL2L1-      --------------------------------------------------
A0A3B4FNX1_BCL2L1-      --------------------------------------------------
A0A3Q2QPL9_BCL2L1-      --------------------------------------------------
A0A3B5PQJ0_BCL2L1-      --------------------------------------------------
A0A087X9B7_BCL2L1-      --------------------------------------------------
A0A3B3TUS7_BCL2L1-      --------------------------------------------------
A0A3B3WI27_BCL2L1-      --------------------------------------------------
A0A3P9N9Y4_BCL2L1-      --------------------------------------------------
A0A3B3QRZ2_BCL2L1-      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q1FR00_BCL2L1-      FTPERPVDISGPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNM
F6VJQ0_BCL2L10-01       --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          --------------------------------------------------
G1PZ39_MCL1-01          --------------APPSPISGRGPRRHRDPSRGGCLRPLAVRGCPRRWK
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          -----ALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPPEEMA
A5PJR2_MCL1-01          PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEME
A0A452GA25_MCL1-01      PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEME
G1L3L7_MCL1-01          ASPPX---------------GAEGPDVTATPPRLLFLEPTRRASPPEEME
G1T2Q0_MCL1-01          ASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRRASPLEEME
F7AVA6_MCL1-01          GSPQTTLAPDSLRVARPSPIGAEGPDVTAPSSRLLFFAPTRCASPPEGME
A0A337S3J9_MCL1-01      ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKME
A0A337S3J9_MCL1-03      ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKME
Q7YRZ9_MCL1-01          ASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEEME
F1PAP1_MCL1-01          ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEME
Q8HYS5_MCL1-01          ASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEME
M3XZZ5_MCL1-01          ASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTHRASPPEEME
A0A452RHX5_MCL1-01      ASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRRASPPEEME
H0XFB7_MCL1-01          ASSPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFAPTLRAAPREEME
F7GTF7_MCL1-01          ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEME
A0A2K5CFH3_MCL1-01      ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEME
A0A2K6V5Y3_MCL1-01      ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEME
A0A2K6KRW9_MCL1-01      ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPLEEME
A0A2K5XSB2_MCL1-01      ASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEME
A0A0D9RZP5_MCL1-01      ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEME
I7G687_MCL1-01          ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAAPLEEME
A0A2K5LXU8_MCL1-01      ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEME
A0A2I3GJZ3_MCL1-02      ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAPLEEME
H2N5Y9_MCL1-01          ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEME
A0A2R9BPJ5_MCL1-01      ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEME
A0A2I3RTV4_MCL1-01      ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEME
A0A2I2YQH7_MCL1-01      ASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEME
A0A2K5C7L5_MCL1-01      ASPSAALTPDAR----------------GSCGRCWFFAPTRRAAPLEEME
A0A2K5I9I0_MCL1-02      ASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEME
A0A2K6GI15_MCL1-01      ASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFAPTRRALPSEEME
A0A2I3GJZ3_MCL1-01      ASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFAPTRRAAPLEEME
A0A2K5CFH3_MCL1-03      ASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEME
A0A2K5R5E2_MCL1-03      ASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEME
A0A2K5W0W9_MCL1-01      ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGPLEEME
A0A2K6ECR0_MCL1-02      ASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRAGPLEEME
A0A2I3LFM0_MCL1-01      ASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAPLEEME
A0A2K6KRW9_MCL1-02      ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPLEEME
A0A2K6PPI3_MCL1-02      ASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFAPTRRAAPLEEME
G3WBC5_MCL1-01          --------------------------DVTAPPRPFFFAPGGRCSPPAEVA
W5QI41_MCL1-01          -------------------------------------------GSRKPRP
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          -----------------------------MFGLKRNAVIGLNLYCGGAGL
B4DG83_MCL1-01          ------------------------------------------------ME
B4E3L8_MCL1-01          ------------------------------------------------ME
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        TQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPWESGRSKPTP
B6V6J0_MCL1-01          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------LPDQME
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          ASPQATLARDPGRVARPSPMGTEGPDGTAAPARWLFSPISRNC--PEELG
H9GEA6_MCL1-01          PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQP
H9GEA6_MCL1-02          PKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQP
A0A493U0E8_MCL1-01      RIDHFGSVPWNSEASPRGVVGTAHFGSVLWN------------------S
A0A1L1RNM6_MCL1-01      ------RAPIGSGAAPHAPIGSAAARRAPPD------------------S
A0A1L1RNM6_MCL1-02      ------RAPIGSGAAPHAPIGSAAARRAPPD------------------S
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          ASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAPAEVA
F6ZMX1_MCL1-02          ASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAPAEVA
F6ZMX1_MCL1-03          ASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLF-APGRCSSAPAEVA
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      --------------------------------------------------
P97287_MCL1-01          ----AALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMA
A0A452GA25_MCL1-02      PSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEME
G3T756_MCL1-01          ASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASPPVEME
A0A1S3F3I1_MCL1-01      ASPSTTLAPDARRVARPAPIGAEVPDVTGTPTKRVFFAPTHRAPTPDEME
G1L3L7_MCL1-02          ASPPAXXX--XXXXXXXXXXGAEGPDVTATPPRLLFLEPTRRASPPEEME
A0A287BK44_MCL1-02      ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEME
A0A287BK44_MCL1-01      ASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFFAPTRLASPPEEME
B4DU51_MCL1-01          ---------------------------ATRPGGRLL---------ATEME
A0A287DCH9_MCL1-02      --------------------GAEVPDVTATPARRLFFAPTYCVSPPEKME
A0A287DCH9_MCL1-01      ----AAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSPPEKME
W5MMB7_MCL1-01          ------------------------------ASLGPCPGGSAARTAVLDPM
A0A3B3SG34_MCL1-01      --------------------------------LDSSARAANTPCLESSGL
Q4SW32_MCL1-01          -------------------------------------ADLSSSQIPMGSP
Q0KFR9_MCL1-01          ------------------------------PLYYFQGAGAICAGASPKSK
A0A3P8Y1W8_MCL1-02      ------------------------------PLCYFSPTGPLCPAASSKSK
A0A3P8Y1W8_MCL1-01      ------------------------------PLCYFSPTGPLCPAASSKSK
D2ITA0_MCL1-03          -------------------------------------SEGSHTTTEGALP
D2ITA0_MCL1-04          -------------------------------------SEGSHTTTEGALP
A0A3P9ILF6_MCL1-02      -------------------------------------AGEMSARVPLPST
A0A3P9ILF6_MCL1-01      -------------------------------------AGEMSARVPLPST
A0A3Q2XZL8_MCL1-01      -------------------------------------SPPVAAASTSPPQ
A0A3B4AFB7_MCL1-02      -------------------------------------AADSSAQMPRPAT
A0A3B3VM25_MCL1-01      -------------------------------------QGLVVPEVAMGAT
I3KXG5_MCL1-01          -------------------------------------PNNDVGFIDNWET
A0A3Q0R633_MCL1-01      ------------------------------------------------TS
A0A3Q0R633_MCL1-03      -------------------------------------SGNSSPQDATGTP
A0A3B4T8L9_MCL1-02      -------------------------------------SGDSSPEIAIGST
A0A3B4T8L9_MCL1-01      -------------------------------------SGDSSPEIAIGST
A0A3Q1EQB9_MCL1-02      -------------------------------------SGDSSPQISVASS
A0A3B4ZKP6_MCL1-01      -------------------------------------SGDPSAQIPMASP
A0A3Q1BKL8_MCL1-02      -------------------------------------SGDSSPQIAVASS
A0A3Q1EQB9_MCL1-01      -------------------------------------SGDSSPQISVASS
A0A3Q1BKL8_MCL1-01      -------------------------------------SGDSSPQIAVASS
A0A3P8RQX7_MCL1-02      -------------------------------------SGDSSPQIAVASS
A0A3P8RQX7_MCL1-01      -------------------------------------SGDSSPQIAVASS
G3PJT0_MCL1-01          -----------------------------------------MRQLAMGSA
A0A3B3IJ04_MCL1-01      -------------------------------------AGEMSARVPLPST
A0A3P9L1F3_MCL1-01      -------------------------------------AGEMSARVPLPST
A0A3B3IJ04_MCL1-02      -------------------------------------AGEMSARVPLPST
A0A3P9L1F3_MCL1-02      -------------------------------------AGEMSARVPLPST
A0A3B3CEX1_MCL1-01      -------------------------------------AGERSARVPLTSA
A0A3B3CEX1_MCL1-02      -------------------------------------AGERSARVPLTSA
A0A3Q3VP02_MCL1-01      -----------------------------------------SSQIGMGSC
A0A3Q3B4P5_MCL1-01      ---------------------------------------DTSPQVSIGAS
A0A3Q3B4P5_MCL1-02      ---------------------------------------DTSPQVSIGAS
A0A3Q2EDX8_MCL1-01      -------------------------------------PEIAAPEIPMNSP
A0A3Q2P7X9_MCL1-01      -------------------------------------PGLQLPEVEMSSS
A0A3Q2P7X9_MCL1-02      -------------------------------------PGLQLPEVEMSSS
A0A3B5PQ55_MCL1-01      -------------------------------------QGLGVPEVAMGST
A0A3B5PQ55_MCL1-02      -------------------------------------QGLGVPEVAMGST
A0A3P9Q4I8_MCL1-01      -------------------------------------QGLVVPEVAMGSR
A0A3P9Q4I8_MCL1-02      -------------------------------------QGLVVPEVAMGSR
A0A087X830_MCL1-01      -------------------------------------QGLVVPEVAMGAT
A0A3B3YCD0_MCL1-01      -------------------------------------QGLVVPEVAMGAT
I3JHR5_MCL1-02          -------------------------------------SGKSSPQNATGSS
I3JHR5_MCL1-03          -------------------------------------SGKSSPQNATGSS
I3JHR5_MCL1-01          -------------------------------------SGKSSPQNATGSS
A0A3Q4HLQ8_MCL1-01      -------------------------------------SGNSSPQNATGSS
A0A3P8NP63_MCL1-02      -------------------------------------SGNSSPQNATGSS
A0A3Q2VNL8_MCL1-01      -------------------------------------SGNSSPQNATGSS
A0A3P8NP63_MCL1-01      -------------------------------------SGNSSPQNATGSS
A0A3P9BVM3_MCL1-01      -------------------------------------SGNSSPQNATGSS
A0A3B4G4Z6_MCL1-01      -------------------------------------SGNSSPQNATGSS
A0A2U9CJ81_MCL1-01      -------------------------------------SGNSLPQIAVGSV
A0A3P8VKM5_MCL1-03      -------------------------------------TGNSTP-IALASS
A0A3P8VKM5_MCL1-04      -------------------------------------TGNSTP-IALASS
A0A3P8VKM5_MCL1-05      -------------------------------------TGNSTP-IALASS
A0A3Q3IZW0_MCL1-01      -------------------------------------S-NTSPQFAVGSS
A0A3Q1GX28_MCL1-02      -------------------------------------SGVNSPQITMSSS
A0A3Q1GX28_MCL1-01      -------------------------------------SGVNSPQITMSSS
A0A3B4XKA5_MCL1-01      -------------------------------------SGDSSPEIAIGST
A0A3Q3GP42_MCL1-01      -------------------------------------PEASSPQIAMGSS
A0A3Q3M6G2_MCL1-01      -------------------------------------SRDPSTQF----T
A0A3Q3M6G2_MCL1-02      -------------------------------------SRDPSTQF----T
A0A3B1IEV7_MCL1-01      -------------------------------------KEEKLPRTERPER
A0A3B4CGU9_MCL1-03      -------------------------------------SESQLDRPDRPDR
A0A3B4CGU9_MCL1-02      -------------------------------------PGGSICAPVLHGS
Q8UWD6_MCL1-01          -------------------------------------DNGFWPC------
A2BF68_MCL1-01          -------------------------------------DNGFWPC------
Q568W5_MCL1-01          -------------------------------------DNGFWPC------
A0A3B1K5R1_MCL1-01      ---------------------------------------DIVPRVAVRGG
A0A3B4C6H5_MCL1-03      -------------------------------------FPSLLAKRPFTLG
A0A3B4C6H5_MCL1-01      -------------------------------------WNFLWEK------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        --------------------------------------CRKFSNNPQPNA
Q91828_BCL2L1-01        --------------------------------------CRKFSNNPNPMP
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------SWSQFS------
H9GHK7_BCL2L1-01        --------------------------------------SWHEIE-----M
Q07816_BCL2L1-04        --------------------------------------CWSELEEEDENR
A0A493TIA6_BCL2L1-      --------------------------------------SWSQLEEEDENR
Q07816_BCL2L1-02        --------------------------------------CWSELEEEDENR
Q07816_BCL2L1-03        --------------------------------------CWSELEEEDENR
Q07816_BCL2L1-01        --------------------------------------CWSELEEEDENR
G1N5N5_BCL2L1-01        --------------------------------------CWSELEEEDENR
A0A452ILL8_BCL2L1-      --------------------------------------SWSRFEGEDEIR
A0A452ILL8_BCL2L1-      --------------------------------------SWSRFEGEDEIR
K7F655_BCL2L1-01        --------------------------------------SWSWFEGEDEIR
A0A452E1B1_BCL2L1-      --------------------------------------SWSQFSDMEENR
W5PSA5_BCL2L1-01        --------------------------------------SWSQFSDMEENR
P53563_BCL2L1-03        --------------------------------------SWSQFSDVEENR
P53563_BCL2L1-02        --------------------------------------SWSQFSDVEENR
A0A287CZ07_BCL2L1-      --------------------------------------SWSQFSDVEENR
F6WA14_BCL2L1-01        --------------------------------------NWSQFED--ENR
G3WKX6_BCL2L1-01        --------------------------------------NWSQFED--ENR
M3XA94_BCL2L1-01        --------------------------------------SWSQFSDVEENR
M3XA94_BCL2L1-02        --------------------------------------SWSQFSDVEENR
A0A3Q2H0F6_BCL2L1-      --------------------------------------NWSQFSDVEENR
H0X6V2_BCL2L1-01        --------------------------------------SWSQFSDVEENR
G3SPN0_BCL2L1-01        --------------------------------------SWSQFSDVEENR
Q2PFS6_BCL2L1-01        --------------------------------------------------
O35843_BCL2L1-01        --------------------------------------SWSQFSDVEENR
M3XA94_BCL2L1-03        --------------------------------------SWSQFSDVEENR
G1RER8_BCL2L1-01        --------------------------------------SWSQFSDVEENR
A0A1S2ZQT6_BCL2L1-      --------------------------------------SWSQFSDVEENR
Q64373_BCL2L1-09        --------------------------------------SWSQFSDVEENR
Q64373_BCL2L1-01        --------------------------------------SWSQFSDVEENR
P53563_BCL2L1-01        --------------------------------------SWSQFSDVEENR
O77737_BCL2L1-01        --------------------------------------SWSQFTDVEENR
Q9MYW4_BCL2L1-01        --------------------------------------SWSQFSDVEENR
A0A3Q2H0F6_BCL2L1-      --------------------------------------NWSQFSDVEENR
L8J061_BCL2L1-01        --------------------------------------SWSQFSDVEENR
Q05KJ0_BCL2L1-01        --------------------------------------SWSQFSDVEENR
Q05KJ0_BCL2L1-02        --------------------------------------SWSQFSDVEENR
E2IV76_BCL2L1-01        --------------------------------------SWSQFIDAEENR
A0A2K6G3C5_BCL2L1-      --------------------------------------SWSQFIDAEENR
B2Z3Z4_BCL2L1-01        --------------------------------------SWSQFSDVEENR
G3HEA7_BCL2L1-01        --------------------------------------SWSQFSDVEENR
G3HEA7_BCL2L1-02        --------------------------------------SWSQFSDVEENR
A0A1U7T4L4_BCL2L1-      --------------------------------------SWSQFSDVEENR
M3Z2H9_BCL2L1-01        --------------------------------------SWSQFSDAEENR
A0A1U7QU73_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A0D9RJZ8_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A286Y5D6_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A250YD48_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A1L5BWY3_BCL2L1-      --------------------------------------SWSQFSDVEENR
I3MUP5_BCL2L1-02        --------------------------------------SWSQFSDVEENR
I3MUP5_BCL2L1-03        --------------------------------------SWSQFSDVEENR
I3MUP5_BCL2L1-01        --------------------------------------SWSQFSDVEENR
G1P9D2_BCL2L1-01        --------------------------------------SWSQFSDVEENR
A0A2K5EBP4_BCL2L1-      --------------------------------------SWSQFSDVEENR
E2IV75_BCL2L1-01        --------------------------------------SWSQFSDVEENR
F7IT34_BCL2L1-01        --------------------------------------SWSQFSDVEENR
Q76LT7_BCL2L1-01        --------------------------------------SWSQFSDVEENR
A0A2K5Q6R6_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K5Q6R6_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K5M8B1_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K5H963_BCL2L1-      --------------------------------------SWSQFSDVEENR
Q8SQ42_BCL2L1-01        --------------------------------------SWSRFSDVEENR
A0A2K5VPG2_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K5YR37_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2R8Z9D7_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A096NV05_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2J8VIH3_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K6QFA2_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K6QFA2_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A2K6UWY8_BCL2L1-      --------------------------------------SWSQFSDVEENR
E2IV77_BCL2L1-01        --------------------------------------SWSQFSDVEENR
A0A452SDS4_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A384D3U1_BCL2L1-      --------------------------------------SWSQFSDVEENR
A0A452FWV3_BCL2L1-      --------------------------------------SWSQFSDVEENR
Q9MZS7_BCL2L1-01        --------------------------------------SWSQFSDVEENR
A0A3B3E2W4_BCL2L1-      --------------------------------------PVSLLKPTDDGG
A0A3B3I2Q5_BCL2L1-      --------------------------------------PVSLLKPTDDGG
A0A3P9I2N4_BCL2L1-      --------------------------------------PVSLLKPTDDGG
A0A3P9MKK4_BCL2L1-      --------------------------------------PVSLLKPTDDGG
A0A3B5B4X7_BCL2L1-      --------------------------------------PTSLLRPEDAAG
A0A3B4BFZ8_BCL2L1-      --------------------------------------PSSLLMSDPARV
A0A3Q3FUB6_BCL2L1-      --------------------------------------PTYVLRSEDAGE
A0A3B5MGS2_BCL2L1-      --------------------------------------SSSLLRSEVAGG
M4A558_BCL2L1-01        --------------------------------------SSSLLRSEVAGG
A0A3P9QFB3_BCL2L1-      --------------------------------------SSSLLRSEADGA
A0A087YBW4_BCL2L1-      --------------------------------------SSSLLRSEADGA
A0A3B3VWI7_BCL2L1-      --------------------------------------SSSLLRSEADGA
A0A3B3XN57_BCL2L1-      --------------------------------------SSSLLRSEADGA
A0A3Q2C6K4_BCL2L1-      --------------------------------------PNSLLRSEVTGG
A0A3Q2NRP4_BCL2L1-      --------------------------------------PNSLLRSEVAGD
A0A0B4KJI5_BCL2L1-      --------------------------------------PTALLRPDDAGG
A0A3Q1JZ46_BCL2L1-      --------------------------------------PASLLRPDDTGG
A0A3Q1JZ46_BCL2L1-      --------------------------------------PASLLRPDDTGG
A0A3Q3NFM4_BCL2L1-      --------------------------------------PTSLLRPEDAGG
A0A3Q3NFM4_BCL2L1-      --------------------------------------PTSLLRPEDAGG
A0A3B4V9K8_BCL2L1-      --------------------------------------PTSLLRPEDAGG
A0A3B4XS24_BCL2L1-      --------------------------------------PTSLLRPEDAGG
A0A2U9BY16_BCL2L1-      --------------------------------------PLNHMGLNEPPN
C1BLI0_BCL2L1-01        --------------------------------------PISQLGLEDASE
C0HAD8_BCL2L1-01        --------------------------------------SCCQLGLEGASG
A0A3B3ZMX9_BCL2L1-      --------------------------------------PL---------G
A0A3B3TFR4_BCL2L1-      --------------------------------------SIAHIIQDEADE
H3CH49_BCL2L1-01        --------------------------------------PLSHI--VEPSS
A0A3Q2FR43_BCL2L1-      --------------------------------------PVNHIMLNEPPN
A0A3P8XYL5_BCL2L1-      --------------------------------------PINHTGLTGAFD
Q90Z98_BCL2L1-02        --------------------------------------PCNHIGLTEDTN
Q90Z98_BCL2L1-01        --------------------------------------PCNHIGLTEDTN
A0A059PJI5_BCL2L1-      --------------------------------------PCDHIGLTEEVN
A0A3B4DTL9_BCL2L1-      --------------------------------------PYNHIGLMEDTN
B5XAY3_BCL2L1-01        --------------------------------------PFNHMELTEAQN
W5MG74_BCL2L1-01        --------------------------------------SWDQFSLE---G
A0A3Q3B3X5_BCL2L1-      --------------------------------------PVNHIILSDPPN
A0A3B3IB64_BCL2L1-      --------------------------------------PLNHIVLNESPN
A0A3P9JYH1_BCL2L1-      --------------------------------------PLNHIVLNESPN
A0A3B3DHA1_BCL2L1-      --------------------------------------PLNHIVLNESPN
A0A3Q0RTF8_BCL2L1-      --------------------------------------PLNHIVLNEPSN
I3IZK7_BCL2L1-01        --------------------------------------PLNHIVLNEPLN
A0A2U9BY16_BCL2L1-      --------------------------------------PLNHMGLNEPPN
A0A2U9BY16_BCL2L1-      --------------------------------------PLNHMGLNEPPN
A0A2U9BY16_BCL2L1-      --------------------------------------PLNHMGLNEPPN
A0A0D6DR75_BCL2L1-      --------------------------------------PLNHLGLSEPPN
A0A3Q3WIW8_BCL2L1-      --------------------------------------PLNHMGLIEPPN
A0A219P0Y3_BCL2L1-      --------------------------------------PLNHMGLIEPPN
A0A3Q3MX20_BCL2L1-      --------------------------------------PLIYIELNEQQN
A0A3Q3G2E1_BCL2L1-      --------------------------------------PLNHMELLEPPN
A0A3Q3G2E1_BCL2L1-      --------------------------------------PLNHMELLEPPN
A0A3Q3G2E1_BCL2L1-      --------------------------------------PLNHMELLEPPN
A0A3Q1GZ93_BCL2L1-      --------------------------------------PLNHLGLNETPN
A0A3Q1GZ93_BCL2L1-      --------------------------------------PLNHLGLNETPN
A0A3Q1GZ93_BCL2L1-      --------------------------------------PLNHLGLNETPN
A0A3B4V3T1_BCL2L1-      --------------------------------------PLTHMELNESPN
A0A3B4XU17_BCL2L1-      --------------------------------------PLTHMELNESPN
H3ANS8_BCL2L1-01        --------------------------------------QWREVGEQDHGG
A0A452FHY1_BCL2L1-      --------------------------------------SW----------
A0A452FHY1_BCL2L1-      --------------------------------------SW----------
A0A1S3EPX7_BCL2L1-      --------------------------------------SWSQFSDVEESR
A0A218USB3_BCL2L1-      --------------------------------------SWSQLEEEDENR
A0A218USB3_BCL2L1-      --------------------------------------SWSQLEEEDENR
U3JSL7_BCL2L1-01        --------------------------------------SWSQLEEEDENR
A0A218USB3_BCL2L1-      --------------------------------------SWSQLEEEDENR
A0A218USB3_BCL2L1-      --------------------------------------SWSQLEEEDENR
H0Z8G3_BCL2L1-01        --------------------------------------SWSQLEEEDENR
Q4U2V6_BCL2L1-01        --------------------------------------SWSQLEEEDENR
R4JQR8_BCL2L1-01        ------------------------------------CPTLDLPPS-----
A0A346RRN1_BCL2L1-      ------------------------------------CPSLEVPPS-----
Q568V1_MCL1-01          --------------------------------------KTCVEDELDGYI
Q1L8X3_MCL1-01          --------------------------------------KTCVEDELDGYI
Q9I9N3_MCL1-01          --------------------------------------KTCVEDELDGYT
A0A286XUI2_BCL2A1-      ------------------------------P-------QCETSPS-----
A0A452U285_BCL2A1-      ------------------------------P-------QPGSAPS-----
A0A452U285_BCL2A1-      ------------------------------P-------QPGSAPS-----
A0A3B3R4U0_MCL1-01      --------------------------------------LPVAPLKAKSEE
F7CP56_BCL2A1-03        --------------------------------------EIETEE------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      ------------------------------E-------DAE--EEDGANN
A0A3P8WUE9_BCL2-01      ------------------------------D-------EDR--DGDAANN
A0A3B4A3G8_BCL2-01      ------------------------------D-------AED--EGDVANN
A0A3Q3G1D7_BCL2-01      ------------------------------E-------DEQ--DEDAANN
A0A3Q2XQX2_BCL2-02      ------------------------------G-------AGE--ED-----
A0A3Q2XQX2_BCL2-01      ------------------------------G-------AED--DAAAANN
A0A3Q3B0R2_BCL2-01      ------------------------------D-------RPRRVRDDAANN
A0A3Q2PN77_BCL2-01      ------------------------------D-------GVR--DDDAAAN
A0A3P9J8Y9_BCL2-01      ------------------------------N-------GGQ--RENAANN
A0A3Q0S5Z7_BCL2-01      ------------------------------D-------GVQ--DEDAANN
A0A3P8QVM8_BCL2-01      ------------------------------R-------VVQ--EEDAANN
A0A3P9DIG5_BCL2-01      ------------------------------R-------VVQ--EEDAANN
A0A3Q2UYW8_BCL2-01      ------------------------------R-------VVQ--EEDAANN
A0A3B4G3K4_BCL2-01      ------------------------------R-------VVQ--EEDAANN
A0A2U9BJ09_BCL2-01      ------------------------------D-------DVR--DEDAADN
A0A3Q1I5N1_BCL2-01      ------------------------------H-------DAQ--DEDAANN
A0A3Q3K1K1_BCL2-01      ------------------------------H-------DVQ--DEDAANN
A0A3Q3MEY1_BCL2-01      ------------------------------H-------NVQ--DEDAANN
A0A1X9JZA1_BCL2-01      ------------------------------D-------AVR--NADAGNN
A0A4D6FTA2_BCL2-01      ------------------------------D-------DVR--DEDAANN
A0A3Q1FLK7_BCL2-01      ------------------------------D-------DVR--DEDAANN
A0A3Q1B8C3_BCL2-01      ------------------------------D-------DVR--DEDAANN
A0A3P8S9L3_BCL2-01      ------------------------------D-------DVR--DEDAANN
A0A3B5BBQ0_BCL2-01      ------------------------------D-------DVR--DEDAANN
A0A3B4TX71_BCL2-01      ------------------------------D-------DVR--DEDAANN
A0A3B4YAG2_BCL2-01      ------------------------------D-------DVR--DEDAANN
G1TW27_BCL2-02          ------------------------------G-------DAGAASA-----
E2RS00_BCL2A1-02        ------------------------------P-------ESDEEEGAGPVV
A0A3B3TCS4_BCL2-01      ------------------------------Q-------------------
A0A0U3DHY6_BCL2-01      ------------------------------Q-------------------
A0A3P9AAB2_BCL2-01      ------------------------------Q-------------------
X4ZGI8_BCL2-01          ------------------------------Q-------SSGEDDDTINTG
A0A3P9MKK4_BCL2L1-      ------------------------------T-------DDGGETEEDHSA
A0A3B3I2Q5_BCL2L1-      ------------------------------T-------DDGGETEEDHSD
A0A3P9I2N4_BCL2L1-      ------------------------------T-------DDGGETEEDHSA
A0A3B4AFB7_MCL1-01      ------------------------------S-------------------
G3TVG9_MCL1-01          ------------------------------E-------EANASVAEAIMS
B9ZYL7_BCL2-01          ------------------------------GRQQVSAEHPQASAAISNYS
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F6YNL8_BCL2-01          ------------------------------G-------DLRAPASPSLPP
A0A218UQA0_BCL2-01      ------------------------------G-------E-----------
Q00709_BCL2-01          ------------------------------G-------E-----------
A0A493T1X3_BCL2-01      ------------------------------G-------E-----------
U3KEW4_BCL2-01          ------------------------------G-------E-----------
G3WZW9_BCL2-01          ------------------------------G-------NLRTPASPSLPP
M3YYK3_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-02          ------------------------------G-------DAGAAPP-----
A0A2K6R2I5_BCL2-02      ------------------------------G-------DVGAATP-----
A0A2R9APW6_BCL2-01      ------------------------------G-------DVGAAP------
G3SLZ1_BCL2-01          ------------------------------G-------EASAAPP-----
Q75SV7_BCL2-01          ------------------------------G-------EAGAAPP-----
M3X1R9_BCL2-01          ------------------------------G-------DAGAAPP-----
Q8I008_BCL2-01          ------------------------------G-------DAGAAPP-----
A0A076FU27_BCL2-01      ------------------------------R-------AAGAAPP-----
A0A4P8GLJ2_BCL2-01      ------------------------------G-------DAGAAPP-----
F6R2C4_BCL2-01          ------------------------------G-------DAGAAPP-----
O02718_BCL2-01          ------------------------------G-------DAGAAPP-----
A0A076FZV9_BCL2-01      ------------------------------G-------AAGAAPP-----
A0A452EV13_BCL2-01      ------------------------------G-------AAGAAPP-----
A0A250YD83_BCL2-01      ------------------------------G-------DVGAAPP-----
A9QXG9_BCL2-01          ------------------------------G-------DVGAAPP-----
A0A2K5NZS5_BCL2-01      ------------------------------G-------DVGAATP-----
A0A0D9S017_BCL2-01      ------------------------------G-------DVGAATP-----
A0A2K6CIX3_BCL2-01      ------------------------------G-------DVGAATP-----
A0A2K5XRD4_BCL2-01      ------------------------------G-------DVGAATP-----
A0A2K6KHG1_BCL2-01      ------------------------------G-------DVGAATP-----
A0A2K6R2I5_BCL2-01      ------------------------------G-------DVGAATP-----
A0A2K5HK49_BCL2-01      ------------------------------G-------DVGAATP-----
G3QES9_BCL2-01          ------------------------------G-------DVGAVPP-----
H2QEM8_BCL2-01          ------------------------------G-------DVGAAPP-----
A0A2I3GZF9_BCL2-01      ------------------------------G-------DVGAAPP-----
A0A2K6UEL3_BCL2-01      ------------------------------G-------DVGAAPP-----
E2QWA1_BCL2-01          -----------------------------------------PFQF-----
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      ------------------------------E-------TRAPRPR-----
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          ------------------------------G-------EADTRTS-----
A0A452T603_BCL2-01      --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      ------------------------------Q-------LQEVERRSDNSD
A0A3Q3BEB7_BCL2L1-      ------------------------------E-------VAGERTE-----
A0A3P8VMA1_BCL2L1-      ------------------------------R-------IGGEQRE-----
A0A345BSW9_BCL2L1-      ------------------------------T-------EDTNRTD-----
A0A286MU87_BCL2L1-      ------------------------------E-------GASGRTD-----
A0A3P8XFS0_BCL2L1-      ------------------------------E-------GASGRTE-----
A0A3P8XFS0_BCL2L1-      ------------------------------E-------GASGRTE-----
A0A0F7L1T6_BCL2L1-      ------------------------------E-------DTDGRTE-----
H2U5I3_BCL2L1-01        ------------------------------E-------DTDGRTE-----
A0A3Q3J5K3_BCL2L1-      ------------------------------E-------NAGGRTE-----
A0A3Q1EVP6_BCL2L1-      ------------------------------E-------DAGGRTD-----
A0A3Q1BQA0_BCL2L1-      ------------------------------E-------DAGGRTD-----
A0A3P8U812_BCL2L1-      ------------------------------E-------DAEGRTD-----
E6ZFR0_BCL2L1-01        ------------------------------E-------NAGERTE-----
G3P7B4_BCL2L1-01        ------------------------------E-------DAGGRTE-----
A0A3Q3X5M5_BCL2L1-      ------------------------------E-------DTGGRTE-----
A0A2U9BIG9_BCL2L1-      ------------------------------E-------DAGGRTE-----
D2ITA2_BCL2L1-02        ------------------------------E-------GAGEGTD----E
A0A3B3ZMX9_BCL2L1-      ------------------------------L-------GLGDRST----Q
G3NJY1_BCL2L1-01        ------------------------------I-------GLSEPPN----R
A0A2U9BY16_BCL2L1-      -------------------------------------------------Q
A0A3Q3DUT7_BCL2L1-      ------------------------------I-------GLRQALN----R
A0A3Q3DUT7_BCL2L1-      ------------------------------I-------GLRQALN----R
A0A3Q3DUT7_BCL2L1-      ------------------------------I-------GLRQALN----R
A0A3B1JJ42_BCL2L1-      ------------------------------I-------GLMEETN----R
A0A3P8UWG7_BCL2L1-      ------------------------------L-------GLGDSPN----R
A0A3Q3IVF5_BCL2L1-      ------------------------------L-------GLNESPN----R
A0A3Q1DHJ3_BCL2L1-      ------------------------------M-------VLNEAPS----R
A0A3Q1DHJ3_BCL2L1-      ------------------------------M-------VLNEAPS----R
A0A3Q1DHJ3_BCL2L1-      ------------------------------M-------VLNEAPS----R
A0A3P8TL99_BCL2L1-      ------------------------------M-------VLNEAPS----R
A0A3P8TL99_BCL2L1-      ------------------------------M-------VLNEAPS----R
A0A3Q1FR00_BCL2L1-      ------------------------------M-------VLNEAPN----R
A0A3B4Z3X2_BCL2L1-      ------------------------------M-------VLNEAPN----R
A0A3B4Z3X2_BCL2L1-      ------------------------------M-------VLNEAPN----R
C3VIT1_BCL2L1-01        ------------------------------I-------VLNEPPN----R
A0A3P8P0F1_BCL2L1-      ------------------------------I-------VLNEPSN----R
A0A3Q2X557_BCL2L1-      ------------------------------I-------VLNEPSN----R
A0A3P9D632_BCL2L1-      ------------------------------I-------VLNEPSN----R
A0A3P9D632_BCL2L1-      ------------------------------I-------VLNEPSN----R
A0A3Q4N4B5_BCL2L1-      ------------------------------I-------VLNEPSN----R
A0A3B4FNX1_BCL2L1-      ------------------------------I-------VLNEPSN----R
A0A3Q2QPL9_BCL2L1-      ------------------------------I-------MLNEPPS----D
A0A3B5PQJ0_BCL2L1-      ------------------------------I-------LPNEPPD----G
A0A087X9B7_BCL2L1-      ------------------------------I-------LPNEPPDSTAAG
A0A3B3TUS7_BCL2L1-      ------------------------------I-------LPNEPPDSTAAG
A0A3B3WI27_BCL2L1-      ------------------------------I-------LPNEPPDSTAAG
A0A3P9N9Y4_BCL2L1-      ------------------------------I-------LPNEPPDSTAAR
A0A3B3QRZ2_BCL2L1-      ------------------------------G-------HFGLPEDRGRTE
Q564A4_BCL2-01          ------------------------------Q-------------------
H9GPE7_BCL2-01          ------------------------------S-------GDRGK-------
A0A452I9V7_BCL2-01      ------------------------------N-------ENRGPVS-----
W5N4F7_BCL2-01          ------------------------------R-------VSGETDPPNNGL
K7F5Y3_BCL2-02          ------------------------------N-------E-NRGPV-----
A0A3Q2HRY3_BCL2-02      ------------------------------G-------DAGAAPL-----
K7F5Y3_BCL2-01          ------------------------------N-------E-NRGPV-----
F1LNV0_BCL2-01          ------------------------------G-------DEDSAPL-----
P49950_BCL2-01          ------------------------------G-------DEDSAPL-----
G1TW27_BCL2-01          ------------------------------G-------DA----------
A0A2K5EB04_BCL2-01      ------------------------------G-------DVGAAPP-----
A0A2R8MY14_BCL2-01      ------------------------------G-------DVGAAPP-----
H2NWH5_BCL2-01          ------------------------------G-------DVGAAPP-----
A0A096MPU7_BCL2-01      ------------------------------G-------D-GAATP-----
A0A2K5PP81_BCL2-01      ------------------------------G-------DVGAAPP-----
H0WKI0_BCL2-01          ------------------------------G-------DVGVAPP-----
A0A2K5UDI5_BCL2-01      ------------------------------G-------DVGAATP-----
P10417_BCL2-01          ------------------------------G-------DADAAPL-----
Q7TSN8_BCL2-01          ------------------------------G-------DADAAPL-----
A0A3Q2HRY3_BCL2-01      ------------------------------G-------DAGAAPL-----
E2QWA1_BCL2-02          ------------------------------G-------EAGAAPP-----
A0A2K6G3I7_BCL2-01      ------------------------------G-------DAGAAPP-----
Q6R755_BCL2-01          ------------------------------G-------DVDAAPL-----
Q9JJV8_BCL2-01          ------------------------------G-------DVDAAPL-----
Q923R6_BCL2-01          ------------------------------G-------DVDAAPL-----
H0W1T3_BCL2-01          ------------------------------G-------DGSALGR-----
G1LIC9_BCL2-02          ------------------------------G-------DAAPAA------
I3MVK9_BCL2-01          ------------------------------G-------DVGAASP-----
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q1FR00_BCL2L1-      SQNRELVVFYIKYKLSQRNYPLNHMVLNEAPNR------------TDGGE
F6VJQ0_BCL2L10-01       --------------------------------------------------
H3AR18_MCL1-01          --------------------------------------------------
J7H260_MCL1-01          -PSPQSELDEDEDYMDVQSDSRG---------------------------
G1PZ39_MCL1-01          AAAADAIMSPEEELDGYEPEPLG----------------------KRPAV
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          ASAA-AIMSPEEELDGCEPEVLS----------------------KRPAV
A5PJR2_MCL1-01          SPISDAIMSPEEELDGCEPDPLG----------------------KRPAV
A0A452GA25_MCL1-01      SPISDAIMSPEEELDGCEPDPLG----------------------KRPAV
G1L3L7_MCL1-01          GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
G1T2Q0_MCL1-01          APAADAIMSPEEELDGYEPEPLA----------------------KRPAV
F7AVA6_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A337S3J9_MCL1-01      GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A337S3J9_MCL1-03      GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
Q7YRZ9_MCL1-01          GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
F1PAP1_MCL1-01          GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
Q8HYS5_MCL1-01          GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
M3XZZ5_MCL1-01          GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A452RHX5_MCL1-01      GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
H0XFB7_MCL1-01          APAADAIMSPEDELDGYEPEPLG----------------------KRPAV
F7GTF7_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5CFH3_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K6V5Y3_MCL1-01      APAADAIMSPEDELDGYEPEPLG----------------------KRPAV
A0A2K6KRW9_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5XSB2_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A0D9RZP5_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
I7G687_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5LXU8_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2I3GJZ3_MCL1-02      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
H2N5Y9_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2R9BPJ5_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2I3RTV4_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2I2YQH7_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5C7L5_MCL1-01      APAADAIMSPEEELDRYEPEPLG----------------------KRPAV
A0A2K5I9I0_MCL1-02      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K6GI15_MCL1-01      APAADAIMSPEDELDGYEPEPLG----------------------KRPAV
A0A2I3GJZ3_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5CFH3_MCL1-03      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5R5E2_MCL1-03      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5W0W9_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K6ECR0_MCL1-02      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2I3LFM0_MCL1-01      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K6KRW9_MCL1-02      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K6PPI3_MCL1-02      APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
G3WBC5_MCL1-01          DGAADAILSPEDELDGYEPELPG----------------------KRPAR
W5QI41_MCL1-01          APGPAPALTPPVRCRAQPPEAFAAFPIYGMQIKRQQQWFKMFGFKRRPAV
F1MQX4_MCL1-01          --------------------------------------------------
B4DLY8_MCL1-01          GAGSGGATRPGGRLLATEKEASA----------------------RRE--
B4DG83_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
B4E3L8_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          --------------------------------------------------
E2RS00_BCL2A1-01        ESDEEEGAGPVVHTEIPPASTCR----------------------PESHP
B6V6J0_MCL1-01          ----------DPDMDTHRPQLNG----------------------LGFNN
A0A3L7HT14_BCL2A1-      --------------------------------------------------
H0XHA5_MCL1-01          AQVADAVKSPEGEVASCEPEPLK----------------------KQPEG
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          ALAADAIMSPGEELGRYEPEP------------------------KQPAV
H9GEA6_MCL1-01          KWRPASLPLPEGELDGCEEAEEE----------------------EAATV
H9GEA6_MCL1-02          KWRPASLPLPEGELDGCEEAEEE----------------------EAATV
A0A493U0E8_MCL1-01      EASPWG-WGGTDHFGAVFPEPSS----------------------G----
A0A1L1RNM6_MCL1-01      TSRPVALWSPEEELDGCEPESER----------------------G----
A0A1L1RNM6_MCL1-02      TSRPVALWSPEEELDGCEPESER----------------------G----
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          DGAADVPMCPEEELDGYEPEPPG----------------------KRPSR
F6ZMX1_MCL1-02          DGAADVPMCPEEELDGYEPEPPG----------------------KRPSR
F6ZMX1_MCL1-03          DGAADVPMCPEEELDGYEPEPPG----------------------KRPSR
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      -------MSPEEELDGYEPEPLG----------------------KRPAV
P97287_MCL1-01          ASAAAAIVSPEEELDGCEPEAIG----------------------KRPAV
A0A452GA25_MCL1-02      SPISDAIMSPEEELDGCEPDPLG----------------------KRPAV
G3T756_MCL1-01          ALAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A1S3F3I1_MCL1-01      AAAAGAIMSPEEELDGYEPEPLG----------------------KRPAV
G1L3L7_MCL1-02          GPAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A287BK44_MCL1-02      SPASDAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A287BK44_MCL1-01      SPASDAIMSPEEELDGYEPEPLG----------------------KRPAV
B4DU51_MCL1-01          APAADAIMSPEEELDGYEPEPLG----------------------KRPAV
A0A287DCH9_MCL1-02      APAAA--MSPEEELDGYEPEPLG----------------------KRPAV
A0A287DCH9_MCL1-01      APAAA--MSPEEELDGYEPEPLG----------------------KRPAV
W5MMB7_MCL1-01          LKADYAEDELDNYSAEPVATSAWIPKSPRSLP----AG-LKLGGHFPE--
A0A3B3SG34_MCL1-01      WDDELDNCTD----EVDV------CPCSTRLAKRDSEK-EPCRGSRLP--
Q4SW32_MCL1-01          RDAFNGN-------VGDS------PKRPSKLTVVKPKV-CLSKTIQED--
Q0KFR9_MCL1-01          --VDLGNG------TGDT------PPRPTTLGVNVVKS-NGLDNHLSD--
A0A3P8Y1W8_MCL1-02      MDVDLGNG------TADT------PVRPTKLEVNMTKP-NVLDSRLSD--
A0A3P8Y1W8_MCL1-01      MDVDLGNG------TADT------PVRPTKLEVNMTKP-NVLDSRLSD--
D2ITA0_MCL1-03          LMATFKS-------GDER------KPRPTELG----RG-RLVNKSQDD--
D2ITA0_MCL1-04          LMATFKS-------GDER------KPRPTELG----RG-RLVNKSQDD--
A0A3P9ILF6_MCL1-02      LASRVANPD-----PSDQ------FKRPQDLE-------YSARRFHDV--
A0A3P9ILF6_MCL1-01      LASRVANPD-----PSDQ------FKRPQDLE-------YSARRFHDV--
A0A3Q2XZL8_MCL1-01      LHRAVATLGAVNCNSGAA------KPRPSALEILCKGG-LATMNHRNN--
A0A3B4AFB7_MCL1-02      MDTRKGNTA-----SSGS------P-HPRPTALVMKNE-LLNKNTREE--
A0A3B3VM25_MCL1-01      VDSLHSP-------KDPY------KQRPTNLAVTASNG-YVAKSLQES--
I3KXG5_MCL1-01          LCRKPGLVR-----RDGI------HPTLDGAALISRN-------------
A0A3Q0R633_MCL1-01      PDS------------NGT------PKRPNNLGVVSTNG-YAPKNI-----
A0A3Q0R633_MCL1-03      KDS------------NGT------PKRPNNLGVVSTNG-YAPKNI-----
A0A3B4T8L9_MCL1-02      ICSHNGNVV-----PNDN------SKRPKSLEVTSTNG-YATKASRED--
A0A3B4T8L9_MCL1-01      ICSHNGNVV-----PNDN------SKRPKSLEVTSTNG-YATKASRED--
A0A3Q1EQB9_MCL1-02      IDPQNGNLG-----SSDT------PKRPKNLGV---NG-YAPKSLRQD--
A0A3B4ZKP6_MCL1-01      LDSHNGNVG-----SGAT------PKRPKNLGVSTTNG-FAGKGLRQV--
A0A3Q1BKL8_MCL1-02      IDSHNGNVG-----SNET------PKRPKNLGV---NG-YASKNLRQD--
A0A3Q1EQB9_MCL1-01      IDPQNGNLG-----SSDT------PKRPKNLGV---NG-YAPKSLRQD--
A0A3Q1BKL8_MCL1-01      IDSHNGNVG-----SNET------PKRPKNLGV---NG-YASKNLRQD--
A0A3P8RQX7_MCL1-02      IDSHNGNVG-----SSET------PKRPKNLGV---NG-YASKNLRQD--
A0A3P8RQX7_MCL1-01      IDSHNGNVG-----SSET------PKRPKNLGV---NG-YASKNLRQD--
G3PJT0_MCL1-01          KDSHNGNAGT-----NDT------PKRPSALGVNSANG-YPSKPQRED--
A0A3B3IJ04_MCL1-01      LASHVANPDP-----SDQ------LKRPQDLE-------YSARRF-----
A0A3P9L1F3_MCL1-01      LASRVANPDP-----SDQ------LKRPQDLE-------YSARRF-----
A0A3B3IJ04_MCL1-02      LASHVANPDP-----SDQ------LKRPQDLE-------YSARRF-----
A0A3P9L1F3_MCL1-02      LASRVANPDP-----SDQ------LKRPQDLE-------YSARRF-----
A0A3B3CEX1_MCL1-01      TASRGANPDP-----SEQ------MKRPQDLDMLGNKSPYAARRF-----
A0A3B3CEX1_MCL1-02      TASRGANPDP-----SEQ------MKRPQDLDMLGNKSPYAARRF-----
A0A3Q3VP02_MCL1-01      LDSHNGNVAL-----NDT------SKRPNLLVVNPTKE-YMGKPIRKDS-
A0A3Q3B4P5_MCL1-01      LGSENGSVAS-----CNS------SKRPKDLVMPPLKG-YQDKRFQEL--
A0A3Q3B4P5_MCL1-02      LGSENGSVAS-----CNS------SKRPKDLVMPPLKG-YQDKRFQEL--
A0A3Q2EDX8_MCL1-01      MGSLHRN----------L------MKRPKDLQV-ATNG-YVGKNLSDN--
A0A3Q2P7X9_MCL1-01      SEDLRWDC-------S---------KRPKNLRVMARNG-FAVKSIQEN--
A0A3Q2P7X9_MCL1-02      SEDLRWDC-------S---------KRPKNLRVMARNG-FAVKSIQEN--
A0A3B5PQ55_MCL1-01      VESLHSPK-------DPF------MKRPTNLGV---NG-YVAKSLPTS--
A0A3B5PQ55_MCL1-02      VESLHSPK-------DPF------MKRPTNLGV---NG-YVAKSLPTS--
A0A3P9Q4I8_MCL1-01      VESLHSPM-------DPF------KKRPTNLAVTASNG-YVAKSLPES--
A0A3P9Q4I8_MCL1-02      VESLHSPM-------DPF------KKRPTNLAVTASNG-YVAKSLPES--
A0A087X830_MCL1-01      VDSLHSPK-------DPY------KKRPTNLAVSASNG-YVAKSLQKS--
A0A3B3YCD0_MCL1-01      VDSLHSPK-------DPY------KQRPTNLAVTASNG-YVAKSLQKS--
I3JHR5_MCL1-02          KDSSNGIVS------NGT------PKRPNNLGVTSTNG-YTTKAI-----
I3JHR5_MCL1-03          KDSSNGIVS------NGT------PKRPNNLGVTSTNG-YTTKAI-----
I3JHR5_MCL1-01          KDSSNGIVS------NGT------PKRPNNLGVTSTNG-YTTKAI-----
A0A3Q4HLQ8_MCL1-01      KDSSNGIVS------NGT------PKRPDNLEVTSTNG-YTTKAI-----
A0A3P8NP63_MCL1-02      KDSSNGIVS------NGT------PKRPDNLEVTSTNG-YKTKAI-----
A0A3Q2VNL8_MCL1-01      KDSSNGIVS------NGT------PKRPDNLEVTSTNG-YKTKAI-----
A0A3P8NP63_MCL1-01      KDSSNGIVS------NGT------PKRPDNLEVTSTNG-YKTKAI-----
A0A3P9BVM3_MCL1-01      KDSSNGIVS------NGT------PKRPDNLEVTSTNG-YKTKAI-----
A0A3B4G4Z6_MCL1-01      KDSSNGIVS------NGT------PKRPDNLEVTSTNG-YKTKAI-----
A0A2U9CJ81_MCL1-01      IDSRGGNVGA-----GDA------PKRPKNLQVSATKA-YAAKSCREDGG
A0A3P8VKM5_MCL1-03      LSTHNDSMSS----VTET------QRRPKDLQVNTANG-HARKSH-----
A0A3P8VKM5_MCL1-04      LSTHNDSMSS----VTET------QRRPKDLQVNTANG-HARKSH-----
A0A3P8VKM5_MCL1-05      LSTHNDSMSS----VTET------QRRPKDLQVNTANG-HARKSH-----
A0A3Q3IZW0_MCL1-01      IDSCKGNVGP-----NNT------LKRPKILDVSSTNG-YGTKTL-VD--
A0A3Q1GX28_MCL1-02      IDACNGN---------AA------LKRPKNLDVSSSNG-YATKNIGAN--
A0A3Q1GX28_MCL1-01      IDACNGN---------AA------LKRPKNLDVSSSNG-YATKNIGAN--
A0A3B4XKA5_MCL1-01      LCCDNGNVVP-----NDN------SKRPKSLEVTSTNG-YATKASRED--
A0A3Q3GP42_MCL1-01      LASQNGNVGS-----NET------TKRPKALVVNSGN-------------
A0A3Q3M6G2_MCL1-01      LDSRNGN-GG-----TAN------PKRPKNLEVSSTNG-YATKSIVAD--
A0A3Q3M6G2_MCL1-02      LDSRNGN-GG-----TAN------PKRPKNLEVSSTNG-YATKSIVAD--
A0A3B1IEV7_MCL1-01      GLEG--------------------------------------LQSAKG--
A0A3B4CGU9_MCL1-03      GLEG--------------------------------------LQAAPGPA
A0A3B4CGU9_MCL1-02      SFGGPVTL-------------------------------IYLIHGGQGGS
Q8UWD6_MCL1-01          -TGLQSKP-------------------------------LVIPELKAHNQ
A2BF68_MCL1-01          -TGLQSKP-------------------------------LVIPELKAHNQ
Q568W5_MCL1-01          -TGLQSKP-------------------------------LVIPELKAHNQ
A0A3B1K5R1_MCL1-01      GGGAGLSL-------------------------------GLAADIRPTRP
A0A3B4C6H5_MCL1-03      ISSQTRAP-------------------------------RIAA-------
A0A3B4C6H5_MCL1-01      ---------------------------------------LIAA-------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------------------------------
H3AAS7_BCL2L2-01        --------------------------------------------------
G1Q051_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-01        --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A482LX62_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-02        --------------------------------------------------
Q7TS60_BCL2L2-01        --------------------------------------------------
G1LMC3_BCL2L2-01        --------------------------------------------------
M3Y5X5_BCL2L2-01        --------------------------------------------------
G1P3J2_BCL2L2-01        --------------------------------------------------
G3WPT1_BCL2L2-02        --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
P70345_BCL2L2-01        --------------------------------------------------
O88996_BCL2L2-01        --------------------------------------------------
A0A3Q9B4M8_BCL2L2-      --------------------------------------------------
H0XR82_BCL2L2-01        --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
L8HP19_BCL2L2-02        --------------------------------------------------
L8HP19_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A286XQQ9_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A0D9RU30_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A287D9B3_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452SHI1_BCL2L2-      --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q2TAP5_BCL2L1-01        ISNGTSTSE-----------------------------------------
Q91828_BCL2L1-01        YLMEPSTSE-----------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
G3TMU7_BCL2L2-01        --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------VRYGNPQWIS--------------------------------
H9GHK7_BCL2L1-01        ESGEEAMEPANETGNTLN--------------------------------
Q07816_BCL2L1-04        TD----TAAEAEMDSVLN--------------------------------
A0A493TIA6_BCL2L1-      TELAS----EA--AAVLN--------------------------------
Q07816_BCL2L1-02        TDTAA----EAEMDSVLN--------------------------------
Q07816_BCL2L1-03        TDTAA----EAEMDSVLN--------------------------------
Q07816_BCL2L1-01        TDTAA----EAEMDSVLN--------------------------------
G1N5N5_BCL2L1-01        TDTAA----EAEMDSVLN--------------------------------
A0A452ILL8_BCL2L1-      TDSAE----EAEMASVPN--------------------------------
A0A452ILL8_BCL2L1-      TDSAE----EAEMASVPN--------------------------------
K7F655_BCL2L1-01        TEAAE----EAEMASVPN--------------------------------
A0A452E1B1_BCL2L1-      TETLEGTESDMETPSAIS--------------------------------
W5PSA5_BCL2L1-01        TETLEGTESDMETPSAIS--------------------------------
P53563_BCL2L1-03        TEAPEETEPERETPSAIN--------------------------------
P53563_BCL2L1-02        TEAPEETEPERETPSAIN--------------------------------
A0A287CZ07_BCL2L1-      TEAPEGTESEVETPSAIN--------------------------------
F6WA14_BCL2L1-01        TEVLEGA----EIPSTVN--------------------------------
G3WKX6_BCL2L1-01        TEASEGT----EIPSTVN--------------------------------
M3XA94_BCL2L1-01        TEAPEGTESEMETPSAIN--------------------------------
M3XA94_BCL2L1-02        TEAPEGTESEMETPSAIN--------------------------------
A0A3Q2H0F6_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
H0X6V2_BCL2L1-01        TEAPEGNESELETPSAIN--------------------------------
G3SPN0_BCL2L1-01        TGASEGTESEMEIPSAIN--------------------------------
Q2PFS6_BCL2L1-01        ----------METPSAIN--------------------------------
O35843_BCL2L1-01        TEAPEETEAERETPSAIN--------------------------------
M3XA94_BCL2L1-03        TEAPEGTESEMETPSAIN--------------------------------
G1RER8_BCL2L1-01        TEAPEGTESEMETPSAIN--------------------------------
A0A1S2ZQT6_BCL2L1-      TEASEGTESEMETPSAIN--------------------------------
Q64373_BCL2L1-09        TEAPEETEAERETPSAIN--------------------------------
Q64373_BCL2L1-01        TEAPEETEAERETPSAIN--------------------------------
P53563_BCL2L1-01        TEAPEETEPERETPSAIN--------------------------------
O77737_BCL2L1-01        TEAPEGTESEAETPSAIN--------------------------------
Q9MYW4_BCL2L1-01        TEAPEGTGPEMETPSAIN--------------------------------
A0A3Q2H0F6_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
L8J061_BCL2L1-01        TEAPEGTESDMETPSAIN--------------------------------
Q05KJ0_BCL2L1-01        TEAPEGTESDMETPSAIN--------------------------------
Q05KJ0_BCL2L1-02        TEAPEGTESDMETPSAIN--------------------------------
E2IV76_BCL2L1-01        TEAPEGTESEMETPSAIN--------------------------------
A0A2K6G3C5_BCL2L1-      TEAPEATESEMETPSAIN--------------------------------
B2Z3Z4_BCL2L1-01        TEAPEGTESERETPSAIN--------------------------------
G3HEA7_BCL2L1-01        TEAPEGTESERETPSAIN--------------------------------
G3HEA7_BCL2L1-02        TEAPEGTESERETPSAIN--------------------------------
A0A1U7T4L4_BCL2L1-      TEASEGTESEMETPSAVN--------------------------------
M3Z2H9_BCL2L1-01        TEAPEGTESEMETPSAIN--------------------------------
A0A1U7QU73_BCL2L1-      TEAPEGAESERETPSAIN--------------------------------
A0A0D9RJZ8_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A286Y5D6_BCL2L1-      TEGPEGTESEMETPSAIN--------------------------------
A0A250YD48_BCL2L1-      TEAPEGIESEVETPSAIN--------------------------------
A0A1L5BWY3_BCL2L1-      TEAPEGIESEVETPSAIN--------------------------------
I3MUP5_BCL2L1-02        TEAPEGTESEVETPSAIN--------------------------------
I3MUP5_BCL2L1-03        TEAPEGTESEVETPSAIN--------------------------------
I3MUP5_BCL2L1-01        TEAPEGTESEVETPSAIN--------------------------------
G1P9D2_BCL2L1-01        TEAPEGTESEVETPSAIN--------------------------------
A0A2K5EBP4_BCL2L1-      TEAPEGTDSEMETPSAIN--------------------------------
E2IV75_BCL2L1-01        TEAPEGTDSEMETPSAIN--------------------------------
F7IT34_BCL2L1-01        TEAPEGTDSEMETPSAIN--------------------------------
Q76LT7_BCL2L1-01        TEAPEGTESEMETPSAIN--------------------------------
A0A2K5Q6R6_BCL2L1-      TEAPEGTDSEMETPSAIN--------------------------------
A0A2K5Q6R6_BCL2L1-      TEAPEGTDSEMETPSAIN--------------------------------
A0A2K5M8B1_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2K5H963_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
Q8SQ42_BCL2L1-01        TEAPEGTESEMETPSAIN--------------------------------
A0A2K5VPG2_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2K5YR37_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2R8Z9D7_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A096NV05_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2J8VIH3_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2K6QFA2_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2K6QFA2_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A2K6UWY8_BCL2L1-      TEAPEGTDSEMETPSAIN--------------------------------
E2IV77_BCL2L1-01        TEAPEGTDSEMETPSAIN--------------------------------
A0A452SDS4_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A384D3U1_BCL2L1-      TEAPEGTESEMETPSAIN--------------------------------
A0A452FWV3_BCL2L1-      TEAPEGTESDMETPSAIN--------------------------------
Q9MZS7_BCL2L1-01        TEAPEGTESDMETPSAIN--------------------------------
A0A3B3E2W4_BCL2L1-      --QTAEDR------------------------------------------
A0A3B3I2Q5_BCL2L1-      --ETEEDH------------------------------------------
A0A3P9I2N4_BCL2L1-      --ETEEDH------------------------------------------
A0A3P9MKK4_BCL2L1-      --ETEEDH------------------------------------------
A0A3B5B4X7_BCL2L1-      --RTEGDKTN----------------------------------------
A0A3B4BFZ8_BCL2L1-      --QCEGNKAA----------------------------------------
A0A3Q3FUB6_BCL2L1-      --RTEGDMEN----------------------------------------
A0A3B5MGS2_BCL2L1-      --RTNWEGDS----------------------------------------
M4A558_BCL2L1-01        --RTNWEGDS----------------------------------------
A0A3P9QFB3_BCL2L1-      --RTNWDGDS----------------------------------------
A0A087YBW4_BCL2L1-      --RTNWDGDS----------------------------------------
A0A3B3VWI7_BCL2L1-      --RTNWDGDS----------------------------------------
A0A3B3XN57_BCL2L1-      --RTNWDGDS----------------------------------------
A0A3Q2C6K4_BCL2L1-      --RTEGDKDA----------------------------------------
A0A3Q2NRP4_BCL2L1-      --RTEGDKDS----------------------------------------
A0A0B4KJI5_BCL2L1-      --RTEADKAN----------------------------------------
A0A3Q1JZ46_BCL2L1-      ----VGDRPN----------------------------------------
A0A3Q1JZ46_BCL2L1-      ----VGDRPN----------------------------------------
A0A3Q3NFM4_BCL2L1-      --RTEGDMTG----------------------------------------
A0A3Q3NFM4_BCL2L1-      --RTEGDMTG----------------------------------------
A0A3B4V9K8_BCL2L1-      --RTEGDKAN----------------------------------------
A0A3B4XS24_BCL2L1-      --RTEGDKAS----------------------------------------
A0A2U9BY16_BCL2L1-      --RTDRGEAGLGEEQQT---------------------------------
C1BLI0_BCL2L1-01        --RTNVDKTN----------------------------------------
C0HAD8_BCL2L1-01        --RTEGDD------------------------------------------
A0A3B3ZMX9_BCL2L1-      --LEDGTEIDTERDRDL---------------------------------
A0A3B3TFR4_BCL2L1-      --QTGGGEGEAAGA------------------------------------
H3CH49_BCL2L1-01        --RTEGQFG-----------------------------------------
A0A3Q2FR43_BCL2L1-      --GTGAQGAEQDDERTP---------------------------------
A0A3P8XYL5_BCL2L1-      --RTEGGEVEEVAAV-----------------------------------
Q90Z98_BCL2L1-02        --RTDGAEENGEGAAGA---------------------------------
Q90Z98_BCL2L1-01        --RTDGAEENGEGAAGA---------------------------------
A0A059PJI5_BCL2L1-      ------GQVAEENAVGAG--------------------------------
A0A3B4DTL9_BCL2L1-      --RTEGGQAAEENAEGA---------------------------------
B5XAY3_BCL2L1-01        --RTEVGQVE--GGAAV---------------------------------
W5MG74_BCL2L1-01        --RTGGAEAVGSGSPNA---------------------------------
A0A3Q3B3X5_BCL2L1-      --RTDAGDAGLEDAEMT---------------------------------
A0A3B3IB64_BCL2L1-      --RTAAGEVG--EEQST---------------------------------
A0A3P9JYH1_BCL2L1-      --RTAAGEVG--EEQST---------------------------------
A0A3B3DHA1_BCL2L1-      --RTAAGEVG--EEQST---------------------------------
A0A3Q0RTF8_BCL2L1-      --RTDGGAAGLDEEQRI---------------------------------
I3IZK7_BCL2L1-01        --RTDGGAAGLDEEQRI---------------------------------
A0A2U9BY16_BCL2L1-      --RTDRGEAGLGEEQQT---------------------------------
A0A2U9BY16_BCL2L1-      --RTDRGEAGLGEEQQT---------------------------------
A0A2U9BY16_BCL2L1-      --RTDRGEAGLGEEQQT---------------------------------
A0A0D6DR75_BCL2L1-      --RTDGGEVESAEEQRI---------------------------------
A0A3Q3WIW8_BCL2L1-      --RTEGGQAVSDEEQRV---------------------------------
A0A219P0Y3_BCL2L1-      --RTDGGEAGLGEEQRV---------------------------------
A0A3Q3MX20_BCL2L1-      --RTDGGEAESGEEQRI---------------------------------
A0A3Q3G2E1_BCL2L1-      --RTDGAGAGSGEEQQV---------------------------------
A0A3Q3G2E1_BCL2L1-      --RTDGAGAGSGEEQQV---------------------------------
A0A3Q3G2E1_BCL2L1-      --RTDGAGAGSGEEQQV---------------------------------
A0A3Q1GZ93_BCL2L1-      --RTDGGEDGLSEEQRI---------------------------------
A0A3Q1GZ93_BCL2L1-      --RTDGGEDGLSEEQRI---------------------------------
A0A3Q1GZ93_BCL2L1-      --RTDGGEDGLSEEQRI---------------------------------
A0A3B4V3T1_BCL2L1-      --RTDGGEAGLVEEQRI---------------------------------
A0A3B4XU17_BCL2L1-      --RTDGGEAGLVEEQRI---------------------------------
H3ANS8_BCL2L1-01        GGDRAREAQTPEEGAIPG--------------------------------
A0A452FHY1_BCL2L1-      --SLRRDKIRYGNPNAVN--------------------------------
A0A452FHY1_BCL2L1-      --SLRRDKIRYGNPNAVN--------------------------------
A0A1S3EPX7_BCL2L1-      TEDPEGTESEMETPSAIN--------------------------------
A0A218USB3_BCL2L1-      T-DFAGEEDEMD--GVLN--------------------------------
A0A218USB3_BCL2L1-      T-DFAGEEDEMD--GVLN--------------------------------
U3JSL7_BCL2L1-01        T-DFAGEEDEMD--GVLN--------------------------------
A0A218USB3_BCL2L1-      T-DFAGEEDEMD--GVLN--------------------------------
A0A218USB3_BCL2L1-      T-DFAGEEDEMD--GVLN--------------------------------
H0Z8G3_BCL2L1-01        T-DFAGEEDEMD--GVLN--------------------------------
Q4U2V6_BCL2L1-01        T-DFAGEEDEMD--GVLN--------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q568V1_MCL1-01          EEEEAPLKRLRPGTNGLK--------------------------------
Q1L8X3_MCL1-01          EEEEAPLKRLRPGTNGLK--------------------------------
Q9I9N3_MCL1-01          EEEEAPLKRLRPGTNGLK--------------------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      ELDSLDEGERFHGAPKTE--------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      GSMISPPPGLVRRIHGAS--------------------------------
A0A3P8WUE9_BCL2-01      GSIVSRPPTLVHRCRGAS--------------------------------
A0A3B4A3G8_BCL2-01      GSIVASSPVLVNRRCRAE--------------------------------
A0A3Q3G1D7_BCL2-01      GSLVAPPPTLVRRCREAS--------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      GLLVAPSPTLVLRCREAS--------------------------------
A0A3Q3B0R2_BCL2-01      GSVASQSPTLVRRCRGAR--------------------------------
A0A3Q2PN77_BCL2-01      GGLGDRSPTLVRRCRDAA--------------------------------
A0A3P9J8Y9_BCL2-01      GSVGDHSPTPVRRRCDAG--------------------------------
A0A3Q0S5Z7_BCL2-01      GSINDPPPTLVRRCREPS--------------------------------
A0A3P8QVM8_BCL2-01      GSITDPPPTLVHRCREAS--------------------------------
A0A3P9DIG5_BCL2-01      GSITDPPPTLVHRCREAS--------------------------------
A0A3Q2UYW8_BCL2-01      GSITDPPPTLVHRCREAS--------------------------------
A0A3B4G3K4_BCL2-01      GSITDPPPTLVHRCREAS--------------------------------
A0A2U9BJ09_BCL2-01      GSIVAPPPTLVRRCHGAS--------------------------------
A0A3Q1I5N1_BCL2-01      GSAVPPPPTLVRRCREAS--------------------------------
A0A3Q3K1K1_BCL2-01      GSIVAPPPTLVRRCREAS--------------------------------
A0A3Q3MEY1_BCL2-01      GSVVAPPPTVVRRCRDAS--------------------------------
A0A1X9JZA1_BCL2-01      GSIVAPPPSLVRRCRGAS--------------------------------
A0A4D6FTA2_BCL2-01      GSIVAPPPTLVRRCREAS--------------------------------
A0A3Q1FLK7_BCL2-01      GSVVDPPPTLVRRCHEAS--------------------------------
A0A3Q1B8C3_BCL2-01      GSVVDPPPTLVRRCHEAS--------------------------------
A0A3P8S9L3_BCL2-01      GSVVDPPPTLVRRCHEAS--------------------------------
A0A3B5BBQ0_BCL2-01      GSVVDPPPTLVRRCHEAS--------------------------------
A0A3B4TX71_BCL2-01      GSIVAPPPTLVRRCREAN--------------------------------
A0A3B4YAG2_BCL2-01      GSIVAPPPTLVRRCREAN--------------------------------
G1TW27_BCL2-02          -------PGVFSSQPAPA--------------------------------
E2RS00_BCL2A1-02        HTEIPPASTCRPESHPEP--------------------------------
A0A3B3TCS4_BCL2-01      --AAGDTDSPNNGSVDSP--------------------------------
A0A0U3DHY6_BCL2-01      --AENDSPNNLFGDPSTP--------------------------------
A0A3P9AAB2_BCL2-01      --TENQSRNNVFEDPSPP--------------------------------
X4ZGI8_BCL2-01          VEDSSPSSDRRLQAPSAG--------------------------------
A0A3P9MKK4_BCL2L1-      ARNGRPVSSEDCQLRRSC--------------------------------
A0A3B3I2Q5_BCL2L1-      ARNRRLVSSEDGRLRRSC--------------------------------
A0A3P9I2N4_BCL2L1-      ARNGRQVSSEDGQLRRSC--------------------------------
A0A3B4AFB7_MCL1-01      ----------------EG--------------------------------
G3TVG9_MCL1-01          AEEELGRYKLETLGKRPA--------------------------------
B9ZYL7_BCL2-01          DDGEMPAASADSRGPPQS--------------------------------
A0A3L7HT14_BCL2A1-      -----------ESAPSKT--------------------------------
F6YNL8_BCL2-01          VVASAPAVGIFSTQPRNT--------------------------------
A0A218UQA0_BCL2-01      --DRVSLPPDHSASAAAA--------------------------------
Q00709_BCL2-01          --DRPPVPPAPAPAAAPA--------------------------------
A0A493T1X3_BCL2-01      --DRAPAPTALAPAAAAV--------------------------------
U3KEW4_BCL2-01          --HRAPLPPGLSAPAAAA--------------------------------
G3WZW9_BCL2-01          VVASAPAVGIFSNQPRHT--------------------------------
M3YYK3_BCL2-01          ----RPVMKLVYLPTAPP--------------------------------
M3X1R9_BCL2-02          --GAAPAPGIFSSQPGRT--------------------------------
A0A2K6R2I5_BCL2-02      --GAAPAPGIFSSQPGHT--------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          --GAAPAPGVLSSPPAAP--------------------------------
Q75SV7_BCL2-01          --GAAPAPGIFSSQPGRA--------------------------------
M3X1R9_BCL2-01          --GAAPAPGIFSSQPGRT--------------------------------
Q8I008_BCL2-01          --GAAPAPGIFSSQPGRT--------------------------------
A0A076FU27_BCL2-01      --GAAPAPGILSSQPGRT--------------------------------
A0A4P8GLJ2_BCL2-01      --GAAPAPGILSSQPGRT--------------------------------
F6R2C4_BCL2-01          --GAAPAPGILSSQPGRT--------------------------------
O02718_BCL2-01          --GAAPAPGILSSQPGRT--------------------------------
A0A076FZV9_BCL2-01      --GAAPAPGILSSQPGRT--------------------------------
A0A452EV13_BCL2-01      --GAAPAPGILSSQPGRA--------------------------------
A0A250YD83_BCL2-01      --EATPAPGIFSFQPGSN--------------------------------
A9QXG9_BCL2-01          --GAAPAPGIFSSQPGHT--------------------------------
A0A2K5NZS5_BCL2-01      --GVAPAPGIFSSQPGHT--------------------------------
A0A0D9S017_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2K6CIX3_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2K5XRD4_BCL2-01      --GVAPAPGIFSSQPGHT--------------------------------
A0A2K6KHG1_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2K6R2I5_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2K5HK49_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
G3QES9_BCL2-01          --GAAPAPGIFSSQPGHT--------------------------------
H2QEM8_BCL2-01          --GAAPAPGIFSSQPGHT--------------------------------
A0A2I3GZF9_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2K6UEL3_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
E2QWA1_BCL2-01          --GGCPVSFSG-PELASP--------------------------------
G1LIC9_BCL2-01          ------------PHPAAS--------------------------------
A0A452R110_BCL2-01      --GPPPRRASSPPSLGSP--------------------------------
A0A452R110_BCL2-02      -------A------------------------------------------
G3WZW9_BCL2-02          -------V------------------------------------------
G3SLZ1_BCL2-02          --PLQADP------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A3Q2Y539_MCL1-01      MDEGAQPLPELQTPPGQG--------------------------------
A0A3Q3BEB7_BCL2L1-      ----------KASSAPSN--------------------------------
A0A3P8VMA1_BCL2L1-      --------GEEVTTASSN--------------------------------
A0A345BSW9_BCL2L1-      --------GAEENGEGAA--------------------------------
A0A286MU87_BCL2L1-      --------GDEAIANGSV--------------------------------
A0A3P8XFS0_BCL2L1-      --------GEEATANGSV--------------------------------
A0A3P8XFS0_BCL2L1-      --------GEEATANGSV--------------------------------
A0A0F7L1T6_BCL2L1-      --------GEKRSPAASN--------------------------------
H2U5I3_BCL2L1-01        --------GEKRSPAASN--------------------------------
A0A3Q3J5K3_BCL2L1-      --------GDRTNPATTN--------------------------------
A0A3Q1EVP6_BCL2L1-      --------GDKASSASSN--------------------------------
A0A3Q1BQA0_BCL2L1-      --------GDKANSASSN--------------------------------
A0A3P8U812_BCL2L1-      --------GDKANSASSN--------------------------------
E6ZFR0_BCL2L1-01        --------GDKANSAARN--------------------------------
G3P7B4_BCL2L1-01        --------GDKANSASVP--------------------------------
A0A3Q3X5M5_BCL2L1-      --------GDKASSAARN--------------------------------
A0A2U9BIG9_BCL2L1-      --------GDKANSAASN--------------------------------
D2ITA2_BCL2L1-02        DKSNRIGNNGLRLNDGNG--------------------------------
A0A3B3ZMX9_BCL2L1-      SDTEHLGLGDRGVDRARL--------------------------------
G3NJY1_BCL2L1-01        TGG-----GVEAGAAGGQ--------------------------------
A0A2U9BY16_BCL2L1-      TDR-----GEAGLG-EEQ--------------------------------
A0A3Q3DUT7_BCL2L1-      TDG-----REEASGEEEQ--------------------------------
A0A3Q3DUT7_BCL2L1-      TDG-----REEASGEEEQ--------------------------------
A0A3Q3DUT7_BCL2L1-      TDG-----REEASGEEEQ--------------------------------
A0A3B1JJ42_BCL2L1-      TEG-----GQEAEG-NAE--------------------------------
A0A3P8UWG7_BCL2L1-      TDG-----EEAGLG-AEQ--------------------------------
A0A3Q3IVF5_BCL2L1-      TDG-----EEA---------------------------------------
A0A3Q1DHJ3_BCL2L1-      TDG-----GEARLG-EEQ--------------------------------
A0A3Q1DHJ3_BCL2L1-      TDG-----GEARLG-EEQ--------------------------------
A0A3Q1DHJ3_BCL2L1-      TDG-----GEARLG-EEQ--------------------------------
A0A3P8TL99_BCL2L1-      TDG-----GEARLG-EEQ--------------------------------
A0A3P8TL99_BCL2L1-      TDG-----GEARLG-EEQ--------------------------------
A0A3Q1FR00_BCL2L1-      TDG-----GEARLG-EDQ--------------------------------
A0A3B4Z3X2_BCL2L1-      TDG-----GEARLA-EEQ--------------------------------
A0A3B4Z3X2_BCL2L1-      TDG-----GEARLA-EEQ--------------------------------
C3VIT1_BCL2L1-01        TGA-----GDGGLG-EEQ--------------------------------
A0A3P8P0F1_BCL2L1-      TDG-----GAAGLD-EEQ--------------------------------
A0A3Q2X557_BCL2L1-      TDG-----GAAGLD-EEQ--------------------------------
A0A3P9D632_BCL2L1-      TDG-----GAAGLD-EEQ--------------------------------
A0A3P9D632_BCL2L1-      TDG-----GAAGLD-EEQ--------------------------------
A0A3Q4N4B5_BCL2L1-      TDG-----GAAGLD-EEQ--------------------------------
A0A3B4FNX1_BCL2L1-      TDG-----GAAGLD-EEQ--------------------------------
A0A3Q2QPL9_BCL2L1-      GGA-----RDAESD-EEQ--------------------------------
A0A3B5PQJ0_BCL2L1-      TAA-----GDVGMD-DEQ--------------------------------
A0A087X9B7_BCL2L1-      DAA-----GDAGMD-DEQ--------------------------------
A0A3B3TUS7_BCL2L1-      DAA-----GDAGMD-DEQ--------------------------------
A0A3B3WI27_BCL2L1-      DAA-----GDAGMD-DEQ--------------------------------
A0A3P9N9Y4_BCL2L1-      DAA-----GDGGMD-DEQ--------------------------------
A0A3B3QRZ2_BCL2L1-      GSGQADGREGVMVTATHV--------------------------------
Q564A4_BCL2-01          --SSAEEDDTFNKAVEES--------------------------------
H9GPE7_BCL2-01          --SASLSPELLNSDPVST--------------------------------
A0A452I9V7_BCL2-01      --PNLSPPTVTGTSSDHA--------------------------------
W5N4F7_BCL2-01          VGPSASGPGLQARRLQAA--------------------------------
K7F5Y3_BCL2-02          --SSSLSPPAAGTPSDHA--------------------------------
A0A3Q2HRY3_BCL2-02      --GATPVPGIFSSQPGRT--------------------------------
K7F5Y3_BCL2-01          --SSSLSPPAAGTPSDHA--------------------------------
F1LNV0_BCL2-01          --RAAPTPGIFSFQPESN--------------------------------
P49950_BCL2-01          --RAAPTPGIFSFQPESN--------------------------------
G1TW27_BCL2-01          --GAASAPGVFSSQP-----------------------------------
A0A2K5EB04_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2R8MY14_BCL2-01      --GAAPAEGIFSSQPGHT--------------------------------
H2NWH5_BCL2-01          --GAATAPGIFSSQPGHT--------------------------------
A0A096MPU7_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
A0A2K5PP81_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
H0WKI0_BCL2-01          --GAATAPGVFSSQPGRT--------------------------------
A0A2K5UDI5_BCL2-01      --GAAPAPGIFSSQPGHT--------------------------------
P10417_BCL2-01          --GAAPTPGIFSFQPESN--------------------------------
Q7TSN8_BCL2-01          --GAAPTPGIFSFQPESN--------------------------------
A0A3Q2HRY3_BCL2-01      --GATPVPGIFSSQPGRT--------------------------------
E2QWA1_BCL2-02          --GAAPAPGISASQX-XX--------------------------------
A0A2K6G3I7_BCL2-01      --GAAPTPGIFSSQPGRN--------------------------------
Q6R755_BCL2-01          --GAAPTPGIFSFQPESN--------------------------------
Q9JJV8_BCL2-01          --GAAPTPGIFSFQPESN--------------------------------
Q923R6_BCL2-01          --GAAPTPGIFSFQPESN--------------------------------
H0W1T3_BCL2-01          --NSPLGV------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --GAAPGPGIFSSQPG----------------------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
G1QEX2_BCL2L10-01       --------APQQPSTPEATVMRSLAA------------------------
A0A3Q1FR00_BCL2L1-      ARLGEDQRTETHANGTFNGTSPGTPPPSP---------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
H3AR18_MCL1-01          ------------------MELPGDGCPQD----GDMAEFRKETLKLLRSY
J7H260_MCL1-01          -----------------STSPPLTPTCSP-------DPLHTETRALLHTF
G1PZ39_MCL1-01          LPLVQLVGEASGG-PGAGGSLPSTPPPAE----EEEDELFRQSLEIISRY
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          LPLLERVSEAAKS-SGADGSLPSTPPPPE----EEDDELYHQSLEIISRY
A5PJR2_MCL1-01          RPLPLLVGEASNNSPGSDGSLPSTPPPAE----EEEDELYRQSLEIISQY
A0A452GA25_MCL1-01      RPLALMVGEASNNSPGSDGSLPSTPPPSE----EEEDELYRQSLEIISQY
G1L3L7_MCL1-01          LPLLELVGEASGG-PCTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
G1T2Q0_MCL1-01          LPLLDLVGEASKV-PSTDGSLPSTPPPAE----EEEDELYRQSLEIIARY
F7AVA6_MCL1-01          LPLLEFVREASSG-PCTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A337S3J9_MCL1-01      LPLLELVGEASSG-PGTDGSLPSTPPPAE----EEEDELFRQSLEIISRY
A0A337S3J9_MCL1-03      LPLLELVGEASSG-PGTDGSLPSTPPPAE----EEEDELFRQSLEIISRY
Q7YRZ9_MCL1-01          LPLLELVGEASSG-PGTDGSLPSTPPPAE----EEEDELFRQSLEIISRY
F1PAP1_MCL1-01          LPLLELVGEASSG-PGMDGSLPSTPPPAE----EEEDELYRQSLEIISRY
Q8HYS5_MCL1-01          LPLLELVGEASSG-PGMDGSLPSTPPPAE----EEEDELYRQSLEIISRY
M3XZZ5_MCL1-01          LPLLELVGEASSG-PCTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A452RHX5_MCL1-01      LPLLELVGEASGG-PCTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
H0XFB7_MCL1-01          LPLLELVGEASNG-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
F7GTF7_MCL1-01          LPLLELVGEPANG-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5CFH3_MCL1-01      LPLLELVGEPGNG-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K6V5Y3_MCL1-01      LPLLELVGEPGHG-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K6KRW9_MCL1-01      LPLLELVGESGNS-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5XSB2_MCL1-01      LPLLELVGESGNS-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A0D9RZP5_MCL1-01      LPLLELVGESGNS-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
I7G687_MCL1-01          LPLLELVGESGNS-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5LXU8_MCL1-01      LPLLELVGESGNS-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2I3GJZ3_MCL1-02      LPLLELVGESGNN-TSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
H2N5Y9_MCL1-01          LPLLELVGESGNN-TSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2R9BPJ5_MCL1-01      LPLLELVGESGNN-TSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2I3RTV4_MCL1-01      LPLLELVGESGNN-TSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2I2YQH7_MCL1-01      LPLLELVGESGND-TSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5C7L5_MCL1-01      LPLLELVEEPGND-SSTDGSLPSTPP---------------TSLEIISRY
A0A2K5I9I0_MCL1-02      LPLLELVGES-NS-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K6GI15_MCL1-01      LPLLELVGEASNG-SSTDGSLPSTPPPAE----EEDDELYRQSLEIISRY
A0A2I3GJZ3_MCL1-01      LPLLELVGESGNN-TSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5CFH3_MCL1-03      LPLLELVGEPGNG-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5R5E2_MCL1-03      LPLLELVGEPGNG-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5W0W9_MCL1-01      LPLLELVGESGNS-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K6ECR0_MCL1-02      LPLLELVGESGNS-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2I3LFM0_MCL1-01      LPLLELVGESGNS-PSTDGSLPSTPPPAE----EEEDELYRQSLEIISWY
A0A2K6KRW9_MCL1-02      LPLLELVGESGNS-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K6PPI3_MCL1-02      LPLLELVGESGNS-SSTDGSLPSTPPPAE----EEEDELYRQSLEIISRY
G3WBC5_MCL1-01          LAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRY
W5QI41_MCL1-01          RPLPLMVGEASNNSPGSDGSLPSTPPPSE----EEEDELYRQSLEIISQY
F1MQX4_MCL1-01          ---------------------GMLPIFSE----EEEDELYWQSLEIISRY
B4DLY8_MCL1-01          ------IGGGEAGAV-IGGSAGASPPSTL----TPDSR------------
B4DG83_MCL1-01          LPLLELVGESGNNTS-TDGSLPSTPPPAE----EEEDELYRQSLEIISRY
B4E3L8_MCL1-01          LPLLELVGESGNNTS-TDGSLPSTPPPAE----EEEDELYRQSLEIISRY
A0A2K5DMS4_MCL1-01      --------------------------------------------------
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          ---------------SVPPSPPTPSTPED--GDGDMAEFRKETLKLLRSY
E2RS00_BCL2A1-01        EPRQPRPHRASGSSRGTRLPSRRAGGPRM--TDCEFGYTLALAQDYVRHV
B6V6J0_MCL1-01          GGSLPCSQEDELDEDMDNGSQGSTSPPDS--PVCPKDGLYMDTQQLILAF
A0A3L7HT14_BCL2A1-      --------------------------------------------------
H0XHA5_MCL1-01          LPLLEFVGEAGNGPST----------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          LPLLQLVGEA--SEGPAGGSLPSTPPPAE--EEEEL-----SLLEMIPQH
H9GEA6_MCL1-01          PSSTPSPDKEMAEEEGEKGKGGPPLFPDH---------LRKTTLEVVGRY
H9GEA6_MCL1-02          PSSTPSPDKEMAEEEGEKGKGGPPLFPDH---------LRKTTLEVVGRY
A0A493U0E8_MCL1-01      ------------IFSRPARTNPLGSAP----------RGRGGDLTILGWF
A0A1L1RNM6_MCL1-01      ----------------PGGDSLPGTPPEL--PDLIPDELRQESLELILRY
A0A1L1RNM6_MCL1-02      ----------------PGGDSLPGTPPEL--PDLIPDELRQESLELILRY
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          LAVLEIARE---GGDSPNGSLPSTPPPAE--EDEEEDELYGQSLELISRY
F6ZMX1_MCL1-02          LAVLEIARE---GGDSPNGSLPSTPPPAE--EDEEEDELYGQSLELISRY
F6ZMX1_MCL1-03          LAVLEIARE---GGDSPNGSLPSTPPPAE--EDEEEDELYGQSLELISRY
G1T2Q0_MCL1-02          --------------------------------------------------
F1PAP1_MCL1-02          --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
Q07820_MCL1-04          --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2R9BPJ5_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A286Y1M5_MCL1-01      LPLLGLVGEAG-KSPSADGSLPSTPPPAE--EEEEEDALYRQSLEIISRY
P97287_MCL1-01          LPLLERVSEAA-KSSGADGSLPSTPPPPE--EEEDD--LYRQSLEIISRY
A0A452GA25_MCL1-02      RPLALMVGEASNNSPGSDGSLPSTPPPSE--EEEDE--LYRQSLEIISQY
G3T756_MCL1-01          FPRLGLVGEAS-NGPGTDGSLPSTPPLAE--EEEDE--LYRQSLEIISRY
A0A1S3F3I1_MCL1-01      LPLLELVGEAS-KSSRTDGSLPSTPPPAE--EEDDE--LYRQSLEIICRY
G1L3L7_MCL1-02          LPLLELVGEAS-GGPCTDGSLPSTPPPAE--EEEDE--LYRQSLEIISRY
A0A287BK44_MCL1-02      LPLLGLVEEAS-SGPGTDGSLPSTPPPAE--EEEDE--LYRQSLEIISRY
A0A287BK44_MCL1-01      LPLLGLVEEAS-SGPGTDGSLPSTPPPAE--EEEDE--LYRQSLEIISRY
B4DU51_MCL1-01          LPLLELVGESG-NNTSTDGSLPLTPPPAE--EEEDE--LYRQSLEIISRY
A0A287DCH9_MCL1-02      LPLLELVGEAA-KSPGADGSLPSTPPPAE--EEDDE--LYRQSLEIISRY
A0A287DCH9_MCL1-01      LPLLELVGEAA-KSPGADGSLPSTPPPAE--EEDDE--LYRQSLEIISRY
W5MMB7_MCL1-01          -SG------HADGSLPSTPDTPLDCGSVP---------------------
A0A3B3SG34_MCL1-01      -GST-----NAVGSLPTSPDGDLPAYGPI---------------------
Q4SW32_MCL1-01          -SE--------DGSLPCTPESHSGDVLDV---------------------
Q0KFR9_MCL1-01          -RSN-----N-DDSLPCTPQMASECGPEL---------------------
A0A3P8Y1W8_MCL1-02      -LAD-----DSDDSLPCTPLMVTECSAGL---------------------
A0A3P8Y1W8_MCL1-01      -LAD-----DSDDSLPCTPLMVTECSAGL---------------------
D2ITA0_MCL1-03          -QEG-------NGSLPSTPELQSEVDTD----------------------
D2ITA0_MCL1-04          -QEG-------NGSLPSTPELQSEVDTD----------------------
A0A3P9ILF6_MCL1-02      -DD--------DGSLPNTPEL--ECEASV---------------------
A0A3P9ILF6_MCL1-01      -DD--------DGSLPNTPEL--ECEASV---------------------
A0A3Q2XZL8_MCL1-01      -SDDDFDVESSDDSPPSTPDSQDSLVAD----------------------
A0A3B4AFB7_MCL1-02      -DYE-----NSEGSLPCTPEFHSDSEMEL---------------------
A0A3B3VM25_MCL1-01      -SD--------EGSLPCTPA-QQDSETVA---------------------
I3KXG5_MCL1-01          ---------LEDGSLPSTPE------------------------------
A0A3Q0R633_MCL1-01      -TDD-----VEDGSLPSTPEFHSDSES-----------------------
A0A3Q0R633_MCL1-03      -TDD-----VEDGSLPSTPEFHSDSES-----------------------
A0A3B4T8L9_MCL1-02      -SD------VDDGSLPCTPEIQSDGETDV---------------------
A0A3B4T8L9_MCL1-01      -SD------VDDGSLPCTPEIQSDGETDV---------------------
A0A3Q1EQB9_MCL1-02      -SDS-----MEDGSLPCTPELQSDSETDV---------------------
A0A3B4ZKP6_MCL1-01      -SDS-----LEDSSLPCTPELQSDSETDV---------------------
A0A3Q1BKL8_MCL1-02      -SDS-----MEEGSLPCTPELQSDSETDV---------------------
A0A3Q1EQB9_MCL1-01      -SDS-----MEDGSLPCTPELQSDSETDV---------------------
A0A3Q1BKL8_MCL1-01      -SDS-----MEEGSLPCTPELQSDSETDV---------------------
A0A3P8RQX7_MCL1-02      -SDS-----MEEGSLPCTPELQSDSETDV---------------------
A0A3P8RQX7_MCL1-01      -SDS-----MEEGSLPCTPELQSDSETDV---------------------
G3PJT0_MCL1-01          -SED-----TDNDSLPCTPESDSE--TDV---------------------
A0A3B3IJ04_MCL1-01      -HDV-----DDDGSLPNTPELECE--ASV---------------------
A0A3P9L1F3_MCL1-01      -HDV-----DDDGSLPNTPELECE--ASV---------------------
A0A3B3IJ04_MCL1-02      -HDV-----DDDGSLPNTPELECE--ASV---------------------
A0A3P9L1F3_MCL1-02      -HDV-----DDDGSLPNTPELECE--ASV---------------------
A0A3B3CEX1_MCL1-01      -HD------DDGGSLPNTPELECD--NSV---------------------
A0A3B3CEX1_MCL1-02      -HD------DDGGSLPNTPELECD--NSV---------------------
A0A3Q3VP02_MCL1-01      -TDT-----DDDGSLPYTPDMSPDSELNV---------------------
A0A3Q3B4P5_MCL1-01      ---G-----DDHGSLPSTPEVDGNPDVPG---------------------
A0A3Q3B4P5_MCL1-02      ---G-----DDHGSLPSTPEVDGNPDVPG---------------------
A0A3Q2EDX8_MCL1-01      -SAD------DGGSLPCTPEMPTDSHPAT---------------------
A0A3Q2P7X9_MCL1-01      -RDD--------GSLPSTPEMQADSEAAG---------------------
A0A3Q2P7X9_MCL1-02      -RDD--------GSLPSTPEMQADSEAAG---------------------
A0A3B5PQ55_MCL1-01      -SDD-----SDEGSLPCTPAQHPDSEKDA---------------------
A0A3B5PQ55_MCL1-02      -SDD-----SDEGSLPCTPAQHPDSEKDA---------------------
A0A3P9Q4I8_MCL1-01      -SDD-----SDEGSLPCTPAQQ-DGETDA---------------------
A0A3P9Q4I8_MCL1-02      -SDD-----SDEGSLPCTPAQQ-DGETDA---------------------
A0A087X830_MCL1-01      -SDD-----SDEGSLPCTPAQQ-DSETDA---------------------
A0A3B3YCD0_MCL1-01      -SDD-----SDEGSLPCTPAQQ-DSETDA---------------------
I3JHR5_MCL1-02          -RDR-----EEDGSLPSTPEYHLD--------------------------
I3JHR5_MCL1-03          -RDR-----EEDGSLPSTPEYHLD--------------------------
I3JHR5_MCL1-01          -RDR-----EEDGSLPSTPEYHLD--------------------------
A0A3Q4HLQ8_MCL1-01      -RDR-----EEDGSLPSTPEFHSD--------------------------
A0A3P8NP63_MCL1-02      -RDR-----EEDGSLPSTPEFHSD--------------------------
A0A3Q2VNL8_MCL1-01      -RDR-----EEDGSLPSTPEFHSD--------------------------
A0A3P8NP63_MCL1-01      -RDR-----EEDGSLPSTPEFHSD--------------------------
A0A3P9BVM3_MCL1-01      -RDR-----EEDGSLPSTPEFHSD--------------------------
A0A3B4G4Z6_MCL1-01      -RDR-----EEDGSLPSTPEFHSD--------------------------
A0A2U9CJ81_MCL1-01      GGGD-----VGGGSLPSTPESDGE--HDV---------------------
A0A3P8VKM5_MCL1-03      --CE-----VDEGSEPCTPEPHSE--AEL---------------------
A0A3P8VKM5_MCL1-04      --CE-----VDEGSEPCTPEPHSE--AEL---------------------
A0A3P8VKM5_MCL1-05      --CE-----VDEGSEPCTPEPHSE--AEL---------------------
A0A3Q3IZW0_MCL1-01      -VSD-----IDNGSLPCSPVLQPDNEIEV---------------------
A0A3Q1GX28_MCL1-02      -SDD-----IEDGSLPCTPELMSDSEVDV---------------------
A0A3Q1GX28_MCL1-01      -SDD-----IEDGSLPCTPELMSDSEVDV---------------------
A0A3B4XKA5_MCL1-01      --SD-----VDDGSLPCTPEMQSDGETDV---------------------
A0A3Q3GP42_MCL1-01      --DD-----IEDGSLPCTPEPDSE--TEV---------------------
A0A3Q3M6G2_MCL1-01      -TDD-----IEDGSLPCTPELQSD--SEA---------------------
A0A3Q3M6G2_MCL1-02      -TDD-----IEDGSLPCTPELQSD--SEA---------------------
A0A3B1IEV7_MCL1-01      --VS-----MGGGSLPDSPLADVDFIQDF---------------------
A0A3B4CGU9_MCL1-03      SKAA-----MAGGSLPESPESD-DFVPDF---------------------
A0A3B4CGU9_MCL1-02      SSSS-----AQTGS-PAAPELT-HVQVNSISISSTKEQTTISLCDGEVTV
Q8UWD6_MCL1-01          FAVD-----SLQGSVPSSPSDETGDYPP----------------------
A2BF68_MCL1-01          FAVD-----SLQGSVPSSPSDETGDYPP----------------------
Q568W5_MCL1-01          FAVD-----SLQGSVPSSPSDETGDYPP----------------------
A0A3B1K5R1_MCL1-01      GVDD--------GSVPSSPLSDCGEMAVG---------------------
A0A3B4C6H5_MCL1-03      -VTD--------GSLPTSPASDCEELDSD---------------------
A0A3B4C6H5_MCL1-01      -VTD--------GSLPTSPASDCEELDSD---------------------
Q9Z0F3_BCL2L10-01       --------PEPPPTSVEA--------------------------------
E1B9B3_BCL2L10-01       --------PAPAPSTPEA--------------------------------
A0A1U7QVA0_BCL2L10      --------PEPPPTSAEA--------------------------------
F1RZB9_BCL2L10-01       --------AARQPSSPEA--------------------------------
F1MV39_BCL2L10-01       --------PAPAPSTPEA--------------------------------
W5QIG4_BCL2L10-01       --------PAPAPSTPEA--------------------------------
Q99M66_BCL2L10-01       --------PEPLPTSVEA--------------------------------
F6ZPD4_BCL2L10-01       --------P-------EV--------------------------------
A0A2K6F2Q2_BCL2L10      --------PGLPPSSLEA--------------------------------
H0WZ06_BCL2L10-01       --------PEPTPSSPEA--------------------------------
A0A1U7UZD8_BCL2L10      --------PEPRPSSPEA--------------------------------
G1T264_BCL2L10-01       --------PEPQPSTPEA--------------------------------
A0A0D9RG38_BCL2L10      --------PEPRPSTPEA--------------------------------
A0A2K5RIU7_BCL2L10      --------PESPPATAEA--------------------------------
A0A2K5F974_BCL2L10      --------PESPPSTAEA--------------------------------
A0A2K6TIT7_BCL2L10      --------PESPPATAEA--------------------------------
F7CT87_BCL2L10-01       --------PESPPSTAEA--------------------------------
A0A096NM44_BCL2L10      --------PEPRPSTPEA--------------------------------
A0A2K6R5T5_BCL2L10      --------PEPRPSTPEA--------------------------------
Q9HD36_BCL2L10-02       --------PEPAPSTPEA--------------------------------
G1R3W6_BCL2L10-01       --------PEPTPSTPEA--------------------------------
A0A2K5K3B0_BCL2L10      --------PEPRPSTPEA--------------------------------
A0A2K6M5H5_BCL2L10      --------PEPRPSTPEA--------------------------------
A0A2K5TKG9_BCL2L10      --------PEPRPSTPEA--------------------------------
F7H6U5_BCL2L10-01       --------PEPRPSTPEA--------------------------------
A0A2K6B2D9_BCL2L10      --------PEPRPSTPEA--------------------------------
A0A2K5MMZ4_BCL2L10      --------PEPRPSTPEA--------------------------------
H2NN92_BCL2L10-01       --------PEPTPPTPEA--------------------------------
A0A2R9BCD9_BCL2L10      --------PEPTPSTPEA--------------------------------
H2Q9G4_BCL2L10-01       --------PEPTPSTPEA--------------------------------
G3QLU6_BCL2L10-01       --------PEPTPSTPEA--------------------------------
A0A337RYG8_BCL2L10      --------PARTPSTPEA--------------------------------
G1LKR4_BCL2L10-01       --------PARAPSTPEA--------------------------------
A0A452QJG0_BCL2L10      --------PARAPSTPEA--------------------------------
A0A3Q4MN81_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3B4ETX9_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3Q2PJS5_BCL2L10      --------PAPPPPSEPA--------------------------------
A0A3Q2GL87_BCL2L10      --------PAPPPPSEPA--------------------------------
A0A3B5MJ12_BCL2L10      --------PAPPPPSEPA--------------------------------
M4AUW7_BCL2L10-01       --------PAPPPPSEPA--------------------------------
A0A096ME02_BCL2L10      --------PAPPPPSEPA--------------------------------
A0A3B3TYN4_BCL2L10      --------PAPPPPSEPA--------------------------------
A0A3B3YT99_BCL2L10      --------PAPPPPSEPA--------------------------------
A0A3P9NE65_BCL2L10      --------PAPPPPSEPA--------------------------------
A0A3P9IIZ2_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3P9LM07_BCL2L10      --------QAPPPPSESA--------------------------------
H2MBQ3_BCL2L10-01       --------QAPPPPSESA--------------------------------
A0A3B4AAV4_BCL2L10      --------AAPPPPSGSA--------------------------------
A0A3Q3EZT5_BCL2L10      --------PAPPPPSMSA--------------------------------
A0A3Q3EZT5_BCL2L10      --------PAPPPPSMSA--------------------------------
A0A3Q3JQ78_BCL2L10      --------PAPPPPSESA--------------------------------
A0A3B4TIY6_BCL2L10      --------PAPPPPSESA--------------------------------
A0A3B4WGF4_BCL2L10      --------PAPPPPSESA--------------------------------
A0A3Q3KZW1_BCL2L10      --------SVPPPPSESA--------------------------------
A0A3B5KD08_BCL2L10      --------PAPPPPSESA--------------------------------
A0A3Q3VI28_BCL2L10      --------PAPPPPSESA--------------------------------
A0A3Q1GM98_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3Q1D2L0_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3P8RL82_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3B4ZFS0_BCL2L10      --------SAPPPPSESA--------------------------------
A0A3Q2UUN9_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3P8PVZ8_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3Q2UUN9_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3P9BLI0_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3Q0S9R1_BCL2L10      --------QVPPPPSESA--------------------------------
D2IT42_BCL2L10-02       --------TAPPPPSESA--------------------------------
A0A3B3C5I4_BCL2L10      --------QAPPPPSESA--------------------------------
A0A3Q1IAB0_BCL2L10      --------PAPPPPSESA--------------------------------
A0A3P8W7K5_BCL2L10      --------PAPPPPSESA--------------------------------
H3AAS7_BCL2L2-02        --------SQQGAPTD-P--------------------------------
H3AAS7_BCL2L2-01        --------SQQGAPTD-P--------------------------------
G1Q051_BCL2L2-01        --------VCGAGPGEGP--------------------------------
G3WPT1_BCL2L2-01        --------ACGTGPGEGP--------------------------------
A0A287D9B3_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A482LX62_BCL2L2-      --------VCGAGPGEGP--------------------------------
W5QDH4_BCL2L2-02        --------VCGAGPGEGP--------------------------------
Q7TS60_BCL2L2-01        --------VCGAGPGEGP--------------------------------
G1LMC3_BCL2L2-01        --------VCGAGPGEGP--------------------------------
M3Y5X5_BCL2L2-01        --------VCGAGPGEGP--------------------------------
G1P3J2_BCL2L2-01        --------VCGAGPGEGP--------------------------------
G3WPT1_BCL2L2-02        --------ACGTGPGEGP--------------------------------
G1TV33_BCL2L2-01        --------VCGAGPGEGP--------------------------------
P70345_BCL2L2-01        --------VCGAGPGEGP--------------------------------
O88996_BCL2L2-01        --------VCGAGPGEGP--------------------------------
A0A3Q9B4M8_BCL2L2-      --------VCGAGPGEGP--------------------------------
H0XR82_BCL2L2-01        --------VCGAGPGEGP--------------------------------
A0A250YBR2_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A250YBR2_BCL2L2-      --------VCGAGPGEGP--------------------------------
L8HP19_BCL2L2-02        --------VCGAGPGEGP--------------------------------
L8HP19_BCL2L2-01        --------VCGAGPGEGP--------------------------------
Q1RMX3_BCL2L2-01        --------VCGAGPGEGP--------------------------------
A0A452ECF0_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A286XQQ9_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K5RUN8_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K5MZX9_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A0D9RU30_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K5HEJ9_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A1S3FYD8_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2I2UAE3_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2I2YPX6_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A287D9B3_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K5V0Q3_BCL2L2-      --------VCGAGPGEGP--------------------------------
F7G4L5_BCL2L2-01        --------VCGAGPGEGP--------------------------------
A0A2K6EA59_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K6AI25_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A1U7RC37_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2I3GEA7_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2R9A2Q3_BCL2L2-      --------VCGAGPGEGP--------------------------------
H2Q805_BCL2L2-01        --------VCGAGPGEGP--------------------------------
A0A096NX09_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K6GWM6_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K6ME72_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K6RW35_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K6RW35_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K6TM77_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A287ATE4_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A1U7UJF2_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A452SHI1_BCL2L2-      --------VCGAGPGEGP--------------------------------
Q05KI8_BCL2L2-01        --------VCGAGPGEGP--------------------------------
Q2TAP5_BCL2L1-01        --------RPGEGATQGI--------------------------------
Q91828_BCL2L1-01        --------RPGEGATQGI--------------------------------
I7GKS6_BCL2L1-01        ----MWK-RTGLRPQKGL--------------------------------
A0A2K5EBP4_BCL2L1-      ----MWK-RTGLRPQKGL--------------------------------
A0A2K5Q6R6_BCL2L1-      ----MWK-RTGLRPQKGL--------------------------------
A0A2K6UWY8_BCL2L1-      ----MWK-RTGLRPQKGL--------------------------------
Q5XGJ4_BCL2L2-01        --------VPEPA---GA--------------------------------
F7G6M3_BCL2L2-01        --------ACGAGPGEGP--------------------------------
A0A2K5CWY6_BCL2L2-      --------VCGAGPGEGP--------------------------------
A0A2K5CWY6_BCL2L2-      --------VCGAGPGEGP--------------------------------
G3TMU7_BCL2L2-01        --------VCGAGPGEGP--------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      -GNPSWH-LADSPTVNGA--------------------------------
H9GHK7_BCL2L1-01        -GSPSWH-PSPSHVINGA--------------------------------
Q07816_BCL2L1-04        -GSPSWH-PPAGHVVNGA--------------------------------
A0A493TIA6_BCL2L1-      -GSPSWH-PPAGQVVNGA--------------------------------
Q07816_BCL2L1-02        -GSPSWH-PPAGHVVNGA--------------------------------
Q07816_BCL2L1-03        -GSPSWH-PPAGHVVNGA--------------------------------
Q07816_BCL2L1-01        -GSPSWH-PPAGHVVNGA--------------------------------
G1N5N5_BCL2L1-01        -GSPSWH-PPAGHVVNGA--------------------------------
A0A452ILL8_BCL2L1-      -GSPSWH-PGASHIVNGA--------------------------------
A0A452ILL8_BCL2L1-      -GSPSWH-PGASHIVNGA--------------------------------
K7F655_BCL2L1-01        -GSPSWH-PGASHVVNGA--------------------------------
A0A452E1B1_BCL2L1-      -GNPSWH-LADSSVVNGA--------------------------------
W5PSA5_BCL2L1-01        -GNPSWH-LADSPVVNGA--------------------------------
P53563_BCL2L1-03        -GNPSWH-LADSPAVNGA--------------------------------
P53563_BCL2L1-02        -GNPSWH-LADSPAVNGA--------------------------------
A0A287CZ07_BCL2L1-      -GNPSWH-LADSPAINGA--------------------------------
F6WA14_BCL2L1-01        -GSPSWH-PADSRAVSGA--------------------------------
G3WKX6_BCL2L1-01        -GSPSWH-PADSRAVSGA--------------------------------
M3XA94_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
M3XA94_BCL2L1-02        -GNPSWH-LADSPAVNGA--------------------------------
A0A3Q2H0F6_BCL2L1-      -GNPSWH-LADSPTGNGA--------------------------------
H0X6V2_BCL2L1-01        -GNPSWH-LADSPTVNGA--------------------------------
G3SPN0_BCL2L1-01        -GNPSRH-LADSPAVNGA--------------------------------
Q2PFS6_BCL2L1-01        -GNPSWH-LVDSPAVNGA--------------------------------
O35843_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
M3XA94_BCL2L1-03        -GNPSWH-LADSPAVNGA--------------------------------
G1RER8_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
A0A1S2ZQT6_BCL2L1-      -GNPSWH-LADSPALNGA--------------------------------
Q64373_BCL2L1-09        -GNPSWH-LADSPAVNGA--------------------------------
Q64373_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
P53563_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
O77737_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
Q9MYW4_BCL2L1-01        -GNPAWH-PADSPAVNGA--------------------------------
A0A3Q2H0F6_BCL2L1-      -GNPSWH-LADSPTGNGA--------------------------------
L8J061_BCL2L1-01        -GNASWH-LADSPAVNGA--------------------------------
Q05KJ0_BCL2L1-01        -GNASWH-LADSPAVNGA--------------------------------
Q05KJ0_BCL2L1-02        -GNASWH-LADSPAVNGA--------------------------------
E2IV76_BCL2L1-01        -GNPSWH-LADSPPANGA--------------------------------
A0A2K6G3C5_BCL2L1-      -GNPSWH-LADSPPANGA--------------------------------
B2Z3Z4_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
G3HEA7_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
G3HEA7_BCL2L1-02        -GNPSWH-LADSPAVNGA--------------------------------
A0A1U7T4L4_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
M3Z2H9_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
A0A1U7QU73_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A0D9RJZ8_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A286Y5D6_BCL2L1-      -GNPSWH-LTDSPTVNGA--------------------------------
A0A250YD48_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A1L5BWY3_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
I3MUP5_BCL2L1-02        -GNPSWH-LADSPAVNGA--------------------------------
I3MUP5_BCL2L1-03        -GNPSWH-LADSPAVNGA--------------------------------
I3MUP5_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
G1P9D2_BCL2L1-01        -GNPSWH-LVDSPAVNGA--------------------------------
A0A2K5EBP4_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
E2IV75_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
F7IT34_BCL2L1-01        -GNPSWH-LADSPVVNGA--------------------------------
Q76LT7_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
A0A2K5Q6R6_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A2K5Q6R6_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A2K5M8B1_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A2K5H963_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
Q8SQ42_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
A0A2K5VPG2_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A2K5YR37_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A2R8Z9D7_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A096NV05_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A2J8VIH3_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A2K6QFA2_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A2K6QFA2_BCL2L1-      -GNPSWH-LVDSPAVNGA--------------------------------
A0A2K6UWY8_BCL2L1-      -GNPAWH-LADSPAVNGA--------------------------------
E2IV77_BCL2L1-01        -GNPAWH-LADSPAVNGA--------------------------------
A0A452SDS4_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A384D3U1_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
A0A452FWV3_BCL2L1-      -GNPSWH-LADSPAVNGA--------------------------------
Q9MZS7_BCL2L1-01        -GNPSWH-LADSPAVNGA--------------------------------
A0A3B3E2W4_BCL2L1-      ------S-ATCNGTLVNS--------------------------------
A0A3B3I2Q5_BCL2L1-      ------S-DARNRRLVSS--------------------------------
A0A3P9I2N4_BCL2L1-      ------S-AARNGRQVSS--------------------------------
A0A3P9MKK4_BCL2L1-      ------S-AARNGRPVSS--------------------------------
A0A3B5B4X7_BCL2L1-      ------S-AASNGLLVNS--------------------------------
A0A3B4BFZ8_BCL2L1-      ------N-VP-NGMLTNR-N-GNRQTLAS---------------------
A0A3Q3FUB6_BCL2L1-      ------S-AASNGFLVNS-RNRAGQSVMS---------------------
A0A3B5MGS2_BCL2L1-      ------R-VPRNGPLVNS---WAGHPGKP---------------------
M4A558_BCL2L1-01        ------R-VPSNGRLVNS---RAGPPGKP---------------------
A0A3P9QFB3_BCL2L1-      ------R-GPSNGPLVNS---RAGSRGKS---------------------
A0A087YBW4_BCL2L1-      ------R-GPSNGPLVNS---WAGSPGKS---------------------
A0A3B3VWI7_BCL2L1-      ------R-GPSNGPLVNS---WAGSPGKS---------------------
A0A3B3XN57_BCL2L1-      ------R-GPSNGPLVNS---WAGSPGKS---------------------
A0A3Q2C6K4_BCL2L1-      ------S-ASSNGPLFNS---RPSPPGKP---------------------
A0A3Q2NRP4_BCL2L1-      ------P-ASSNGPLVSS---WAGSPWQP---------------------
A0A0B4KJI5_BCL2L1-      ------S-AATNGLLANS-SNGGGQPGAD---------------------
A0A3Q1JZ46_BCL2L1-      ------S-AAANGLPVS----RSGELGNS---------------------
A0A3Q1JZ46_BCL2L1-      ------S-AAANGLPVS----RSGELGNS---------------------
A0A3Q3NFM4_BCL2L1-      ------A-AATNGLLVNS-RYVSGRPGMS---------------------
A0A3Q3NFM4_BCL2L1-      ------A-AATNGLLVNS-RYVSGRPGMS---------------------
A0A3B4V9K8_BCL2L1-      ------S-AASNGLLVNS-SDRCGQPGTS---------------------
A0A3B4XS24_BCL2L1-      ------S-AASNGLLVNS-SDRCGQPGTS---------------------
A0A2U9BY16_BCL2L1-      ------A-PHANGTLNGV---NPG--TPP---------------------
C1BLI0_BCL2L1-01        ------V-SPVNGSVEND-RNCIGSLGIS---------------------
C0HAD8_BCL2L1-01        --------AIANGSVGNS-RS---NLAKP---------------------
A0A3B3ZMX9_BCL2L1-      ------L-GLGDRSVDRN--------STP---------------------
A0A3B3TFR4_BCL2L1-      ------V-AHANGSVSSGNSVGQG--APL---------------------
H3CH49_BCL2L1-01        ------T-TQSNGTFNGA---SPG--TPP---------------------
A0A3Q2FR43_BCL2L1-      ------E-THANGTFNGT---SPG--SP----------------------
A0A3P8XYL5_BCL2L1-      ------T-MHPNGTMNGT--SPGT--PTQ---------------------
Q90Z98_BCL2L1-02        ------T-TLVNGTMNRTNASSTG--TPP---------------------
Q90Z98_BCL2L1-01        ------T-TLVNGTMNRTNASSTG--TPP---------------------
A0A059PJI5_BCL2L1-      -ESETPT-AVVNGTLNGT--GSAG--TPP---------------------
A0A3B4DTL9_BCL2L1-      --AVTPT-AVVNGSVNGT--SHG----PA---------------------
B5XAY3_BCL2L1-01        ------L-TYVNGTSPGT---PPPRQSPP---------------------
W5MG74_BCL2L1-01        ------E-ERTNGAANGG---GGP--VSR---------------------
A0A3Q3B3X5_BCL2L1-      ------E-THANGTFNGT---SPG--TPP---------------------
A0A3B3IB64_BCL2L1-      ------E-THANGTFNGT---TPG--TPP---------------------
A0A3P9JYH1_BCL2L1-      ------E-THANGTFNGT---TPG--TPP---------------------
A0A3B3DHA1_BCL2L1-      ------E-THANGTFNGT---SPG--TPP---------------------
A0A3Q0RTF8_BCL2L1-      ------D-THANGTFNGT---SPG--TPP---------------------
I3IZK7_BCL2L1-01        ------D-THANGTFNGT---SPG--TPP---------------------
A0A2U9BY16_BCL2L1-      ------A-PHANGTLNGV---NPG--TPP---------------------
A0A2U9BY16_BCL2L1-      ------A-PHANGTLNGV---NPG--TPP---------------------
A0A2U9BY16_BCL2L1-      ------A-PHANGTLNGV---NPG--TPP---------------------
A0A0D6DR75_BCL2L1-      ------A-THANGTFNGR---SPG--TPP---------------------
A0A3Q3WIW8_BCL2L1-      ------A-THANGTFNGT---SPG--TPP---------------------
A0A219P0Y3_BCL2L1-      ------A-THANGTFNGM---SPG--TPP---------------------
A0A3Q3MX20_BCL2L1-      ------A-THANGTFNGT---SPG--TPP---------------------
A0A3Q3G2E1_BCL2L1-      ------A-THANGTFNGT---SPG--TPP---------------------
A0A3Q3G2E1_BCL2L1-      ------A-THANGTFNGT---SPG--TPP---------------------
A0A3Q3G2E1_BCL2L1-      ------A-THANGTFNGT---SPG--TPP---------------------
A0A3Q1GZ93_BCL2L1-      ------A-THANGTFNGR---SPG--TPP---------------------
A0A3Q1GZ93_BCL2L1-      ------A-THANGTFNGR---SPG--TPP---------------------
A0A3Q1GZ93_BCL2L1-      ------A-THANGTFNGR---SPG--TPP---------------------
A0A3B4V3T1_BCL2L1-      ------A-THANGTFNGT---SPG--TRA---------------------
A0A3B4XU17_BCL2L1-      ------A-THANGTFNGT---SPG--TRP---------------------
H3ANS8_BCL2L1-01        -MDPPNG-SHPHAGLNGA--------VNG---------------------
A0A452FHY1_BCL2L1-      -ANPSWH-LAHSPAVNGA--------------------------------
A0A452FHY1_BCL2L1-      -ANPSWH-LAHSPAVNGA--------------------------------
A0A1S3EPX7_BCL2L1-      -GNPSWHLADSPAVVNGA--------------------------------
A0A218USB3_BCL2L1-      -GSPSWH-AATSHIVNGA--------------------------------
A0A218USB3_BCL2L1-      -GSPSWH-AATSHIVNGA--------------------------------
U3JSL7_BCL2L1-01        -GSPSWH-APTSHIVNGA--------------------------------
A0A218USB3_BCL2L1-      -GSPSWH-AATSHIVNGA--------------------------------
A0A218USB3_BCL2L1-      -GSPSWH-AATSHIVNGA--------------------------------
H0Z8G3_BCL2L1-01        -GSPSWH-AATSHIVNGA--------------------------------
Q4U2V6_BCL2L1-01        -GSPSWH-AATSHIVNGA--------------------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q568V1_MCL1-01          -GLQLDGRFVSTTDGSLPTTPDPEELDYA---------------------
Q1L8X3_MCL1-01          -GLQLDGRFVSATDGSLPTTPDPEELDYA---------------------
Q9I9N3_MCL1-01          -GLQLDGRFVSATDGSLPTTPDPEELDYA---------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      -RRDCEHHLRASGNEDGSLPSTPGTPPDC---------------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      -K--A----------GQGSVPHISK-WLS---------------------
A0A3P8WUE9_BCL2-01      -T-GP----------GNDGIPNLCK-RPP---------------------
A0A3B4A3G8_BCL2-01      -R----------------------L-CSA---------------------
A0A3Q3G1D7_BCL2-01      -S-GP----------DRESIPHLCK-RPP---------------------
A0A3Q2XQX2_BCL2-02      ------------------------D-RSH---------------------
A0A3Q2XQX2_BCL2-01      -S-GP----------ERDCAP---K-RSH---------------------
A0A3Q3B0R2_BCL2-01      -G-APGGAGTAPPDAESDPDPVLCG-RIS---------------------
A0A3Q2PN77_BCL2-01      -APGQ----------DSDGDPRRVRGRLS---------------------
A0A3P9J8Y9_BCL2-01      -T-GP----------DEESSPRLIR-ALS---------------------
A0A3Q0S5Z7_BCL2-01      -N-GP----------DGESNTHLCR-RLP---------------------
A0A3P8QVM8_BCL2-01      -T-GP----------DGESNTHLCR-RLP---------------------
A0A3P9DIG5_BCL2-01      -T-GP----------DGESNTHLCR-RLP---------------------
A0A3Q2UYW8_BCL2-01      -T-GP----------DGESNTHLCR-RLP---------------------
A0A3B4G3K4_BCL2-01      -T-GP----------DGESNTHLCR-RLP---------------------
A0A2U9BJ09_BCL2-01      -T-GP----------DDESHPDLCR-RPP---------------------
A0A3Q1I5N1_BCL2-01      -T-GP----------DSDSIPQHCR-RLP---------------------
A0A3Q3K1K1_BCL2-01      -T-GP----------DSESTPHRCK-RPP---------------------
A0A3Q3MEY1_BCL2-01      -T-GP----------DSESIPQLCR-GLP---------------------
A0A1X9JZA1_BCL2-01      -T-GP----------DSESIPHLCT-RLP---------------------
A0A4D6FTA2_BCL2-01      -T-GP----------DTESIPHLCK-RLP---------------------
A0A3Q1FLK7_BCL2-01      -T-GP----------DNESDPHLCR-RLP---------------------
A0A3Q1B8C3_BCL2-01      -T-GP----------DNESDPHLCR-RLP---------------------
A0A3P8S9L3_BCL2-01      -T-GP----------DNESDPHLCR-RLP---------------------
A0A3B5BBQ0_BCL2-01      -T-GP----------DNESDPHLCR-RLP---------------------
A0A3B4TX71_BCL2-01      -T-GP----------DNDSSPNLCR-RLS---------------------
A0A3B4YAG2_BCL2-01      -T-GP----------DNDSSPNLCR-RLS---------------------
G1TW27_BCL2-02          -APRDP--------------AARTSPPPP---------------------
E2RS00_BCL2A1-02        -RQPRPHRASGSSRGTRLPSRRAGGPRMT---------------------
A0A3B3TCS4_BCL2-01      -PGSQVLARRSQAAAAGGEDASPVRSRTP---------------------
A0A0U3DHY6_BCL2-01      -NTPEVFARRSQPTAAVEDTDSPFQNRSP---------------------
A0A3P9AAB2_BCL2-01      -NSPELFARRLQPPAAGEDNDPQFANRIP---------------------
X4ZGI8_BCL2-01          -GGNNSECLIANRVTRSDPYS-----------------------------
A0A3P9MKK4_BCL2L1-      -PCCAS--------------------------------------------
A0A3B3I2Q5_BCL2L1-      -PCCAS--------------------------------------------
A0A3P9I2N4_BCL2L1-      -PCCAS--------------------------------------------
A0A3B4AFB7_MCL1-01      -SLPCTPEFHSDSEMELSSYSAEHEVLES---------------------
G3TVG9_MCL1-01          -ALPLLVLVGEASNCPGTHGALPSTQPPA---------------------
B9ZYL7_BCL2-01          -SLASAASSDEETPSNTPITFVGNAPAVP---------------------
A0A3L7HT14_BCL2A1-      -SRVLQ--------------------------------------------
F6YNL8_BCL2-01          -PLPAA----A---------------------------------------
A0A218UQA0_BCL2-01      -IAAAG------TSDHTGLVSPHPEPPGS---------------------
Q00709_BCL2-01          -AVAAA----GASSHH------RPEPPGS---------------------
A0A493T1X3_BCL2-01      -AAAGT----PSRHRPAGLLSPHPEPPGS---------------------
U3KEW4_BCL2-01          -VAAAA----GTSSDHTGPVSPHPEPPGS---------------------
G3WZW9_BCL2-01          -PLPAA----PQDLATSTTAAARNSPLPP---------------------
M3YYK3_BCL2-01          -PPPLS----RHR------RPQLTSPATA---------------------
M3X1R9_BCL2-02          -PAP-----------------ARTSPPPP---------------------
A0A2K6R2I5_BCL2-02      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          -RGPD----------------TRTSPLQA---------------------
Q75SV7_BCL2-01          -PAP-----------------ARTSPPPP---------------------
M3X1R9_BCL2-01          -PAP-----------------ARTSPPPP---------------------
Q8I008_BCL2-01          -PAP-----------------ARTSPPPP---------------------
A0A076FU27_BCL2-01      -PAP-----------------SRTSPPPP---------------------
A0A4P8GLJ2_BCL2-01      -PAP-----------------SRTSPPPP---------------------
F6R2C4_BCL2-01          -PAP-----------------SRTSPPPP---------------------
O02718_BCL2-01          -PAP-----------------SRTSPPPP---------------------
A0A076FZV9_BCL2-01      -PAP-----------------SRTSPPPP---------------------
A0A452EV13_BCL2-01      -PAP-----------------SRTSPPPP---------------------
A0A250YD83_BCL2-01      -PLPAA----PRD------RAARTTSLPP---------------------
A9QXG9_BCL2-01          -PHPAA----SRD------PVARTSPLQT---------------------
A0A2K5NZS5_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A0D9S017_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2K6CIX3_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2K5XRD4_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2K6KHG1_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2K6R2I5_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2K5HK49_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
G3QES9_BCL2-01          -PHPAA----SRD------RVARTSPLQT---------------------
H2QEM8_BCL2-01          -PHPAA----SRD------PVARTSPLQT---------------------
A0A2I3GZF9_BCL2-01      -PHPAA----SRD------PVARTSPLPT---------------------
A0A2K6UEL3_BCL2-01      -PGPAA----PRD------PVARTXXXXX---------------------
E2QWA1_BCL2-01          -PPPPG----P--------------PAAA---------------------
G1LIC9_BCL2-01          -PRPFV----RRW------QVAP--PSAA---------------------
A0A452R110_BCL2-01      -PRPPG----PRR------LPPPAAPAAA---------------------
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
M3Y8D1_BCL2L10-01       ----------------------PGTPARS---------------------
A0A3Q2Y539_MCL1-01      -VLDTE----TRRLIGRFLRDFTGLSTAA---------------------
A0A3Q3BEB7_BCL2L1-      -GLLVN----SRDGQS----------------------------------
A0A3P8VMA1_BCL2L1-      -GVPQT----PSAVLQ----------------------------------
A0A345BSW9_BCL2L1-      -GTTTL----VNGSMN----RTPPQSPAT---------------------
A0A286MU87_BCL2L1-      -GNYR------NSRSN----LAKPSSP-----------------------
A0A3P8XFS0_BCL2L1-      -GNGR------NSRRN----LGKPSTP-----------------------
A0A3P8XFS0_BCL2L1-      -GNGR------NSRRN----LGKPSTP-----------------------
A0A0F7L1T6_BCL2L1-      -GLLVR----SRNRGG------ASPSA-----------------------
H2U5I3_BCL2L1-01        -GLLVR----SRNRGG------ASPSA-----------------------
A0A3Q3J5K3_BCL2L1-      -GLG----------------------------------------------
A0A3Q1EVP6_BCL2L1-      -GLLVN------NRDG----------------------------------
A0A3Q1BQA0_BCL2L1-      -GLLVN------SRGG----------------------------------
A0A3P8U812_BCL2L1-      -GLLVN------SRGG----------------------------------
E6ZFR0_BCL2L1-01        -GLLAS----KNTSGQ----PGTSSSS-----------------------
G3P7B4_BCL2L1-01        -GRGSS----AGQPGM----SSPPPPP-----------------------
A0A3Q3X5M5_BCL2L1-      -GLLVN----SSSRGG------LSPST-----------------------
A0A2U9BIG9_BCL2L1-      -GLLVD----GGNRCGQLGTDPLPPDG-----------------------
D2ITA2_BCL2L1-02        -NGQLA----PSPTPQGTE-------------------------------
A0A3B3ZMX9_BCL2L1-      -QRETE----VDSTELRLDSASDSAPVHS---------------------
G3NJY1_BCL2L1-01        -RGATH----SNGTFNGTS---PGTPPAS---------------------
A0A2U9BY16_BCL2L1-      -QTAPH----ANGTLNGVN---PGTPPES---------------------
A0A3Q3DUT7_BCL2L1-      -RVQTP----ANGTTNGTS------PPAS---------------------
A0A3Q3DUT7_BCL2L1-      -RVQTP----ANGTTNGTS------PPAS---------------------
A0A3Q3DUT7_BCL2L1-      -RVQTP----ANGTTNGTS------PPAS---------------------
A0A3B1JJ42_BCL2L1-      -AAGVTPTAVVNGSVNGTSHGAAGSPTSS---------------------
A0A3P8UWG7_BCL2L1-      -RTSTH----ANGTVNGTS---SGTPPAS---------------------
A0A3Q3IVF5_BCL2L1-      ----TH----ANGTFNGTS---PGTPPAS---------------------
A0A3Q1DHJ3_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3Q1DHJ3_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3Q1DHJ3_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3P8TL99_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3P8TL99_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3Q1FR00_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3B4Z3X2_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
A0A3B4Z3X2_BCL2L1-      -RTETH----ANGTFNGTS---PGTPPPS---------------------
C3VIT1_BCL2L1-01        -STETH----ANGTFTGTS---PGTPPVS---------------------
A0A3P8P0F1_BCL2L1-      -RIDTH----ANGTFNGTS---PGTPPAS---------------------
A0A3Q2X557_BCL2L1-      -RIDTH----ANGTFNGTS---PGTPPAS---------------------
A0A3P9D632_BCL2L1-      -RIDTH----ANGTFNGTS---PGTPPAS---------------------
A0A3P9D632_BCL2L1-      -RIDTH----ANGTFNGTS---PGTPPAS---------------------
A0A3Q4N4B5_BCL2L1-      -RIDTH----ANGTFNGTS---PGTPPAS---------------------
A0A3B4FNX1_BCL2L1-      -RIDTH----ANGTFNGTS---PGTPPAS---------------------
A0A3Q2QPL9_BCL2L1-      -TAETH----ANGTVNGTS---SGSPRRR---------------------
A0A3B5PQJ0_BCL2L1-      -TLETH----ANGTFNGTS---PGSPRR----------------------
A0A087X9B7_BCL2L1-      -TLETH----ANGTFNGTS---PGSPRR----------------------
A0A3B3TUS7_BCL2L1-      -TLETH----ANGTFNGTS---PGSPRR----------------------
A0A3B3WI27_BCL2L1-      -TLETH----ANGTFNGTS---PGSPRR----------------------
A0A3P9N9Y4_BCL2L1-      -TLETH----ANGTFNGTS---PGSPRR----------------------
A0A3B3QRZ2_BCL2L1-      -NGSVI----AGGTSSQVS---PVPEQ-----------------------
Q564A4_BCL2-01          -SPNSD----RRLQAPSAG---GGNNSEC---------------------
H9GPE7_BCL2-01          -NAPRE----EPD-------------------------------------
A0A452I9V7_BCL2-01      -GLMSL----PPEPPGSAA---ASNVP-----------------------
W5N4F7_BCL2-01          -GAERG----AVPVPRRTP---PPDPH-----------------------
K7F5Y3_BCL2-02          -GLVSL----PPEPPGSAA---ASNVP-----------------------
A0A3Q2HRY3_BCL2-02      -PAP-----------ARTS---PLLPP-----------------------
K7F5Y3_BCL2-01          -GLVSL----PPEPPGSAA---ASNVP-----------------------
F1LNV0_BCL2-01          -RTPAV----HRDTAARTS---PLRPL-----------------------
P49950_BCL2-01          -RTPAV----HRDTAARTS---PLRPL-----------------------
G1TW27_BCL2-01          --APAA----PRDPAARTS---PPPPP-----------------------
A0A2K5EB04_BCL2-01      -PGPAA----PRDPVSRTS---PPPPP-----------------------
A0A2R8MY14_BCL2-01      -PGPAA----PRDPVARTS---PPPPP-----------------------
H2NWH5_BCL2-01          -PHPAA----SRDP-ARTS---PLPTP-----------------------
A0A096MPU7_BCL2-01      -PHPAA----SRDPVARTS---PLPTP-----------------------
A0A2K5PP81_BCL2-01      -PGPAA----PRDPVARTS---PPSPP-----------------------
H0WKI0_BCL2-01          -PTPAA----PRDPAARTS---PPAAP-----------------------
A0A2K5UDI5_BCL2-01      -PHPAA----SRDPVARTS---PLPTPAA---------------------
P10417_BCL2-01          -PMPAV----HRDMAARTS---PLRPL-----------------------
Q7TSN8_BCL2-01          -PMPAV----HRDMAARTS---PLRPL-----------------------
A0A3Q2HRY3_BCL2-01      -PAPA------RTSPLLPP---A--AP-----------------------
E2QWA1_BCL2-02          -XXXXX----XXXXXXXXX---X--XX-----------------------
A0A2K6G3I7_BCL2-01      -PPPAA----PRDPAARTS---P--PP-----------------------
Q6R755_BCL2-01          -PTPAV----HRDMAARTS---PLRPI-----------------------
Q9JJV8_BCL2-01          -PTPAV----HRDMAARTS---PLRPI-----------------------
Q923R6_BCL2-01          -PTPAV----HRDMAARTS---PLRPI-----------------------
H0W1T3_BCL2-01          ----------PRDPAARTS---PPPPL-----------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          ----------SHTPAARTS---PPPPP-----------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
H0ZCL9_BCL2A1-01        --------------------------------------------------
U3JTB2_BCL2A1-01        --------------------------------------------------
A0A218V8Z6_BCL2A1-      --------------------------------------------------
Q9W6F2_BCL2A1-01        --------------------------------------------------
A0A493SSZ7_BCL2A1-      --------------------------------------------------
G1N8C5_BCL2A1-01        --------------------------------------------------
A0A452J3N6_BCL2A1-      --------------------------------------------------
K7G130_BCL2A1-01        --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
G3WSP8_BCL2A1-01        --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
O55178_BCL2A1-01        --------------------------------------------------
Q0P538_BCL2A1-01        --------------------------------------------------
G3V977_BCL2A1-01        --------------------------------------------------
Q925A9_BCL2A1-01        --------------------------------------------------
Q07440_BCL2A1-01        --------------------------------------------------
O55179_BCL2A1-01        --------------------------------------------------
O55177_BCL2A1-02        --------------------------------------------------
Q497M6_BCL2A1-01        --------------------------------------------------
Q8K164_BCL2A1-01        --------------------------------------------------
Q4FK02_BCL2A1-01        --------------------------------------------------
A0A452SIR9_BCL2A1-      --------------------------------------------------
M3YVH4_BCL2A1-01        --------------------------------------------------
U6CQS8_BCL2A1-01        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
G3T8E6_BCL2A1-01        --------------------------------------------------
H0WZ23_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
B4E1X9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2K6TLJ5_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A452EK63_BCL2A1-      --------------------------------------------------
W5Q0N6_BCL2A1-01        --------------------------------------------------
L8IZT5_BCL2A1-01        --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
C7F841_BCL2A1-01        --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5TMD1_BCL2A1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A0D9RRC3_BCL2A1-      --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q1FR00_BCL2L1-      -RRLASTATMD---------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
H3AR18_MCL1-01          LCEVA-GCEST------------------------------------ETA
J7H260_MCL1-01          FREWAGDAKQE------------------------------------D--
G1PZ39_MCL1-01          -REQATGAKDA------------------------------------KPL
Q95KR3_MCL1-01          --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
Q9Z1P3_MCL1-01          LREQATGSKDA------------------------------------KPL
A5PJR2_MCL1-01          LREQATGAKDA------------------------------------KPL
A0A452GA25_MCL1-01      LLEQATGAKDA------------------------------------KPL
G1L3L7_MCL1-01          LREQATGAKDA------------------------------------KPL
G1T2Q0_MCL1-01          LREQATGAKDA------------------------------------KPM
F7AVA6_MCL1-01          LREQATGTKDT------------------------------------KPM
A0A337S3J9_MCL1-01      LREQATGAKDA------------------------------------KPL
A0A337S3J9_MCL1-03      LREQATGAKDA------------------------------------KPL
Q7YRZ9_MCL1-01          LREQATGAKDA------------------------------------KPL
F1PAP1_MCL1-01          LREQATGAKDA------------------------------------KPL
Q8HYS5_MCL1-01          LREQATGAKDA------------------------------------KPL
M3XZZ5_MCL1-01          LREQATGAKDA------------------------------------KPL
A0A452RHX5_MCL1-01      LREQATGAKDA------------------------------------KPL
H0XFB7_MCL1-01          LREQATGAKDA------------------------------------KPM
F7GTF7_MCL1-01          LREQATGAKDT------------------------------------KPM
A0A2K5CFH3_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K6V5Y3_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K6KRW9_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K5XSB2_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A0D9RZP5_MCL1-01      LREQATGAKDT------------------------------------KPM
I7G687_MCL1-01          LREQATGAKDT------------------------------------KPM
A0A2K5LXU8_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2I3GJZ3_MCL1-02      LREQATGAKDT------------------------------------KPM
H2N5Y9_MCL1-01          LREQATGAKDT------------------------------------KPL
A0A2R9BPJ5_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2I3RTV4_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2I2YQH7_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K5C7L5_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K5I9I0_MCL1-02      LREQATGAKDT------------------------------------QPM
A0A2K6GI15_MCL1-01      LREQATGAKDA------------------------------------KPM
A0A2I3GJZ3_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K5CFH3_MCL1-03      LREQATGAKDT------------------------------------KPM
A0A2K5R5E2_MCL1-03      LREQATGAKDT------------------------------------KPM
A0A2K5W0W9_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K6ECR0_MCL1-02      LREQATGAKDT------------------------------------KPM
A0A2I3LFM0_MCL1-01      LREQATGAKDT------------------------------------KPM
A0A2K6KRW9_MCL1-02      LREQATGAKDT------------------------------------KPM
A0A2K6PPI3_MCL1-02      LREQATGAKDT------------------------------------KPM
G3WBC5_MCL1-01          LREQAVGTKDT------------------------------------KPL
W5QI41_MCL1-01          LLEQATGTKDA------------------------------------KPL
F1MQX4_MCL1-01          LREQATGAKDV------------------------------------KPL
B4DLY8_MCL1-01          -RVARPPPKDT------------------------------------KPM
B4DG83_MCL1-01          LREQATGAKDT------------------------------------KPM
B4E3L8_MCL1-01          LREQATGAKDT------------------------------------KPM
A0A2K5DMS4_MCL1-01      ----ATGAKDT------------------------------------KPM
U3KKY6_MCL1-01          --------------------------------------------------
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          LCEVAGCESTE--------------------------------------T
E2RS00_BCL2A1-01        LQIPQPGPAPS---------------------------------------
B6V6J0_MCL1-01          YRVYSGEESGE---------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
H0XHA5_MCL1-01          --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K6GWM6_BCL2L2-      --------------------------------------------------
W5QDH4_BCL2L2-01        --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2R9A2Q3_BCL2L2-      --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A287ATE4_BCL2L2-      --------------------------------------------------
A0A4D6NWN1_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A452UF16_BCL2L2-      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          LRE-RAGARDQ------------------------------------SQG
H9GEA6_MCL1-01          LREAADEAGSKGTGPKFSFQ---------------------------GLL
H9GEA6_MCL1-02          LREAADEAGSKGTGPKFSFQ---------------------------GLL
A0A493U0E8_MCL1-01      HPTQKRAPEPAGRRDAAPPAAGCCTFKKCKRFRAGPHPFPHHPAGRDFWG
A0A1L1RNM6_MCL1-01      LREAAGEAEPGVKK-----------------------LFPGLLGGPGRPG
A0A1L1RNM6_MCL1-02      LREAAGEAEPGVKK-----------------------LFPGLLGGPGRPG
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          LREQAVGTKEA------------------------------------KPL
F6ZMX1_MCL1-02          LREQAVGTKEA------------------------------------KPL
F6ZMX1_MCL1-03          LREQAVGTKEA------------------------------------KPL
G1T2Q0_MCL1-02          ----ATGAKDA------------------------------------KPM
F1PAP1_MCL1-02          ----ATGAKDA------------------------------------KPL
A0A337S3J9_MCL1-04      ----ATGAKDA------------------------------------KPL
F7AVA6_MCL1-02          ----ATGTKDT------------------------------------KPM
A0A2K6GI15_MCL1-03      ----ATGAKDA------------------------------------KPM
C8YZ26_MCL1-01          ----ATGAKDT------------------------------------KPM
F7GTF7_MCL1-02          ----ATGAKDT------------------------------------KPM
A0A2K5R5E2_MCL1-04      ----ATGAKDT------------------------------------KPM
A0A2K6V5Y3_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2K5LXU8_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2K5I9I0_MCL1-03      ----ATGAKDT------------------------------------QPM
A0A2I2YQH7_MCL1-03      ----ATGAKDT------------------------------------KPM
Q07820_MCL1-04          ----ATGAKDT------------------------------------KPM
A0A2K5W0W9_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2K6ECR0_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2K5XSB2_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2R9BPJ5_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2I3RTV4_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2I3LFM0_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A2K6PPI3_MCL1-03      ----ATGAKDT------------------------------------KPM
A0A286Y1M5_MCL1-01      LREQAAGAKDS------------------------------------KPL
P97287_MCL1-01          LREQATGSKDS------------------------------------KPL
A0A452GA25_MCL1-02      LLEQATGAKDA------------------------------------KPL
G3T756_MCL1-01          LQEQATGAKDT------------------------------------KPM
A0A1S3F3I1_MCL1-01      LREQATGAKDA------------------------------------KPL
G1L3L7_MCL1-02          LREQATGAKDA------------------------------------KPL
A0A287BK44_MCL1-02      LREQATGAKDA------------------------------------KPM
A0A287BK44_MCL1-01      LREQATGAKDA------------------------------------KPM
B4DU51_MCL1-01          LREQATGAKDT------------------------------------KPM
A0A287DCH9_MCL1-02      LREQATGSKDA------------------------------------KPL
A0A287DCH9_MCL1-01      LREQATGSKDA------------------------------------KPL
W5MMB7_MCL1-01          --EFLSEAHG-QLNAETRELIGTFLQMYT---------------------
A0A3B3SG34_MCL1-01      --CGFSRSAVEMLDQETSELITTFFAEYT---------------------
Q4SW32_MCL1-01          --SGRPAGDEAALDSDTRQLVSRLMADVT---------------------
Q0KFR9_MCL1-01          --SNCPSGDE-VLEHDTRQLIENFLGDYT---------------------
A0A3P8Y1W8_MCL1-02      --SHCPSGNE-VLDNDTRQLIENLLRDYT---------------------
A0A3P8Y1W8_MCL1-01      --SHCPSGNE-VLDNDTRQLIENLLRDYT---------------------
D2ITA0_MCL1-03          ----SQAGEE-VLDNDTKRIIRIFLRDYA---------------------
D2ITA0_MCL1-04          ----SQAGEE-VLDNDTKRIIRIFLRDYA---------------------
A0A3P9ILF6_MCL1-02      --SGDNSGID-ALNEDTTEFLTNFFRNFV---------------------
A0A3P9ILF6_MCL1-01      --SGDNSGID-ALNEDTTEFLTNFFRNFV---------------------
A0A3Q2XZL8_MCL1-01      ------GRND-VVDAETKGLIRRFLTDFT---------------------
A0A3B4AFB7_MCL1-02      --SSYSAEHE-VLESDTRQLLSDFFKLFT---------------------
A0A3B3VM25_MCL1-01      --SAVRASNQ-VLDNDTMELIGSFLRNFT---------------------
I3KXG5_MCL1-01          ---------------ETKLIIHSFLGDFT---------------------
A0A3Q0R633_MCL1-01      --------DE-ALERETKSLITSFFRDFT---------------------
A0A3Q0R633_MCL1-03      --------DE-ALERETKSLITSFFRDFT---------------------
A0A3B4T8L9_MCL1-02      --PSCPAGDE-VLEDDTRQLISQSMKSFT---------------------
A0A3B4T8L9_MCL1-01      --PSCPAGDE-VLEDDTRQLISQSMKSFT---------------------
A0A3Q1EQB9_MCL1-02      --SSCPTGDE-LLENDTRQLIRRFLRDFT---------------------
A0A3B4ZKP6_MCL1-01      --SSCPAGDE-VLENDTRQLISSFLKDFT---------------------
A0A3Q1BKL8_MCL1-02      --SSCPAGDE-LLENDTRQLLRRFLRDFT---------------------
A0A3Q1EQB9_MCL1-01      --SSCPTGDE-LLENDTRQLIRRFLRDFT---------------------
A0A3Q1BKL8_MCL1-01      --SSCPAGDE-LLENDTRQLLRRFLRDFT---------------------
A0A3P8RQX7_MCL1-02      --SSCPAGDE-LLENDTRQLLRRFLRDFT---------------------
A0A3P8RQX7_MCL1-01      --SSCPAGDE-LLENDTRQLLRRFLRDFT---------------------
G3PJT0_MCL1-01          --SDSPAGAA-ALESDTRQLLGRFLREFT---------------------
A0A3B3IJ04_MCL1-01      --SGDNSGID-ALNEDTTEFLTNFFRNFV---------------------
A0A3P9L1F3_MCL1-01      --SGDNSGID-ALNEDTTEFLTNFFRNFV---------------------
A0A3B3IJ04_MCL1-02      --SGDNSGID-ALNEDTTEFLTNFFRNFV---------------------
A0A3P9L1F3_MCL1-02      --SGDNSGID-ALNEDTTEFLTNFFRNFV---------------------
A0A3B3CEX1_MCL1-01      --LVPND--P-PINQDTTEFLTNFFRNYV---------------------
A0A3B3CEX1_MCL1-02      --LVPND--P-PINQDTTEFLTNFFRNYV---------------------
A0A3Q3VP02_MCL1-01      --SGCLAGDE-LLEKDTRQLISRVLMELS---------------------
A0A3Q3B4P5_MCL1-01      -----GAEDE-VLENDTKHLISRFLQEFT---------------------
A0A3Q3B4P5_MCL1-02      -----GAEDE-VLENDTKHLISRFLQEFT---------------------
A0A3Q2EDX8_MCL1-01      --PGGHAGDE-ALDNDTKELISSFLRDFT---------------------
A0A3Q2P7X9_MCL1-01      --CGSHAGQE-ALDSDTTELISGFLRDFT---------------------
A0A3Q2P7X9_MCL1-02      --CGSHAGQE-ALDSDTTELISGFLRDFT---------------------
A0A3B5PQ55_MCL1-01      --TAVGASNQ-VLDNDTTELISSFLRDFT---------------------
A0A3B5PQ55_MCL1-02      --TAVGASNQ-VLDNDTTELISSFLRDFT---------------------
A0A3P9Q4I8_MCL1-01      --SAVRASNQ-VLDNDTTELISSFLRNFT---------------------
A0A3P9Q4I8_MCL1-02      --SAVRASNQ-VLDNDTTELISSFLRNFT---------------------
A0A087X830_MCL1-01      --SAVRASNQ-VLDNDTMELISSFLRNFT---------------------
A0A3B3YCD0_MCL1-01      --SAVRASNQ-VLDNDTMELISSFLRHFT---------------------
I3JHR5_MCL1-02          -----GESDE-ELERETKLLIHSFLGDFT---------------------
I3JHR5_MCL1-03          -----GESDE-ELERETKLLIHSFLGDFT---------------------
I3JHR5_MCL1-01          -----GESDE-ELERETKLLIHSFLGDFT---------------------
A0A3Q4HLQ8_MCL1-01      -----SESDE-QLERETKLLIHSFLGDFT---------------------
A0A3P8NP63_MCL1-02      -----SESDE-QLERETKLLIHSFLGDFI---------------------
A0A3Q2VNL8_MCL1-01      -----SESDE-QLERETKLLIHSFLGDFT---------------------
A0A3P8NP63_MCL1-01      -----SESDE-QLERETKLLIHSFLGDFI---------------------
A0A3P9BVM3_MCL1-01      -----SESDE-QLERETKLLIHSFLGDFI---------------------
A0A3B4G4Z6_MCL1-01      -----SESDE-QLERETKLLIHSFLGDFT---------------------
A0A2U9CJ81_MCL1-01      --SGCPAADE-ALDSFTRELISQFLRDYV---------------------
A0A3P8VKM5_MCL1-03      --DVSQAGDE-VLDTDTKELIFQFYRDFT---------------------
A0A3P8VKM5_MCL1-04      --DVSQAGDE-VLDTDTKELIFQFYRDFT---------------------
A0A3P8VKM5_MCL1-05      --DVSQAGDE-VLDTDTKELIFQFYRDFT---------------------
A0A3Q3IZW0_MCL1-01      --SSSPAEYE-VLENDTRLLICHFLRDYT---------------------
A0A3Q1GX28_MCL1-02      --SSCPAGDE-VLENDTRQLLSQFLQDFS---------------------
A0A3Q1GX28_MCL1-01      --SSCPAGDE-VLENDTRQLLSQFLQDFS---------------------
A0A3B4XKA5_MCL1-01      --PSCPAG-E-VLESDTSQLISQSMKSFT---------------------
A0A3Q3GP42_MCL1-01      --SSCPTGGE-VLESDTRQLISAFLREHT---------------------
A0A3Q3M6G2_MCL1-01      --PSCPAGDE-VLENDTRQLICQYLKDVS---------------------
A0A3Q3M6G2_MCL1-02      --PSCPAGDE-VLENDTRQLICQYLKDVS---------------------
A0A3B1IEV7_MCL1-01      ----SCRCPG-ALEAETRRLMVEFYRGYL---------------------
A0A3B4CGU9_MCL1-03      -------GGS-ALVEETRRLIGGFYRGYI---------------------
A0A3B4CGU9_MCL1-02      LIKPKPKGRV-RLEEETLCIIGDFYQGY----------------------
Q8UWD6_MCL1-01          ---------T-ALDMDTREIIDTFLKIFT---------------------
A2BF68_MCL1-01          ---------T-ALDMDTREIIDTFLKIFT---------------------
Q568W5_MCL1-01          ---------T-ALDMDTREIIDTFLIIFT---------------------
A0A3B1K5R1_MCL1-01      ----NCKQYE-TLDGDTREIISDFLRNFC---------------------
A0A3B4C6H5_MCL1-03      ----QFKESE-TLDRDTSEIVIDFLQNFT---------------------
A0A3B4C6H5_MCL1-01      ----QFKESE-TLDRDTSEIVIDFLQNFT---------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P8PVZ8_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      --------------------------------------------------
A0A3P9BLI0_BCL2L10      --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3P8W7K5_BCL2L10      --------------------------------------------------
H3AAS7_BCL2L2-02        --------------------------PAN---------------------
H3AAS7_BCL2L2-01        --------------------------PAN---------------------
G1Q051_BCL2L2-01        --------------------------AAD---------------------
G3WPT1_BCL2L2-01        --------------------------TNE---------------------
A0A287D9B3_BCL2L2-      --------------------------AAD---------------------
A0A482LX62_BCL2L2-      --------------------------AAD---------------------
W5QDH4_BCL2L2-02        --------------------------AAD---------------------
Q7TS60_BCL2L2-01        --------------------------AAD---------------------
G1LMC3_BCL2L2-01        --------------------------AAD---------------------
M3Y5X5_BCL2L2-01        --------------------------AAD---------------------
G1P3J2_BCL2L2-01        --------------------------AAD---------------------
G3WPT1_BCL2L2-02        --------------------------TNE---------------------
G1TV33_BCL2L2-01        --------------------------AAN---------------------
P70345_BCL2L2-01        --------------------------AAD---------------------
O88996_BCL2L2-01        --------------------------AAD---------------------
A0A3Q9B4M8_BCL2L2-      --------------------------AAD---------------------
H0XR82_BCL2L2-01        --------------------------ATD---------------------
A0A250YBR2_BCL2L2-      --------------------------AAD---------------------
A0A250YBR2_BCL2L2-      --------------------------AAD---------------------
L8HP19_BCL2L2-02        --------------------------AAD---------------------
L8HP19_BCL2L2-01        --------------------------AAD---------------------
Q1RMX3_BCL2L2-01        --------------------------AAD---------------------
A0A452ECF0_BCL2L2-      --------------------------AAD---------------------
A0A286XQQ9_BCL2L2-      --------------------------AAD---------------------
A0A2K5RUN8_BCL2L2-      --------------------------AAD---------------------
A0A2K5MZX9_BCL2L2-      --------------------------AAD---------------------
A0A0D9RU30_BCL2L2-      --------------------------AAD---------------------
A0A2K5HEJ9_BCL2L2-      --------------------------AAD---------------------
A0A1S3FYD8_BCL2L2-      --------------------------AAD---------------------
A0A2I2UAE3_BCL2L2-      --------------------------AAD---------------------
A0A2I2YPX6_BCL2L2-      --------------------------AAD---------------------
A0A287D9B3_BCL2L2-      --------------------------AAD---------------------
A0A2K5V0Q3_BCL2L2-      --------------------------AAD---------------------
F7G4L5_BCL2L2-01        --------------------------AAD---------------------
A0A2K6EA59_BCL2L2-      --------------------------AAD---------------------
A0A2K6AI25_BCL2L2-      --------------------------AAD---------------------
A0A1U7RC37_BCL2L2-      --------------------------AAD---------------------
A0A2I3GEA7_BCL2L2-      --------------------------AAD---------------------
A0A2R9A2Q3_BCL2L2-      --------------------------AAD---------------------
H2Q805_BCL2L2-01        --------------------------AAD---------------------
A0A096NX09_BCL2L2-      --------------------------AAD---------------------
A0A2K6GWM6_BCL2L2-      --------------------------AAD---------------------
A0A2K6ME72_BCL2L2-      --------------------------AAD---------------------
A0A2K6RW35_BCL2L2-      --------------------------AAD---------------------
A0A2K6RW35_BCL2L2-      --------------------------AAD---------------------
A0A2K6TM77_BCL2L2-      --------------------------AAD---------------------
A0A287ATE4_BCL2L2-      --------------------------AAD---------------------
A0A1U7UJF2_BCL2L2-      --------------------------AAD---------------------
A0A452SHI1_BCL2L2-      --------------------------AAD---------------------
Q05KI8_BCL2L2-01        --------------------------AAD---------------------
Q2TAP5_BCL2L1-01        --------------------------VEE---------------------
Q91828_BCL2L1-01        --------------------------VEE---------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
Q5XGJ4_BCL2L2-01        --------------------------ASC---------------------
F7G6M3_BCL2L2-01        --------------------------PAQ---------------------
A0A2K5CWY6_BCL2L2-      --------------------------AAD---------------------
A0A2K5CWY6_BCL2L2-      --------------------------AAD---------------------
G3TMU7_BCL2L2-01        --------------------------AAD---------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      ------------TGHSRSL-DARKMIPMT---------------------
H9GHK7_BCL2L1-01        ------------SEHPELLEEEEEENPRV---------------------
Q07816_BCL2L1-04        ------------TVHRSSL-EVHEIVRAS---------------------
A0A493TIA6_BCL2L1-      ------------AVHRSSL-EVHELVQSA---------------------
Q07816_BCL2L1-02        ------------TVHRSSL-EVHEIVRAS---------------------
Q07816_BCL2L1-03        ------------TVHRSSL-EVHEIVRAS---------------------
Q07816_BCL2L1-01        ------------TVHRSSL-EVHEIVRAS---------------------
G1N5N5_BCL2L1-01        ------------AVHRSSL-EVHEIVRAS---------------------
A0A452ILL8_BCL2L1-      ------------AGHSNSL-EAHERVPAT---------------------
A0A452ILL8_BCL2L1-      ------------AGHSNSL-EAHERVPAT---------------------
K7F655_BCL2L1-01        ------------AGHSNSL-EAHERVPAA---------------------
A0A452E1B1_BCL2L1-      ------------TGHSRSL-DAGKMIPTA---------------------
W5PSA5_BCL2L1-01        ------------TGHSRSL-DTGKMIPMA---------------------
P53563_BCL2L1-03        ------------TGHSSSL-DAREVIPMA---------------------
P53563_BCL2L1-02        ------------TGHSSSL-DAREVIPMA---------------------
A0A287CZ07_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
F6WA14_BCL2L1-01        ------------TGHSSSL-DAHETIPVA---------------------
G3WKX6_BCL2L1-01        ------------TGHSSSL-DAHETIPVA---------------------
M3XA94_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
M3XA94_BCL2L1-02        ------------TGHSSSL-DAREVIPMA---------------------
A0A3Q2H0F6_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
H0X6V2_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
G3SPN0_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
Q2PFS6_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
O35843_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
M3XA94_BCL2L1-03        ------------TGHSSSL-DAREVIPMA---------------------
G1RER8_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A1S2ZQT6_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
Q64373_BCL2L1-09        ------------TGHSSSL-DAREVIPMA---------------------
Q64373_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
P53563_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
O77737_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
Q9MYW4_BCL2L1-01        ------------TGHSSSL-DAREVIPMT---------------------
A0A3Q2H0F6_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
L8J061_BCL2L1-01        ------------TGHSRSS-DAREVIPMA---------------------
Q05KJ0_BCL2L1-01        ------------TGHSRSS-DAREVIPMA---------------------
Q05KJ0_BCL2L1-02        ------------TGHSRSS-DAREVIPMA---------------------
E2IV76_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A2K6G3C5_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
B2Z3Z4_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
G3HEA7_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
G3HEA7_BCL2L1-02        ------------TGHSSSL-DAREVIPMA---------------------
A0A1U7T4L4_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
M3Z2H9_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A1U7QU73_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A0D9RJZ8_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A286Y5D6_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A250YD48_BCL2L1-      ------------TGHSSSL-DAREVIPMT---------------------
A0A1L5BWY3_BCL2L1-      ------------TGHSSSL-DAREVIPMT---------------------
I3MUP5_BCL2L1-02        ------------TGHSSSL-DAREVIPMA---------------------
I3MUP5_BCL2L1-03        ------------TGHSSSL-DAREVIPMA---------------------
I3MUP5_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
G1P9D2_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5EBP4_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
E2IV75_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
F7IT34_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
Q76LT7_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5Q6R6_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5Q6R6_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5M8B1_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5H963_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
Q8SQ42_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5VPG2_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K5YR37_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2R8Z9D7_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A096NV05_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2J8VIH3_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K6QFA2_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K6QFA2_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A2K6UWY8_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
E2IV77_BCL2L1-01        ------------TGHSSSL-DAREVIPMA---------------------
A0A452SDS4_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A384D3U1_BCL2L1-      ------------TGHSSSL-DAREVIPMA---------------------
A0A452FWV3_BCL2L1-      ------------TGHSRSL-DAREVIPMA---------------------
Q9MZS7_BCL2L1-01        ------------TGHSRSL-DAREVIPMA---------------------
A0A3B3E2W4_BCL2L1-      -------------EDGQLKKSCPCCASMD---------------------
A0A3B3I2Q5_BCL2L1-      -------------EDGRLRRSCPCCASMD---------------------
A0A3P9I2N4_BCL2L1-      -------------EDGQLRRSCPCCASMD---------------------
A0A3P9MKK4_BCL2L1-      -------------EDCQLRRSCPCCASMD---------------------
A0A3B5B4X7_BCL2L1-      --------------RG----------GIE---------------------
A0A3B4BFZ8_BCL2L1-      -----------LPPDD----------HLD---------------------
A0A3Q3FUB6_BCL2L1-      -----------SSPHT----------DIE---------------------
A0A3B5MGS2_BCL2L1-      -----------RGPPA----------GVE---------------------
M4A558_BCL2L1-01        -----------RGPMA----------GVE---------------------
A0A3P9QFB3_BCL2L1-      -----------QGPP------------VE---------------------
A0A087YBW4_BCL2L1-      -----------RDPPT----------GVK---------------------
A0A3B3VWI7_BCL2L1-      -----------RDPPT----------GVK---------------------
A0A3B3XN57_BCL2L1-      -----------QDPPT----------GVE---------------------
A0A3Q2C6K4_BCL2L1-      -----------RAPHG----------SIE---------------------
A0A3Q2NRP4_BCL2L1-      -----------WAPHG----------RAE---------------------
A0A0B4KJI5_BCL2L1-      ---------------------------IE---------------------
A0A3Q1JZ46_BCL2L1-      -----------SPPCK----------SME---------------------
A0A3Q1JZ46_BCL2L1-      -----------SPPCK----------SME---------------------
A0A3Q3NFM4_BCL2L1-      -----------SSPHG----------GVE---------------------
A0A3Q3NFM4_BCL2L1-      -----------SSPHG----------GVE---------------------
A0A3B4V9K8_BCL2L1-      -----------SPPHG----------GIE---------------------
A0A3B4XS24_BCL2L1-      -----------SPPHG----------GIE---------------------
A0A2U9BY16_BCL2L1-      -----------ESPLR--LQRLPSSPSLD---------------------
C1BLI0_BCL2L1-01        -----------SSPQG----------GIE---------------------
C0HAD8_BCL2L1-01        -----------SSPQG----------GME---------------------
A0A3B3ZMX9_BCL2L1-      -----------SLRLR--------LDSAS---------------------
A0A3B3TFR4_BCL2L1-      -----------EGATP---------QGLE---------------------
H3CH49_BCL2L1-01        -----------AP-----SQHQQSLTSLD---------------------
A0A3Q2FR43_BCL2L1-      ------------------RRQQASTAAME---------------------
A0A3P8XYL5_BCL2L1-      -----------QSPPSSPRRTV----GLD---------------------
Q90Z98_BCL2L1-02        -----------QSPASSPQRQTNGSGGLD---------------------
Q90Z98_BCL2L1-01        -----------QSPASSPQRQTNGSGGLD---------------------
A0A059PJI5_BCL2L1-      -----------RSPTLSPQRQVNGSASLE---------------------
A0A3B4DTL9_BCL2L1-      -----------GSPTSSPQRRSNGAGGLD---------------------
B5XAY3_BCL2L1-01        -----------SSPRR--------TAGLD---------------------
W5MG74_BCL2L1-01        -----------QPPQG-----------IE---------------------
A0A3Q3B3X5_BCL2L1-      -----------ASPLR--QQPLPTTANMD---------------------
A0A3B3IB64_BCL2L1-      -----------LSPLR--EQQLPSTTNMD---------------------
A0A3P9JYH1_BCL2L1-      -----------LSPLR--EQQLPSTTNMD---------------------
A0A3B3DHA1_BCL2L1-      -----------LSPLR--QQQLPSTTNMD---------------------
A0A3Q0RTF8_BCL2L1-      -----------ASPQR--QQQPPSTTNLD---------------------
I3IZK7_BCL2L1-01        -----------ASPQR--QQQPPSTTDLD---------------------
A0A2U9BY16_BCL2L1-      -----------ESPLR--LQRLPSSPSLD---------------------
A0A2U9BY16_BCL2L1-      -----------ESPLR--LQRLPSSPSLD---------------------
A0A2U9BY16_BCL2L1-      -----------ESPLR--LQRLPSSPSLD---------------------
A0A0D6DR75_BCL2L1-      -----------ASPLR--QQRLPSPTSLD---------------------
A0A3Q3WIW8_BCL2L1-      -----------RSPLR----LQPSTTSLD---------------------
A0A219P0Y3_BCL2L1-      -----------ASPLR--QQQLPSTTSLD---------------------
A0A3Q3MX20_BCL2L1-      -----------ASPLR--QEHLQSTASLD---------------------
A0A3Q3G2E1_BCL2L1-      -----------ASPHRQQQQRLPATTNLD---------------------
A0A3Q3G2E1_BCL2L1-      -----------ASPHRQQQQRLPATTNLD---------------------
A0A3Q3G2E1_BCL2L1-      -----------ASPHRQQQQRLPATTNLD---------------------
A0A3Q1GZ93_BCL2L1-      -----------ASPLR--QQRLPSTTSLD---------------------
A0A3Q1GZ93_BCL2L1-      -----------ASPLR--QQRLPSTTSLD---------------------
A0A3Q1GZ93_BCL2L1-      -----------ASPLR--QQRLPSTTSLD---------------------
A0A3B4V3T1_BCL2L1-      -----------ESPQR--QQRLPSTTSLD---------------------
A0A3B4XU17_BCL2L1-      -----------ESPQR--QQRLPSTTSLD---------------------
H3ANS8_BCL2L1-01        -----------LPAGSSSRLEAQAVSGPE---------------------
A0A452FHY1_BCL2L1-      -------------TGHTE-----ESGPVA---------------------
A0A452FHY1_BCL2L1-      -------------TGHTE-----ESGPVA---------------------
A0A1S3EPX7_BCL2L1-      -------------TGHSSSSEAREVIPMA---------------------
A0A218USB3_BCL2L1-      -------------TVHQSSLEVHEIRRAA---------------------
A0A218USB3_BCL2L1-      -------------TVHQSSLEVHEIRRAA---------------------
U3JSL7_BCL2L1-01        -------------SVHQSSLEVHEIRRAA---------------------
A0A218USB3_BCL2L1-      -------------TVHQSSLEVHEIRRAA---------------------
A0A218USB3_BCL2L1-      -------------TVHQSSLEVHEIRRAA---------------------
H0Z8G3_BCL2L1-01        -------------TVHQNSLEVHEIRRAA---------------------
Q4U2V6_BCL2L1-01        -------------TVHQSSLEVHEIRRAA---------------------
R4JQR8_BCL2L1-01        --------------------------------------------------
A0A346RRN1_BCL2L1-      --------------------------------------------------
Q568V1_MCL1-01          -----------ELERDTRQLLLDFYRTHT---------------------
Q1L8X3_MCL1-01          -----------ELERDTRQLLLDFYRTHT---------------------
Q9I9N3_MCL1-01          -----------ELERDTRQLLLDFYRTHT---------------------
A0A286XUI2_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A3B3R4U0_MCL1-01      -----------GKMLTFPNRGLSQETHELIGTFLR---------------
F7CP56_BCL2A1-03        --------------------------------------------------
A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8YNB4_BCL2-01      -----------QPDP-HA--------------------------------
A0A3P8WUE9_BCL2-01      -----------APEA-HA--------------------------------
A0A3B4A3G8_BCL2-01      -----------PSDP-HA--------------------------------
A0A3Q3G1D7_BCL2-01      -----------QSDPAYA--------------------------------
A0A3Q2XQX2_BCL2-02      -----------GSDP-LA--------------------------------
A0A3Q2XQX2_BCL2-01      -----------GSDP-LA--------------------------------
A0A3Q3B0R2_BCL2-01      -----------PHEP-LA--------------------------------
A0A3Q2PN77_BCL2-01      -----------QSDP-HA--------------------------------
A0A3P9J8Y9_BCL2-01      -----------RADP-LA--------------------------------
A0A3Q0S5Z7_BCL2-01      -----------QSDP-HA--------------------------------
A0A3P8QVM8_BCL2-01      -----------QSDP-HA--------------------------------
A0A3P9DIG5_BCL2-01      -----------QSDP-HA--------------------------------
A0A3Q2UYW8_BCL2-01      -----------QSDP-HA--------------------------------
A0A3B4G3K4_BCL2-01      -----------QSDP-HA--------------------------------
A0A2U9BJ09_BCL2-01      -----------QSEP-RA--------------------------------
A0A3Q1I5N1_BCL2-01      -----------PSDP-HA--------------------------------
A0A3Q3K1K1_BCL2-01      -----------QSDM-HA--------------------------------
A0A3Q3MEY1_BCL2-01      -----------QSDP-QA--------------------------------
A0A1X9JZA1_BCL2-01      -----------QSDP-HA--------------------------------
A0A4D6FTA2_BCL2-01      -----------QSDP-HA--------------------------------
A0A3Q1FLK7_BCL2-01      -----------QSDP-HA--------------------------------
A0A3Q1B8C3_BCL2-01      -----------QSDP-HA--------------------------------
A0A3P8S9L3_BCL2-01      -----------QSDP-HA--------------------------------
A0A3B5BBQ0_BCL2-01      -----------QSDP-HA--------------------------------
A0A3B4TX71_BCL2-01      -----------QSDP-HA--------------------------------
A0A3B4YAG2_BCL2-01      -----------QSDP-HA--------------------------------
G1TW27_BCL2-02          -----------PAAA-GP--------------------------------
E2RS00_BCL2A1-02        -----------DCEF-GYTLALAQDYVRH---------------------
A0A3B3TCS4_BCL2-01      -----------RFDP-HA--------------------------------
A0A0U3DHY6_BCL2-01      -----------QPDP-HV--------------------------------
A0A3P9AAB2_BCL2-01      -----------QPDP-HA--------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A3P9MKK4_BCL2L1-      --------------------------------------------------
A0A3B3I2Q5_BCL2L1-      --------------------------------------------------
A0A3P9I2N4_BCL2L1-      --------------------------------------------------
A0A3B4AFB7_MCL1-01      -----------DTRQ-LLSDFFKLFTGIS---------------------
G3TVG9_MCL1-01          -----------EEEE-DKLYPQ----------------------------
B9ZYL7_BCL2-01          -----------RRSA-SAVSPLAELNVEPRDLNVNPDASRAADGDNNDAD
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F6YNL8_BCL2-01          -------------------------AAGP---------------------
A0A218UQA0_BCL2-01      -----------ATAS-HT-------PPAE---------------------
Q00709_BCL2-01          -----------AAAS-EV-------PPAE---------------------
A0A493T1X3_BCL2-01      -----------AAAS-EA-------PPGE---------------------
U3KEW4_BCL2-01          -----------AAAS-PA-------PPAE---------------------
G3WZW9_BCL2-01          -----------PPAV-AAATV----AAGP---------------------
M3YYK3_BCL2-01          -----------LAAA-A--------AAGP---------------------
M3X1R9_BCL2-02          -----------PVAP-AAAAAAA--AAGP---------------------
A0A2K6R2I5_BCL2-02      -----------PAAP-AA-------AAGP---------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          -----------DP------------AAQP---------------------
Q75SV7_BCL2-01          -----------PAAP-AAAAAAAADAAGP---------------------
M3X1R9_BCL2-01          -----------PVAP-AAAAAAA--AAGP---------------------
Q8I008_BCL2-01          -----------PVAP---AAAAA--AAGP---------------------
A0A076FU27_BCL2-01      -----------PAA-----------AAGP---------------------
A0A4P8GLJ2_BCL2-01      -----------PAA-----------AAGP---------------------
F6R2C4_BCL2-01          -----------PAA-----------AAGP---------------------
O02718_BCL2-01          -----------PAA-----------AAGP---------------------
A0A076FZV9_BCL2-01      -----------PAA-----------AAGP---------------------
A0A452EV13_BCL2-01      -----------PAA-----------AAGP---------------------
A0A250YD83_BCL2-01      -----------PVAP-AA-------RAGP---------------------
A9QXG9_BCL2-01          -----------PAAP-GA-------AAGP---------------------
A0A2K5NZS5_BCL2-01      -----------PAAP-AA-------AAGP---------------------
A0A0D9S017_BCL2-01      -----------PAAP-AA-------AAGP---------------------
A0A2K6CIX3_BCL2-01      -----------PAAP-AA-------AAGP---------------------
A0A2K5XRD4_BCL2-01      -----------PAAP-AA-------AAGP---------------------
A0A2K6KHG1_BCL2-01      -----------PAAP-AA-------AAGP---------------------
A0A2K6R2I5_BCL2-01      -----------PAAP-AA-------AAGP---------------------
A0A2K5HK49_BCL2-01      -----------PAAP-AA-------AAGP---------------------
G3QES9_BCL2-01          -----------PAAP-GA-------AAGP---------------------
H2QEM8_BCL2-01          -----------PAAP-GA-------AAGP---------------------
A0A2I3GZF9_BCL2-01      -----------PAAP-GA-------AAGP---------------------
A0A2K6UEL3_BCL2-01      -----------XXXX-XX-------XXXX---------------------
E2QWA1_BCL2-01          -----------AAAA-FP-------PRAP---------------------
G1LIC9_BCL2-01          -----------AAAA------------GP---------------------
A0A452R110_BCL2-01      -----------AAAA------------GP---------------------
A0A452R110_BCL2-02      -------------------------AAGP---------------------
G3WZW9_BCL2-02          -------------------------AAGP---------------------
G3SLZ1_BCL2-02          -------------------------AAQP---------------------
A0A452T603_BCL2-01      --------------------------------------------------
M3Y8D1_BCL2L10-01       -----------PST------------------------------------
A0A3Q2Y539_MCL1-01      -----------WIQS-----------------------------------
A0A3Q3BEB7_BCL2L1-      ------------GKK-IW-------PRRS---------------------
A0A3P8VMA1_BCL2L1-      --------------------------HCS---------------------
A0A345BSW9_BCL2L1-      -----------SPQH-QT-------NGSG---------------------
A0A286MU87_BCL2L1-      ---------------------------QG---------------------
A0A3P8XFS0_BCL2L1-      ---------------------------QG---------------------
A0A3P8XFS0_BCL2L1-      ---------------------------QG---------------------
A0A0F7L1T6_BCL2L1-      ---------------------------GA---------------------
H2U5I3_BCL2L1-01        ---------------------------GA---------------------
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1BQA0_BCL2L1-      --------------------------------------------------
A0A3P8U812_BCL2L1-      --------------------------------------------------
E6ZFR0_BCL2L1-01        ---------------------------GA---------------------
G3P7B4_BCL2L1-01        ---------------------------SG---------------------
A0A3Q3X5M5_BCL2L1-      ---------------------------GA---------------------
A0A2U9BIG9_BCL2L1-      ---------------------------G----------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A3B3ZMX9_BCL2L1-      -----------PAPL-LD--------------------------------
G3NJY1_BCL2L1-01        -----------PLLQ-QR-------SPST---------------------
A0A2U9BY16_BCL2L1-      -----------PLRL-QR-------LPSS---------------------
A0A3Q3DUT7_BCL2L1-      -----------PLRE-AA-------S------------------------
A0A3Q3DUT7_BCL2L1-      -----------PLRE-AA-------S------------------------
A0A3Q3DUT7_BCL2L1-      -----------PLRE-AA-------S------------------------
A0A3B1JJ42_BCL2L1-      -----------PQRR-AN-------GARG---------------------
A0A3P8UWG7_BCL2L1-      -----------PLRQ-QH-------SASD---------------------
A0A3Q3IVF5_BCL2L1-      -----------PLRQ-QQ-------LPST---------------------
A0A3Q1DHJ3_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3Q1DHJ3_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3Q1DHJ3_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3P8TL99_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3P8TL99_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3Q1FR00_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3B4Z3X2_BCL2L1-      -----------PRRL-AS-------TAT----------------------
A0A3B4Z3X2_BCL2L1-      -----------PRRL-AS-------TAT----------------------
C3VIT1_BCL2L1-01        -----------PLRQ-QP-------LPST---------------------
A0A3P8P0F1_BCL2L1-      -----------PQRR-QQ-------QPPS---------------------
A0A3Q2X557_BCL2L1-      -----------PQRR-QQ-------QPPS---------------------
A0A3P9D632_BCL2L1-      -----------PQRR-QQ-------QPPS---------------------
A0A3P9D632_BCL2L1-      -----------PQRR-QQ-------QPPS---------------------
A0A3Q4N4B5_BCL2L1-      -----------PQRR-QQ-------QPPS---------------------
A0A3B4FNX1_BCL2L1-      -----------PQRR-QQ-------QPPS---------------------
A0A3Q2QPL9_BCL2L1-      -----------QQQP-AS-------TAA----------------------
A0A3B5PQJ0_BCL2L1-      ------------HQA-AS-------AST----------------------
A0A087X9B7_BCL2L1-      ------------QQA-AS-------AAT----------------------
A0A3B3TUS7_BCL2L1-      ------------QQA-AS-------AAT----------------------
A0A3B3WI27_BCL2L1-      ------------QQA-AS-------AAT----------------------
A0A3P9N9Y4_BCL2L1-      ------------QQA-AS-------AST----------------------
A0A3B3QRZ2_BCL2L1-      ----------------------------P---------------------
Q564A4_BCL2-01          -----------LIAR-VT-------RSDP---------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------LGD---------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------LGD---------------------
A0A3Q2HRY3_BCL2-02      ------------AAP-AG-------AAGP---------------------
K7F5Y3_BCL2-01          --------------------------LGD---------------------
F1LNV0_BCL2-01          ----------------VA-------TAGP---------------------
P49950_BCL2-01          ----------------VA-------NAGP---------------------
G1TW27_BCL2-01          -----------------A-------AAGP---------------------
A0A2K5EB04_BCL2-01      -----------AAPA-AA-------ATGP---------------------
A0A2R8MY14_BCL2-01      -----------AAPA-AA-------ATGP---------------------
H2NWH5_BCL2-01          ------------AAP-GA-------AVGP---------------------
A0A096MPU7_BCL2-01      ------------AAP-AA-------AAGP---------------------
A0A2K5PP81_BCL2-01      -----------AAPA-AA-------ATGP---------------------
H0WKI0_BCL2-01          -------------AA-AA-------AAEP---------------------
A0A2K5UDI5_BCL2-01      -----------PAAA-AA-------AAGP---------------------
P10417_BCL2-01          ----------------VA-------TAGP---------------------
Q7TSN8_BCL2-01          ----------------VA-------TAGP---------------------
A0A3Q2HRY3_BCL2-01      ----------------AG-------AAGP---------------------
E2QWA1_BCL2-02          ----------------XX-------XXXX---------------------
A0A2K6G3I7_BCL2-01      ----------------AA-------AAGP---------------------
Q6R755_BCL2-01          ----------------VA-------TTGP---------------------
Q9JJV8_BCL2-01          ----------------VA-------TTGP---------------------
Q923R6_BCL2-01          ----------------VA-------TTGP---------------------
H0W1T3_BCL2-01          ------------AGL-AV-------AQGP---------------------
G1LIC9_BCL2-02          ----------------AA-------AAGP---------------------
I3MVK9_BCL2-01          ------------AAP-AA-------AAGP---------------------
                                                                          

P70345_BCL2L2-02        --------------------------------------------------
G1MZW1_BCL2-01          --------------------------------------------------
A2BF68_MCL1-02          -----------------MILWT----------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        -----------------KTSRV-----------LQDIAF--SVQNEVEKN
H0ZCL9_BCL2A1-01        -----------------RVAHV-----------LRTMAS--SLQDQTEEA
U3JTB2_BCL2A1-01        -----------------RVAHV-----------LRTMAS--SLQDQTEEA
A0A218V8Z6_BCL2A1-      -----------------RVAHV-----------LRTMAS--SLQDQTEEA
Q9W6F2_BCL2A1-01        -----------------RVAHV-----------LRNIAS--SLQDQTEEA
A0A493SSZ7_BCL2A1-      -----------------RVAHV-----------LRNIAS--SLQDQTEEA
G1N8C5_BCL2A1-01        -----------------RVAHV-----------LRNIAS--SLQDQTEEA
A0A452J3N6_BCL2A1-      -----------------RVAHV-----------LRHAAS--FLQKENEES
K7G130_BCL2A1-01        -----------------RVAHV-----------LRNSAS--FLQKENEEI
A0A2K5PYQ3_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQ------
A0A2K5PYQ3_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQ------
F6SFL4_BCL2A1-01        -----------------KTSQI-----------LQKVAF--SVQQEVEKD
G3WSP8_BCL2A1-01        -----------------RTSQI-----------LQKVAF--SVQEEVEKD
F6S8G3_BCL2A1-01        -----------------RTSRA-----------LQNVMF--SVQGDVEKA
O55178_BCL2A1-01        -----------------QAFRV-----------LQRVAF--SVQKEVGKN
Q0P538_BCL2A1-01        -----------------QAFRV-----------LQRVAF--SVQKEVGKN
G3V977_BCL2A1-01        -----------------KTSRV-----------LQRVAF--SVQKEVEKN
Q925A9_BCL2A1-01        -----------------KTSRV-----------LQRVAF--SVQKEVEKN
Q07440_BCL2A1-01        -----------------QACRV-----------LQRVAF--SVQKEVEKN
O55179_BCL2A1-01        -----------------QACRV-----------LQRVAF--SVQKEVEKN
O55177_BCL2A1-02        -----------------QACRV-----------LQRVAF--SVQKEVEKN
Q497M6_BCL2A1-01        -----------------KACRV-----------LQRVAF--SVQKEVEKN
Q8K164_BCL2A1-01        -----------------QACRV-----------LQRVAF--SVQKEVEKN
Q4FK02_BCL2A1-01        -----------------KACRV-----------LQRVAF--SVQKEVEKN
A0A452SIR9_BCL2A1-      -----------------RASQV-----------LRDVAS--SVQGEVEKN
M3YVH4_BCL2A1-01        -----------------RVSRV-----------LRDVAS--SVQGEVEQN
U6CQS8_BCL2A1-01        -----------------RVSRV-----------LRDVAS--SVQREVEQN
I3MCZ7_BCL2A1-01        -----------------KTSKV-----------LQNVAF--SVQKEVEKN
G3T8E6_BCL2A1-01        -----------------KTSRV-----------LQNVAF--SVQKEVEKN
H0WZ23_BCL2A1-01        -----------------KTSRV-----------LQNVAF--SVQEEVEKS
A0A2K6TLJ5_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEES
A0A2K5D2I1_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKS
B4E1X9_BCL2A1-01        -----------------KTSRV-----------LQNVAF--SVQKEVEKN
A0A2I2YML2_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2R8ZJX9_BCL2A1-      -----------------QTSRV-----------LQNVAF--SVQKEVEKN
A0A2I3HBP6_BCL2A1-      -----------------KTSRV-----------LQNVAF--SVQKEVEKN
A0A2K6PHF2_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K6LV19_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K5TMD1_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K5KAA3_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQEEVEKN
A0A2K6DS18_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A096NMX5_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K6AD27_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
F7HXW0_BCL2A1-01        -----------------KTSRV-----------LQQVAF--SVQKEVEKS
A0A2K6TLJ5_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEES
A0A2I3HBP6_BCL2A1-      -----------------KTSRV-----------LQNVAF--SVQKEVEKN
A0A2K6EKG1_BCL2A1-      -----------------KTSRV-----------LQNIAF--SVQNEVEKN
A0A452EK63_BCL2A1-      -----------------KTSRV-----------LQDVAS--SVQDEVERT
W5Q0N6_BCL2A1-01        -----------------KTSRV-----------LQDVAS--SVQDEVERT
L8IZT5_BCL2A1-01        -----------------KISRV-----------LQDVAS--SVQDEVERT
Q3C2I0_BCL2A1-01        -----------------KTSRV-----------LQDVAS--SVQDEVERT
F7CP56_BCL2A1-04        -----------------KTSRV-----------LQDIAF--SVQNEVEKN
C7F841_BCL2A1-01        -----------------KTSRV-----------LRDVAF--SVQNEVEKN
A0A2K5D2I1_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKS
H2NNZ9_BCL2A1-01        -----------------KASRV-----------LQKVAF--SVQKEVEKN
A0A2I2YML2_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K6LV19_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K6PHF2_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K5KHH8_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K5KHH8_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K5KAA3_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQEEVEKN
A0A2K5TMD1_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
F7E8V5_BCL2A1-01        -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K6DS18_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A2K6AD27_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A096NMX5_BCL2A1-      -----------------KTSRV-----------LQKVAF--SVQKEVEKN
A0A0D9RRC3_BCL2A1-      -----------------KTSRV-----------LQKVAS--SVQKEVEKN
Q16548_BCL2A1-01        -----------------KTSRV-----------LQNVAF--SVQKEVEKN
A0A2R8ZJX9_BCL2A1-      -----------------QTSRV-----------LQNVAF--SVQKEVEKN
G1QEX2_BCL2L10-01       ---------------------------------HSWLGTPHSWSRRQRNR
A0A3Q1FR00_BCL2L1-      -----------------AVKEA-----------LRDTAN--EFELRYARA
F6VJQ0_BCL2L10-01       -----------------PAAAT-----------LRLVSS--ELRQIYQDF
H3AR18_MCL1-01          FRFGLDQWSGGE-----KPLDT-----------LRRVGD--SIIDKHRIA
J7H260_MCL1-01          --------GDSP-----KALPT-----------MRRLGG--DINEKHRMA
G1PZ39_MCL1-01          GGPA----ASSR-----KALET-----------LRRVGD--GVQRNHEMA
Q95KR3_MCL1-01          -----------------------------------------------SSA
A0A2K5EPX0_MCL1-02      -------------------------------------------------T
A0A2K5EPX0_MCL1-01      -------------------------------------------------S
Q9Z1P3_MCL1-01          GEAG----AAGR-----RALET-----------LRRVGD--GVQRNHETA
A5PJR2_MCL1-01          GGSG----TTSR-----KALET-----------LRRVGD--GVQRNHETA
A0A452GA25_MCL1-01      GGSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
G1L3L7_MCL1-01          GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
G1T2Q0_MCL1-01          GRAG----SASR-----KALET-----------LRRVGD--GVQRNHETA
F7AVA6_MCL1-01          GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A337S3J9_MCL1-01      GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A337S3J9_MCL1-03      GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
Q7YRZ9_MCL1-01          GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
F1PAP1_MCL1-01          GGSR----AASR-----KALET-----------LRRVGD--GVQRNHETA
Q8HYS5_MCL1-01          GGSR----AASR-----KALET-----------LQRVGD--GVQRNHETA
M3XZZ5_MCL1-01          GGPG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A452RHX5_MCL1-01      GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
H0XFB7_MCL1-01          GRAG----AASR-----KALET-----------LRRVGD--GVQRNHETA
F7GTF7_MCL1-01          GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5CFH3_MCL1-01      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6V5Y3_MCL1-01      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6KRW9_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5XSB2_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A0D9RZP5_MCL1-01      SRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
I7G687_MCL1-01          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5LXU8_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I3GJZ3_MCL1-02      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
H2N5Y9_MCL1-01          GRSG----ATCR-----KALET-----------LRRVGD--GVQRNHETA
A0A2R9BPJ5_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I3RTV4_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I2YQH7_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5C7L5_MCL1-01      DRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5I9I0_MCL1-02      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6GI15_MCL1-01      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I3GJZ3_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5CFH3_MCL1-03      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5R5E2_MCL1-03      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5W0W9_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6ECR0_MCL1-02      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I3LFM0_MCL1-01      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6KRW9_MCL1-02      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6PPI3_MCL1-02      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
G3WBC5_MCL1-01          ---------RSG-----KALET-----------LRRVGD--GVQRNHETA
W5QI41_MCL1-01          GGSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
F1MQX4_MCL1-01          GGSG----ATSR-----KALET-----------LHRVGD--GVQHNHETA
B4DLY8_MCL1-01          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
B4DG83_MCL1-01          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
B4E3L8_MCL1-01          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5DMS4_MCL1-01      GRSE----AANS-----KALET-----------LRGVGE--GVPRNHEMA
U3KKY6_MCL1-01          --------------------------------------------KKNKKN
G1MPY7_MCL1-01          --------------------------------------------------
K7FPN7_MCL1-01          --------------------------------------------------
H3AR18_MCL1-02          AFRF----GLDQWSGGEKPLDT-----------LRRVGD--SIIDKHRIA
E2RS00_BCL2A1-01        -----------------RASRV-----------LQDVAF--SVQGQVEKN
B6V6J0_MCL1-01          LEAS----CLLQHGVHHKALET-----------LLRVGG--EIIEKHHMA
A0A3L7HT14_BCL2A1-      -----------------KTSRV-----------LQRVAS--SVQKEVEKN
H0XHA5_MCL1-01          -----------------DTLPS-----------TPPPAE--EEDELYWQS
A0A2I2YPX6_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6TM77_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K5RUN8_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6GWM6_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
W5QDH4_BCL2L2-01        -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6ME72_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6RW35_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A287ATE4_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2R8M4C0_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K5MZX9_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K5HEJ9_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K5V0Q3_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
F7G4L5_BCL2L2-02        -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6EA59_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6AI25_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A1U7RC37_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2I3GEA7_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2R9A2Q3_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
H2Q805_BCL2L2-02        -------------------HQA-----------MRAAGD--EFETRFRRT
A0A096NX09_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A287ATE4_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A4D6NWN1_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A1U7UJF2_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A452UF16_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A452UF16_BCL2L2-      -------------------HQA-----------MRAAGD--EFETRFRRT
A0A2K6F6N9_MCL1-01      -----------------WAWLG-----------LK--------------A
G1QAV8_MCL1-01          PRVG----GVQR-----------------------RAAGCSGVRQ--ETA
H9GEA6_MCL1-01          GRFG----SSPNEAEVARALET-----------LRRVGE--SLREKHLLA
H9GEA6_MCL1-02          GRFG----SSPNEAEVARALET-----------LRRVGE--SLREKHLLA
A0A493U0E8_MCL1-01      FTTP----GQIF-----GVLAR-----------KPHSGEQGGVTVEDLGR
A0A1L1RNM6_MCL1-01      RASS----AVME-----KALET-----------LRRVGD--GVMQKHELA
A0A1L1RNM6_MCL1-02      RASS----AVME-----KALET-----------LRRVGD--GVMQKHELA
G2HFR3_MCL1-01          --------------------------------------------------
F6ZMX1_MCL1-01          ---------RSG-----KALET-----------LRRVGD--GVQRNHERA
F6ZMX1_MCL1-02          ---------RSG-----KALET-----------LRRVGD--GVQRNHERA
F6ZMX1_MCL1-03          ---------RSG-----KALET-----------LRRVGD--GVQRNHERA
G1T2Q0_MCL1-02          GRAG----SASR-----KALET-----------LRRVGD--GVQRNHETA
F1PAP1_MCL1-02          GGSR----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A337S3J9_MCL1-04      GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
F7AVA6_MCL1-02          GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6GI15_MCL1-03      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
C8YZ26_MCL1-01          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
F7GTF7_MCL1-02          GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5R5E2_MCL1-04      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6V5Y3_MCL1-03      GRSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5LXU8_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5I9I0_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I2YQH7_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
Q07820_MCL1-04          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5W0W9_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6ECR0_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K5XSB2_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2R9BPJ5_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I3RTV4_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2I3LFM0_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A2K6PPI3_MCL1-03      GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A286Y1M5_MCL1-01      GGVG----PTSR-----KALET-----------LRRVGD--GVQRNHQTA
P97287_MCL1-01          GEAG----AAGR-----RALET-----------LRRVGD--GVQRNHETA
A0A452GA25_MCL1-02      GGSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
G3T756_MCL1-01          GGSG----AASR-----KALET-----------LRRVAD--GVQRNHETA
A0A1S3F3I1_MCL1-01      GGAG----AASR-----KALET-----------LRRVGD--GVQRNHETA
G1L3L7_MCL1-02          GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A287BK44_MCL1-02      GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A287BK44_MCL1-01      GGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
B4DU51_MCL1-01          GRSG----ATSR-----KALET-----------LRRVGD--GVQRNHETA
A0A287DCH9_MCL1-02      RGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
A0A287DCH9_MCL1-01      RGSG----AASR-----KALET-----------LRRVGD--GVQRNHETA
W5MMB7_MCL1-01          -----------------GLPHRR-SRGKALE-TLKRVVD--SVVAKHQIA
A0A3B3SG34_MCL1-01      -----------------GLCATLQRRNEALS-TLKRVVA--TVVEKHKFA
Q4SW32_MCL1-01          -----------------GISRAQWRESRALA-TTKRVVG--DLMEKHRYT
Q0KFR9_MCL1-01          -----------------GLSQPRWTQSKPLT-TMKRVVE--DVIAKHRYA
A0A3P8Y1W8_MCL1-02      -----------------GLSQPRWKQNKSLV-TMKRVVG--DVIAKHTYA
A0A3P8Y1W8_MCL1-01      -----------------GLSQPRWKQNKSLV-TMKRVVG--DVIAKHTYA
D2ITA0_MCL1-03          -----------------GASKAKRTRQDEVQVTMRRVVD--GVLEKHQYA
D2ITA0_MCL1-04          -----------------GASKAKRTRQDEVQVTMRRVVD--GVLEKHQYA
A0A3P9ILF6_MCL1-02      -----------------GISQYPHRDNKYMS-TAKRVVN--DVLEKHKIT
A0A3P9ILF6_MCL1-01      -----------------GISQYPHRDNKYMS-TAKRVVN--DVLEKHKIT
A0A3Q2XZL8_MCL1-01      -----------------GLSTASWNESKAHS-TMKRVVA--KVLEKHKYK
A0A3B4AFB7_MCL1-02      -----------------GISQPKWKQRPALS-TMKGVVD--KLLEKHRYA
A0A3B3VM25_MCL1-01      -----------------GLSKCRWSQNKALS-TMKRVVE--DVLSKHRYA
I3KXG5_MCL1-01          -----------------GLSQPQRKETKALK-MMKRVVA--DVLEKHRYA
A0A3Q0R633_MCL1-01      -----------------GLSQRRWKESEALK-TMKRVVA--DVLEKHRYA
A0A3Q0R633_MCL1-03      -----------------GLSQRRWKESEALK-TMKRVVA--DVLEKHRYA
A0A3B4T8L9_MCL1-02      -----------------GRSIPRWTEHRALQ-TMKRVVD--GVLEKHRYA
A0A3B4T8L9_MCL1-01      -----------------GRSIPRWTEHRALQ-TMKRVVD--GVLEKHRYA
A0A3Q1EQB9_MCL1-02      -----------------GLSKPRWNESKALS-TMKRVVD--DVLDKHRYS
A0A3B4ZKP6_MCL1-01      -----------------GLSKPRWNEGKALS-TMKRVVE--DVLEKHRYA
A0A3Q1BKL8_MCL1-02      -----------------GLSKPRWNESKALS-TMKRVVD--DVLDKHRYA
A0A3Q1EQB9_MCL1-01      -----------------GLSKPRWNESKALS-TMKRVVD--DVLDKHRYS
A0A3Q1BKL8_MCL1-01      -----------------GLSKPRWNESKALS-TMKRVVD--DVLDKHRYA
A0A3P8RQX7_MCL1-02      -----------------GLSKPRWNESKALS-TMKRVVD--DVLDKHRYA
A0A3P8RQX7_MCL1-01      -----------------GLSKPRWNESKALS-TMKRVVD--DVLDKHRYA
G3PJT0_MCL1-01          -----------------GLSKTQWNPSRELT-TMKRVVG--DVLEKHRYV
A0A3B3IJ04_MCL1-01      -----------------GISQYRHRDNKYMS-TAKRVVN--DVLEKHKIT
A0A3P9L1F3_MCL1-01      -----------------GISQYRHRDNKYMS-TAKRVVN--DVLEKHKIT
A0A3B3IJ04_MCL1-02      -----------------GISQYRHRDNKYMS-TAKRVVN--DVLEKHKIT
A0A3P9L1F3_MCL1-02      -----------------GISQYRHRDNKYMS-TAKRVVN--DVLEKHKIT
A0A3B3CEX1_MCL1-01      -----------------GLSQSRHRESKYIS-TAKRVVN--DMMDKHRFA
A0A3B3CEX1_MCL1-02      -----------------GLSQSRHRESKYIS-TAKRVVN--DMMDKHRFA
A0A3Q3VP02_MCL1-01      -----------------GHGRARWTESRTLS-TMKRVVA--ELLEKHRYV
A0A3Q3B4P5_MCL1-01      -----------------GLSKRQWSESKELS-TMNRVVE--DLLTKHRFA
A0A3Q3B4P5_MCL1-02      -----------------GLSKRQWSESKELS-TMNRVVE--DLLTKHRFA
A0A3Q2EDX8_MCL1-01      -----------------GLPKQRRNQTKALS-TMKRVVE--DVLSKHRYA
A0A3Q2P7X9_MCL1-01      -----------------GLSGHRWYTKKSLS-TMKRVVE--DLLSKHRYA
A0A3Q2P7X9_MCL1-02      -----------------GLSGHRWYTKKSLS-TMKRVVE--DLLSKHRYA
A0A3B5PQ55_MCL1-01      -----------------GLSKCRWGQNKALS-TMKRVVE--DLLSKHKYA
A0A3B5PQ55_MCL1-02      -----------------GLSKCRWGQNKALS-TMKRVVE--DLLSKHKYA
A0A3P9Q4I8_MCL1-01      -----------------GLSKCRWSQNKALS-TMKRVVE--DVLSKHRYA
A0A3P9Q4I8_MCL1-02      -----------------GLSKCRWSQNKALS-TMKRVVE--DVLSKHRYA
A0A087X830_MCL1-01      -----------------GLSKCRWSQNKALS-TMKRVVE--DVLSKHRYA
A0A3B3YCD0_MCL1-01      -----------------GLSKCRWSQNKALS-TMKRVVE--DVLSKHRYA
I3JHR5_MCL1-02          -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
I3JHR5_MCL1-03          -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
I3JHR5_MCL1-01          -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A3Q4HLQ8_MCL1-01      -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A3P8NP63_MCL1-02      -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A3Q2VNL8_MCL1-01      -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A3P8NP63_MCL1-01      -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A3P9BVM3_MCL1-01      -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A3B4G4Z6_MCL1-01      -----------------GLSQPQRKETKALK-TMKRVVA--DVLEKHRYA
A0A2U9CJ81_MCL1-01      -----------------ARTDPRWTDSKALS-TMKRVVD--RLVEKHRYA
A0A3P8VKM5_MCL1-03      -----------------THSPSKWGERKALT-TMKRVVD--DVLEKHRYA
A0A3P8VKM5_MCL1-04      -----------------THSPSKWGERKALT-TMKRVVD--DVLEKHRYA
A0A3P8VKM5_MCL1-05      -----------------THSPSKWGERKALT-TMKRVVD--DVLEKHRYA
A0A3Q3IZW0_MCL1-01      -----------------GLSTHRWTRRKTLS-TMKRVVE--GVLEKHRYA
A0A3Q1GX28_MCL1-02      -----------------GLTKPRWCETKELS-TMKRVVN--DVLEKHRYA
A0A3Q1GX28_MCL1-01      -----------------GLTKPRWCETKELS-TMKRVVN--DVLEKHRYA
A0A3B4XKA5_MCL1-01      -----------------GRSIQRRTEHRALQ-TMKRVVE--GVLEKHRYA
A0A3Q3GP42_MCL1-01      -----------------GLSKPGWNESSALS-TMKRVVE--DVLAKHRYA
A0A3Q3M6G2_MCL1-01      -----------------GLSKPRWHDSKALS-TMKRVVE--DLLEKYRYT
A0A3Q3M6G2_MCL1-02      -----------------GLSKPRWHDSKALS-TMKRVVE--DLLEKYRYT
A0A3B1IEV7_MCL1-01      -----------------G--QKPREQSPALR-TMSRVVA--GVVLKHGIA
A0A3B4CGU9_MCL1-03      -----------------G--QKTRDQHPAHG-TMSRVVE--GVILKHSIA
A0A3B4CGU9_MCL1-02      ---------------------RSRNQHPASD-TLSRVVE--GMLHKHSVA
Q8UWD6_MCL1-01          -----------------GLPHSKSGRKQVLS-TMRRVVD--NLAVKHELA
A2BF68_MCL1-01          -----------------GLPHSKSGRKQVLS-TMRRVVD--NLAVKHELA
Q568W5_MCL1-01          -----------------GLPHSKSGRKQVLS-TMRRVVD--NLAVKHELA
A0A3B1K5R1_MCL1-01      -----------------GLSRSCGGHGAVVQ-TMKRVVD--DLVVKHGIA
A0A3B4C6H5_MCL1-03      -----------------GLSRSCGRHRGVVQ-TIRRVVD--GLVVKHELV
A0A3B4C6H5_MCL1-01      -----------------GLSRSCGRHRGVVQ-TIRRVVD--GLVVKHELV
Q9Z0F3_BCL2L10-01       -----------------AL--------------LRSVTR--QIQQEHQEF
E1B9B3_BCL2L10-01       -----------------AV--------------LRHVAA--RIQEANRNV
A0A1U7QVA0_BCL2L10      -----------------AL--------------LRSVAE--QIQQQHHFF
F1RZB9_BCL2L10-01       -----------------AV--------------LRCVAA--QIREYNVRT
F1MV39_BCL2L10-01       -----------------AV--------------LRHVAA--RIQEANRNV
W5QIG4_BCL2L10-01       -----------------AV--------------LRHVAA--RVLEANRNV
Q99M66_BCL2L10-01       -----------------AL--------------LRSVTS--QIQQEHQDL
F6ZPD4_BCL2L10-01       -----------------AV--------------LRCVAA--QIQPRNQRV
A0A2K6F2Q2_BCL2L10      -----------------AA--------------MRFAAT--KIRRKHASF
H0WZ06_BCL2L10-01       -----------------AL--------------LRSVTA--YIQQRHWSF
A0A1U7UZD8_BCL2L10      -----------------AV--------------LRSTAA--RLRQRHASF
G1T264_BCL2L10-01       -----------------AV--------------LRCAAT--QLQRVHWPF
A0A0D9RG38_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2K5RIU7_BCL2L10      -----------------AV--------------LRATAA--GVRKVYRSF
A0A2K5F974_BCL2L10      -----------------AV--------------LRAMAA--GVRKLYRSF
A0A2K6TIT7_BCL2L10      -----------------AV--------------LRATAA--VVRKLYPSF
F7CT87_BCL2L10-01       -----------------AV--------------LRAVAA--SVRKLYRSF
A0A096NM44_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2K6R5T5_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
Q9HD36_BCL2L10-02       -----------------AV--------------LRSAAA--RLRQIHRSF
G1R3W6_BCL2L10-01       -----------------AM--------------LRSAAA--RLRQLHPSF
A0A2K5K3B0_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2K6M5H5_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2K5TKG9_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
F7H6U5_BCL2L10-01       -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2K6B2D9_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2K5MMZ4_BCL2L10      -----------------AV--------------LRSAAA--RLRQLHRSF
H2NN92_BCL2L10-01       -----------------AV--------------LRSAAA--RLRQLHRSF
A0A2R9BCD9_BCL2L10      -----------------AV--------------LRSAAA--RLRQIHRSF
H2Q9G4_BCL2L10-01       -----------------AV--------------LRSAAA--RLRQIHRSF
G3QLU6_BCL2L10-01       -----------------AV--------------LRSAAA--RLRQIHRSF
A0A337RYG8_BCL2L10      -----------------AV--------------LRYLAA--QIRQRHQRF
G1LKR4_BCL2L10-01       -----------------AV--------------LRSVAA--QVQQRHERF
A0A452QJG0_BCL2L10      -----------------AV--------------LRSVAA--QVQQRHEHF
A0A3Q4MN81_BCL2L10      --------------------AA-----------MRRLGW--DIERQHQAR
A0A3B4ETX9_BCL2L10      --------------------AA-----------MRRLGW--DIERQHQAR
A0A3Q2PJS5_BCL2L10      --------------------AA-----------MRRLAQ--DVESQHQAR
A0A3Q2GL87_BCL2L10      --------------------AA-----------MRRLAQ--DMETQHQAR
A0A3B5MJ12_BCL2L10      --------------------AA-----------MRRLAQ--DVEAKHQAR
M4AUW7_BCL2L10-01       --------------------AA-----------MRRLAQ--DVEAKHQAR
A0A096ME02_BCL2L10      --------------------AA-----------MRRLAQ--DVEAQHQAR
A0A3B3TYN4_BCL2L10      --------------------AA-----------MRRLAQ--DVEAQHQAR
A0A3B3YT99_BCL2L10      --------------------AA-----------MRRLAQ--DVEAQHQAR
A0A3P9NE65_BCL2L10      --------------------AA-----------MRRLAQ--DVEAQHQAR
A0A3P9IIZ2_BCL2L10      --------------------AA-----------MRRLAQ--DMEAQYQPR
A0A3P9LM07_BCL2L10      --------------------AA-----------MRRLAQ--DMEAQYQPR
H2MBQ3_BCL2L10-01       --------------------AA-----------MRRLAQ--DMEAQYQPR
A0A3B4AAV4_BCL2L10      --------------------SA-----------MRRLGQ--DMEAQHKAR
A0A3Q3EZT5_BCL2L10      --------------------AA-----------IRRLAQ--DMEKQHQAR
A0A3Q3EZT5_BCL2L10      --------------------AA-----------IRRLAQ--DMEKQHQAR
A0A3Q3JQ78_BCL2L10      --------------------AA-----------MRCLAQ--DMETQHQAR
A0A3B4TIY6_BCL2L10      --------------------AA-----------MRSMAQ--DMETQHQAR
A0A3B4WGF4_BCL2L10      --------------------AA-----------MRGMAQ--DMETQHQAR
A0A3Q3KZW1_BCL2L10      --------------------AA-----------MRCLAQ--KMERQHQAR
A0A3B5KD08_BCL2L10      --------------------TA-----------MRHLGQ--DMEKQHQAR
A0A3Q3VI28_BCL2L10      --------------------AA-----------MRDLAQ--DMEKQHQAR
A0A3Q1GM98_BCL2L10      --------------------AA-----------MRRLAQ--DMEKQHQAR
A0A3Q1D2L0_BCL2L10      --------------------AA-----------MRRLAQ--DMEKQHQAR
A0A3P8RL82_BCL2L10      --------------------AA-----------MRRLAQ--DMEKQHQAR
A0A3B4ZFS0_BCL2L10      --------------------AA-----------MRCLAQ--DMEKQHQAR
A0A3Q2UUN9_BCL2L10      --------------------AA-----------MRRLGW--DIERQHQAR
A0A3P8PVZ8_BCL2L10      --------------------AA-----------MRRLGW--DIERQHQAR
A0A3Q2UUN9_BCL2L10      --------------------AA-----------MRRLGW--DIERQHQAR
A0A3P9BLI0_BCL2L10      --------------------AA-----------MRRLGW--DIERQHQAR
A0A3Q0S9R1_BCL2L10      --------------------AA-----------MRRLGQ--DIERQHQAR
D2IT42_BCL2L10-02       --------------------AA-----------MRGLAQ--DMERQHYAR
A0A3B3C5I4_BCL2L10      --------------------SA-----------MRRLAQ--DMETQYQPR
A0A3Q1IAB0_BCL2L10      --------------------AA-----------MRRLAQ--DMEKQHQVR
A0A3P8W7K5_BCL2L10      --------------------AA-----------MRHLAQ--DMEKQHQAR
H3AAS7_BCL2L2-02        -----------------PLYRA-----------MREAGD--EFEARFHRT
H3AAS7_BCL2L2-01        -----------------PLYRA-----------MREAGD--EFEARFHRT
G1Q051_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETHFRCT
G3WPT1_BCL2L2-01        -----------------PLHRA-----------MRAAGD--EFESRFRRT
A0A287D9B3_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A482LX62_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
W5QDH4_BCL2L2-02        -----------------PLHQA-----------MRAAGD--EFETRFRRT
Q7TS60_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
G1LMC3_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
M3Y5X5_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
G1P3J2_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
G3WPT1_BCL2L2-02        -----------------PLHRA-----------MRAAGD--EFESRFRRT
G1TV33_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRQN
P70345_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
O88996_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A3Q9B4M8_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
H0XR82_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A250YBR2_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A250YBR2_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
L8HP19_BCL2L2-02        -----------------PLHQA-----------MRAAGD--EFETRFRRT
L8HP19_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
Q1RMX3_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A452ECF0_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A286XQQ9_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K5RUN8_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K5MZX9_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A0D9RU30_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K5HEJ9_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A1S3FYD8_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2I2UAE3_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2I2YPX6_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A287D9B3_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K5V0Q3_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
F7G4L5_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6EA59_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6AI25_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A1U7RC37_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2I3GEA7_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2R9A2Q3_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
H2Q805_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A096NX09_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6GWM6_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6ME72_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6RW35_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6RW35_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K6TM77_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A287ATE4_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A1U7UJF2_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A452SHI1_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
Q05KI8_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
Q2TAP5_BCL2L1-01        -----------------EVLQA-----------LLEATE--EFELRYQRA
Q91828_BCL2L1-01        -----------------EVLQA-----------LLEATE--EFELRYQRA
I7GKS6_BCL2L1-01        ----------------------------------------------NRRW
A0A2K5EBP4_BCL2L1-      ----------------------------------------------IRRW
A0A2K5Q6R6_BCL2L1-      ----------------------------------------------IRRW
A0A2K6UWY8_BCL2L1-      ----------------------------------------------IRRW
Q5XGJ4_BCL2L2-01        -----------------SLHSA-----------MRAAGD--EFEERFRQA
F7G6M3_BCL2L2-01        -----------------PLHRA-----------MRAAGD--EFESRFRRA
A0A2K5CWY6_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K5CWY6_BCL2L2-      -----------------PLHQA-----------MRAAGD--EFETRFRRT
G3TMU7_BCL2L2-01        -----------------PLHQA-----------MRAAGD--EFETRFRRT
A0A2K5M8B1_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A2K5H963_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A2K5VPG2_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A2K5YR37_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A2R8Z9D7_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A096NV05_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A2K6QFA2_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLNRR
A0A1U7T4L4_BCL2L1-      ---------------------M-----------WKRTGL--RPQKGLSRR
A0A2K6G3C5_BCL2L1-      ---------------------M-----------QKRTGL--RPQKRLNRR
A0A3Q1LRT3_BCL2L1-      -----------------TVKQA-----------LREASN--EFKLRYQQT
H9GHK7_BCL2L1-01        -----------------DVSQT-----------LREAGD--EFELRYRRA
Q07816_BCL2L1-04        -----------------DVRQA-----------LRDAGD--EFELR--GF
A0A493TIA6_BCL2L1-      -----------------AVRQA-----------LREAGD--EFELRYRRA
Q07816_BCL2L1-02        -----------------DVRQA-----------LRDAGD--EFELRYRRA
Q07816_BCL2L1-03        -----------------DVRQA-----------LRDAGD--EFELRYRRA
Q07816_BCL2L1-01        -----------------DVRQA-----------LRDAGD--EFELRYRRA
G1N5N5_BCL2L1-01        -----------------DVRQT-----------LRDAGD--EFELRYRRA
A0A452ILL8_BCL2L1-      -----------------GVRQA-----------LREAGD--EFELRYRRA
A0A452ILL8_BCL2L1-      -----------------GVRQA-----------LREAGD--EFELRYRRA
K7F655_BCL2L1-01        -----------------EVRQA-----------LREAGD--EFELRYRRA
A0A452E1B1_BCL2L1-      -----------------VVKQA-----------LREASN--ECELRYQQT
W5PSA5_BCL2L1-01        -----------------VVKQA-----------LREASN--ECELRYQQT
P53563_BCL2L1-03        -----------------AVKQA-----------LREAGD--EFELRYRRA
P53563_BCL2L1-02        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A287CZ07_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELWYWRA
F6WA14_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
G3WKX6_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
M3XA94_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
M3XA94_BCL2L1-02        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A3Q2H0F6_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
H0X6V2_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
G3SPN0_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
Q2PFS6_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
O35843_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
M3XA94_BCL2L1-03        -----------------AVKQA-----------LREAGD--EFELRYRRA
G1RER8_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A1S2ZQT6_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
Q64373_BCL2L1-09        -----------------AVKQA-----------LREAGD--EFELRYRRA
Q64373_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
P53563_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
O77737_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
Q9MYW4_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A3Q2H0F6_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
L8J061_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
Q05KJ0_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
Q05KJ0_BCL2L1-02        -----------------AVKQA-----------LREAGD--EFELRYRRA
E2IV76_BCL2L1-01        -----------------AVKQA-----------LKEAGD--EFELRYRRA
A0A2K6G3C5_BCL2L1-      -----------------AVKQA-----------LKEAGD--EFELRYRRA
B2Z3Z4_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
G3HEA7_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
G3HEA7_BCL2L1-02        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A1U7T4L4_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
M3Z2H9_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A1U7QU73_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A0D9RJZ8_BCL2L1-      -----------------AVKQT-----------LREAGD--EFELRYRRA
A0A286Y5D6_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A250YD48_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A1L5BWY3_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
I3MUP5_BCL2L1-02        -----------------AVKQA-----------LREAGD--EFELRYRRA
I3MUP5_BCL2L1-03        -----------------AVKQA-----------LREAGD--EFELRYRRA
I3MUP5_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
G1P9D2_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5EBP4_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
E2IV75_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
F7IT34_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
Q76LT7_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5Q6R6_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5Q6R6_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5M8B1_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5H963_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
Q8SQ42_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5VPG2_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K5YR37_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2R8Z9D7_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A096NV05_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2J8VIH3_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K6QFA2_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K6QFA2_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A2K6UWY8_BCL2L1-      -----------------AIKQA-----------LREAGD--EFELRYRRA
E2IV77_BCL2L1-01        -----------------AIKQA-----------LREAGD--EFELRYRRA
A0A452SDS4_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A384D3U1_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A452FWV3_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
Q9MZS7_BCL2L1-01        -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A3B3E2W4_BCL2L1-      -----------------AIKST-----------LKDSAN--EFERRFSQG
A0A3B3I2Q5_BCL2L1-      -----------------AIKST-----------LKDSAD--EFERRFHQG
A0A3P9I2N4_BCL2L1-      -----------------AIKST-----------LKDSAD--EFERRFHQG
A0A3P9MKK4_BCL2L1-      -----------------AIKST-----------LKDSAD--EFERRFHQG
A0A3B5B4X7_BCL2L1-      -----------------AVKAA-----------LKDSAD--EFELLFTQA
A0A3B4BFZ8_BCL2L1-      -----------------AIKTA-----------LTDSAD--EFEELFTQA
A0A3Q3FUB6_BCL2L1-      -----------------AVKAA-----------LLDSAD--EFELLFTQA
A0A3B5MGS2_BCL2L1-      -----------------VVKSV-----------LKDAAE--EFERLYTQS
M4A558_BCL2L1-01        -----------------VVKSV-----------LKDAAE--EFERLYTQS
A0A3P9QFB3_BCL2L1-      -----------------VVKSV-----------LKDAAE--EFERLYTQS
A0A087YBW4_BCL2L1-      -----------------VVKLV-----------LKDAAE--EFERLYTQS
A0A3B3VWI7_BCL2L1-      -----------------VVKLV-----------LKDAAE--EFERLYTQS
A0A3B3XN57_BCL2L1-      -----------------VVKSV-----------LKDAAE--EFERLYTQS
A0A3Q2C6K4_BCL2L1-      -----------------AVKSA-----------LKDSAN--EFELLFSQS
A0A3Q2NRP4_BCL2L1-      -----------------AVKSA-----------LRDSAD--EFEHLFTQS
A0A0B4KJI5_BCL2L1-      -----------------AVKAA-----------LRDSSE--EFELLFTQA
A0A3Q1JZ46_BCL2L1-      -----------------AVKTA-----------LRDSAD--EFELLFTQA
A0A3Q1JZ46_BCL2L1-      -----------------AVKTA-----------LRDSAD--EFELLFTQA
A0A3Q3NFM4_BCL2L1-      -----------------AVKAA-----------LRDSAE--EFELLFTQA
A0A3Q3NFM4_BCL2L1-      -----------------AVKAA-----------LRDSAE--EFELLFTQA
A0A3B4V9K8_BCL2L1-      -----------------AVKSA-----------LKDSAD--EFELLFNQA
A0A3B4XS24_BCL2L1-      -----------------AVKSA-----------LKDSAD--EFELLFNQA
A0A2U9BY16_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
C1BLI0_BCL2L1-01        -----------------AVKAA-----------LRDSAD--EFELRYTRA
C0HAD8_BCL2L1-01        -----------------PVKAA-----------LRDSVD--EFELRYTRA
A0A3B3ZMX9_BCL2L1-      -----------------DSAPA-----------LRDSAN--EFELRFSRA
A0A3B3TFR4_BCL2L1-      -----------------AVKEA-----------LRLSAN--EFEFRYQRA
H3CH49_BCL2L1-01        -----------------AVKEA-----------LRDTGN--EFELRYTCA
A0A3Q2FR43_BCL2L1-      -----------------AVKAA-----------LRDTAC--EFELRYARA
A0A3P8XYL5_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYALA
Q90Z98_BCL2L1-02        -----------------AVKEA-----------LRDSAN--EFELRYSRA
Q90Z98_BCL2L1-01        -----------------AVKEA-----------LRDSAN--EFELRYSRA
A0A059PJI5_BCL2L1-      -----------------AVKEA-----------LRDSGN--EFELRYSRA
A0A3B4DTL9_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYSRA
B5XAY3_BCL2L1-01        -----------------AVKEA-----------LRDSAN--EFELRYARA
W5MG74_BCL2L1-01        -----------------AVQGA-----------LRDSAN--EFELRYGRA
A0A3Q3B3X5_BCL2L1-      -----------------KVKEA-----------LRDTAN--EFELRYARA
A0A3B3IB64_BCL2L1-      -----------------AVKEA-----------LRDTAN--EFELRYALA
A0A3P9JYH1_BCL2L1-      -----------------AVKEA-----------LRDTAN--EFELRYALA
A0A3B3DHA1_BCL2L1-      -----------------AVKEA-----------LRDTAN--EFELRYALA
A0A3Q0RTF8_BCL2L1-      -----------------AVKEA-----------LRDTAN--EFELRYARA
I3IZK7_BCL2L1-01        -----------------AVKEA-----------LRDTAN--EFELRYARA
A0A2U9BY16_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A2U9BY16_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A2U9BY16_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A0D6DR75_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A3Q3WIW8_BCL2L1-      -----------------AVKDA-----------LRDSAN--EFELRYARA
A0A219P0Y3_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A3Q3MX20_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A3Q3G2E1_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYASA
A0A3Q3G2E1_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYASA
A0A3Q3G2E1_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYASA
A0A3Q1GZ93_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A3Q1GZ93_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A3Q1GZ93_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYARA
A0A3B4V3T1_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYSRA
A0A3B4XU17_BCL2L1-      -----------------AVKEA-----------LRDSAN--EFELRYSRA
H3ANS8_BCL2L1-01        -----------------AVKRT-----------LREAGE--EFELRYSRA
A0A452FHY1_BCL2L1-      -----------------TAQQA-----------PREAGS--EFELRHQQT
A0A452FHY1_BCL2L1-      -----------------TAQQA-----------PREAGS--EFELRHQQT
A0A1S3EPX7_BCL2L1-      -----------------AVKQA-----------LREAGD--EFELRYRRA
A0A218USB3_BCL2L1-      -----------------DVRQA-----------LREAGD--EFELRYRRA
A0A218USB3_BCL2L1-      -----------------DVRQA-----------LREAGD--EFELRYRRA
U3JSL7_BCL2L1-01        -----------------DVRQA-----------LREAGD--EFELRYRRA
A0A218USB3_BCL2L1-      -----------------DVRQA-----------LREAGD--EFELRYRRA
A0A218USB3_BCL2L1-      -----------------DVRQA-----------LREAGD--EFELRYRRA
H0Z8G3_BCL2L1-01        -----------------DVRQA-----------LREAGD--EFELRYRRA
Q4U2V6_BCL2L1-01        -----------------DVRQA-----------LREAGD--EFELRYRRA
R4JQR8_BCL2L1-01        -----------------QIQLK-----------LRSLGD--EFQERFQTQ
A0A346RRN1_BCL2L1-      -----------------QVQLT-----------LRTIGD--EFQERFRTQ
Q568V1_MCL1-01          -----GMCPVDR-----KLHHA-------IP-TMKRVVD--NILVKHQIA
Q1L8X3_MCL1-01          -----GMCPVDR-----KLHHA-------IP-TMKRVVD--NILVKHQIA
Q9I9N3_MCL1-01          -----GMCPVDR-----KLHHA-------IP-TMKRVVD--NILVKHQIA
A0A286XUI2_BCL2A1-      -----------------KASKV-----------LQDMAL--SVQEEVERR
A0A452U285_BCL2A1-      -----------------RASQV-----------LRDVAS--SVQGEVEKN
A0A452U285_BCL2A1-      -----------------RASQV-----------LRDVAS--SVQGEVEKN
A0A3B3R4U0_MCL1-01      -----TYSGLPASASRHKAYPV-----------LRRVAE--TVIGKHLIA
F7CP56_BCL2A1-03        -----------------IIRDI-----------FQQGKT--CFIPRYQFN
A0A3P8V8T6_MCL1-01      ---------------------------------MKRVVK--GILDKHRHA
A0A3P8YNB4_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3P8WUE9_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3B4A3G8_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3Q3G1D7_BCL2-01      -----------------DIHRV-----------LREAGD--ELERLYQPD
A0A3Q2XQX2_BCL2-02      -----------------DIHRV-----------LREAGD--ELERLYQPD
A0A3Q2XQX2_BCL2-01      -----------------DIHRV-----------LREAGD--ELERLYQPD
A0A3Q3B0R2_BCL2-01      -----------------HIHRV-----------LREAGD--ELERLYQPD
A0A3Q2PN77_BCL2-01      -----------------DIHRV-----------LREAGD--ELERLYQLD
A0A3P9J8Y9_BCL2-01      -----------------DIHRV-----------LREAGD--ELERLYQRD
A0A3Q0S5Z7_BCL2-01      -----------------DIHRV-----------LREAGD--ELERLYQPD
A0A3P8QVM8_BCL2-01      -----------------GIHRV-----------LREAGD--ELERLYQPD
A0A3P9DIG5_BCL2-01      -----------------GIHRV-----------LREAGD--ELERLYQPD
A0A3Q2UYW8_BCL2-01      -----------------GIHRV-----------LREAGD--ELERLYQPD
A0A3B4G3K4_BCL2-01      -----------------GIHRV-----------LREAGD--ELERLYQPD
A0A2U9BJ09_BCL2-01      -----------------AVHRV-----------LREAGD--ELERLYQPD
A0A3Q1I5N1_BCL2-01      -----------------ALHRV-----------LREAGD--ELERLYQPD
A0A3Q3K1K1_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3Q3MEY1_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A1X9JZA1_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A4D6FTA2_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3Q1FLK7_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3Q1B8C3_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3P8S9L3_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3B5BBQ0_BCL2-01      -----------------AIHRV-----------LREAGD--ELERLYQPD
A0A3B4TX71_BCL2-01      -----------------EIHRV-----------LREAGD--ELERLYQPD
A0A3B4YAG2_BCL2-01      -----------------EIHRV-----------LREAGD--ELERLYQPD
G1TW27_BCL2-02          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
E2RS00_BCL2A1-02        -----VLQIPQPGPAPSRASRV-----------LQDVAF--SVQGQVEKN
A0A3B3TCS4_BCL2-01      -----------------RLHRV-----------LREAGD--EIERMFQRD
A0A0U3DHY6_BCL2-01      -----------------RLHRV-----------LREAGD--EIERMYLRD
A0A3P9AAB2_BCL2-01      -----------------RLHRV-----------LRDAGN--EIERMYQRD
X4ZGI8_BCL2-01          -----------------RIYRS-----------LREAGD--QIERMYQRE
A0A3P9MKK4_BCL2L1-      ----------MD-----AIKST-----------LKDSAD--EFERRFHQG
A0A3B3I2Q5_BCL2L1-      ----------MD-----AIKST-----------LKDSAD--EFERRFHQG
A0A3P9I2N4_BCL2L1-      ----------MD-----AIKST-----------LKDSAD--EFERRFHQG
A0A3B4AFB7_MCL1-01      ----------QPKWKQRPALST-----------MKGVVD--KLLEKHRYA
G3TVG9_MCL1-01          -----SLDIIFRYLHEQAIGATQGRQLEGVR-NLPRVAD--GVQRNEETV
B9ZYL7_BCL2-01          GGDEAVMQPVPS-----AVLQT-----------LSRAGD--EFSRLYQQD
A0A3L7HT14_BCL2A1-      -----------------RVASS-----------VQKEVE--KNLKLYLDD
F6YNL8_BCL2-01          -----TVSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A218UQA0_BCL2-01      -----GLRPAPQ-----VVHLV-----------LRQAGD--EFSRRYQRD
Q00709_BCL2-01          -----GLRPAPP-----GVHLA-----------LRQAGD--EFSRRYQRD
A0A493T1X3_BCL2-01      -----GLRPAPP-----VVHLA-----------LRQAGD--EFSRRYQRD
U3KEW4_BCL2-01          -----GLRPAPQ-----VVHLV-----------LRQAGD--EFSRRYQRD
G3WZW9_BCL2-01          -----AVSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
M3YYK3_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
M3X1R9_BCL2-02          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K6R2I5_BCL2-02      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2R9APW6_BCL2-01      ------LSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
G3SLZ1_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
Q75SV7_BCL2-01          -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
M3X1R9_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
Q8I008_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A076FU27_BCL2-01      -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A4P8GLJ2_BCL2-01      -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
F6R2C4_BCL2-01          -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
O02718_BCL2-01          -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A076FZV9_BCL2-01      -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A452EV13_BCL2-01      -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A250YD83_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A9QXG9_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K5NZS5_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A0D9S017_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K6CIX3_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K5XRD4_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K6KHG1_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K6R2I5_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K5HK49_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
G3QES9_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
H2QEM8_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2I3GZF9_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K6UEL3_BCL2-01      -----XXSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
E2QWA1_BCL2-01          -----XXSPVPP-----VVHLT-----------LRQAGD--DFSRRYRR-
G1LIC9_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A452R110_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A452R110_BCL2-02      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
G3WZW9_BCL2-02          -----AVSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
G3SLZ1_BCL2-02          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A452T603_BCL2-01      --------PVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
M3Y8D1_BCL2L10-01       -----------------REAAV-----------LRSVAA--VVRQRHERF
A0A3Q2Y539_MCL1-01      -----------------KAQST-----------MKRVVT--RLVDKHRIL
A0A3Q3BEB7_BCL2L1-      -----DIE---------AVKSA-----------LKDSAD--EFERLYTQS
A0A3P8VMA1_BCL2L1-      -----GAE---------AVKAA-----------LKDSAD--EFELRFTQA
A0A345BSW9_BCL2L1-      -----GLD---------AVKEA-----------LRDSAN--EFELRYSRA
A0A286MU87_BCL2L1-      -----GME---------PVKAA-----------LRDSVD--EFELRYTRA
A0A3P8XFS0_BCL2L1-      -----CME---------AVKAA-----------LRDSAD--EFELRYTRA
A0A3P8XFS0_BCL2L1-      -----CME---------AVKAA-----------LRDSAD--EFELRYTRA
A0A0F7L1T6_BCL2L1-      -----GIE---------AVNAA-----------LRDSAE--EFEKLFAQA
H2U5I3_BCL2L1-01        -----GIE---------AVNAA-----------LRDSAE--EFEKLFAQA
A0A3Q3J5K3_BCL2L1-      ------IE---------AVKAA-----------LRDSAD--EFELRFTQA
A0A3Q1EVP6_BCL2L1-      ------IE---------AVKST-----------LKDAAD--EFELLFTQT
A0A3Q1BQA0_BCL2L1-      ------IE---------AVKSA-----------LKDAAD--EFELLFTQA
A0A3P8U812_BCL2L1-      ------IE---------AVKSA-----------LKDAAD--EFELLFTQA
E6ZFR0_BCL2L1-01        -----DIE---------AVKAA-----------LRDSAD--EFELLFTQA
G3P7B4_BCL2L1-01        -----DTE---------AVKAA-----------LQDSAN--EFELLFTQA
A0A3Q3X5M5_BCL2L1-      -----DME---------AVKSA-----------LRDSAN--EFEQLFTQA
A0A2U9BIG9_BCL2L1-      ------VG---------AVKEA-----------LRDSAH--EFEQLFNQA
D2ITA2_BCL2L1-02        -----------------AVRAA-----------LLESVE--EFELRYTLA
A0A3B3ZMX9_BCL2L1-      ----------LD-----AVKEA-----------LRDSAN--EFELRFSRA
G3NJY1_BCL2L1-01        -----AS---LD-----AVKEA-----------LRDSAN--EFELRYARA
A0A2U9BY16_BCL2L1-      -----PS---LD-----AVKEA-----------LRDSAN--EFELRYARA
A0A3Q3DUT7_BCL2L1-      ----------LD-----AVKEA-----------LRDSAN--EFELRYSHA
A0A3Q3DUT7_BCL2L1-      ----------LD-----AVKEA-----------LRDSAN--EFELRYSHA
A0A3Q3DUT7_BCL2L1-      ----------LD-----AVKEA-----------LRDSAN--EFELRYSHA
A0A3B1JJ42_BCL2L1-      ----------LD-----AVKEA-----------LRDSAN--EFELRYSRA
A0A3P8UWG7_BCL2L1-      -----TS---LD-----SIKEA-----------LRDSAN--EFELRYARA
A0A3Q3IVF5_BCL2L1-      -----AN---LD-----AVKEA-----------LRDSAN--EFELRYARA
A0A3Q1DHJ3_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3Q1DHJ3_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3Q1DHJ3_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3P8TL99_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3P8TL99_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3Q1FR00_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3B4Z3X2_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3B4Z3X2_BCL2L1-      ----------MD-----AVKEA-----------LRDTAN--EFELRYARA
C3VIT1_BCL2L1-01        -----TTTTRLD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3P8P0F1_BCL2L1-      -----TTD--LD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3Q2X557_BCL2L1-      -----TTD--LD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3P9D632_BCL2L1-      -----TTD--LD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3P9D632_BCL2L1-      -----TTD--LD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3Q4N4B5_BCL2L1-      -----TTD--LD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3B4FNX1_BCL2L1-      -----TTD--LD-----AVKEA-----------LRDTAN--EFELRYARA
A0A3Q2QPL9_BCL2L1-      ----------ME-----AVKVA-----------LRETAC--EFELRYARA
A0A3B5PQJ0_BCL2L1-      ----------MD-----AVKVA-----------LRDTAR--EFELRYSRA
A0A087X9B7_BCL2L1-      ----------MD-----AVKVT-----------LRDTAR--EFELRYSRA
A0A3B3TUS7_BCL2L1-      ----------MD-----AVKVT-----------LRDTAR--EFELRYSRA
A0A3B3WI27_BCL2L1-      ----------MD-----AVKVT-----------LRDTAR--EFELRYSRA
A0A3P9N9Y4_BCL2L1-      ----------MD-----AVKVT-----------LRDTAR--EFELRYSRA
A0A3B3QRZ2_BCL2L1-      -----LHSPSPSPQGLEAVKEA-----------LRDSAN--EFELRYSRA
Q564A4_BCL2-01          -----HLR----------LYRV-----------LRDAGD--EIERIYQRE
H9GPE7_BCL2-01          --------PVPQ-----VVHTT-----------LRQAGD--EFSRRYRRD
A0A452I9V7_BCL2-01      -----GLRPAPQ-----AVLLA-----------LCQAGD--EFSRRYHRD
W5N4F7_BCL2-01          -----------A-----ALHKV-----------LREAGD--EIERMYHRD
K7F5Y3_BCL2-02          -----GLRSAPQ-----AVHLT-----------LCQAGD--EFSRRYHRD
A0A3Q2HRY3_BCL2-02      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
K7F5Y3_BCL2-01          -----GLRSAPQ-----AVHLT-----------LCQAGD--EFSRRYHRD
F1LNV0_BCL2-01          -----ALSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
P49950_BCL2-01          -----ALSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
G1TW27_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K5EB04_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2R8MY14_BCL2-01      -----TLSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
H2NWH5_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A096MPU7_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K5PP81_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
H0WKI0_BCL2-01          -----LLSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
A0A2K5UDI5_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
P10417_BCL2-01          -----ALSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
Q7TSN8_BCL2-01          -----ALSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
A0A3Q2HRY3_BCL2-01      -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
E2QWA1_BCL2-02          -----XXSPVPP-----VVHLT-----------LRQAGD--DFSRRYRR-
A0A2K6G3I7_BCL2-01      -----APSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
Q6R755_BCL2-01          -----TLSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
Q9JJV8_BCL2-01          -----TLSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
Q923R6_BCL2-01          -----TLSPVPP-----VVHLT-----------LRRAGD--DFSRRYRRD
H0W1T3_BCL2-01          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRQD
G1LIC9_BCL2-02          -----ALSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
I3MVK9_BCL2-01          -----VLSPVPP-----VVHLT-----------LRQAGD--DFSRRYRRD
                                                                          

P70345_BCL2L2-02        ----------MEP-LV--------------------------G-------
G1MZW1_BCL2-01          ------------V---------------------EELFRD--G-VNWGRI
A2BF68_MCL1-02          LSGMI-----ARL-NL--EQKGEDVSFIKQVA--TELFSD--GTTNWGRI
A0A3L7HT14_BCL2A1-      ------------M-AC--APMLVHRGHAPSLP--TASEGD--GRGRGGTC
F7CP56_BCL2A1-02        -------------------------------M--EKQFED--GIINWGRI
F7CP56_BCL2A1-01        LKPCL-----DNF-HV--VSIDAARTIFNQVM--EKQFED--GIINWGRI
H0ZCL9_BCL2A1-01        VRPLL-----DRI-DI--TSVAAAKRIFNGVM--DEKFAD--GNTNWGRI
U3JTB2_BCL2A1-01        LRPLL-----DRI-DI--TSVAVAKRIFNGVM--DEKFAD--GNTNWGRI
A0A218V8Z6_BCL2A1-      VRPLL-----DRI-DI--SSVAVAKRIFNGVM--DEKFAD--GNTNWGRI
Q9W6F2_BCL2A1-01        LRPFL-----DRI-DI--TSVDVAKRIFNGVM--EEKFAD--GNTNWGRI
A0A493SSZ7_BCL2A1-      LRPFL-----DRI-DI--SSVDVAKRIFNGVM--DEKFAD--GNTNWGRI
G1N8C5_BCL2A1-01        LRPFL-----DRI-DI--TSVDVAKRIFNGVM--EEKFAD--GNTNWGRI
A0A452J3N6_BCL2A1-      LKPCL-----DTF-DI--TSVDAARRIFTQVM--DKEFAD--GNTNWGRI
K7G130_BCL2A1-01        LKPCL-----DTL-DI--TSVDAARRIFIQVM--DKEFDD--GNTNWGRI
A0A2K5PYQ3_BCL2A1-      -KPCL-----DNV-NI--VSIDNARTIFSQVM--ETEFED--GIINWGRI
A0A2K5PYQ3_BCL2A1-      -KPCL-----DNV-NI--VSIDNARTIFSQVM--ETEFED--GIINWGRI
F6SFL4_BCL2A1-01        METCL-----STL-DI--VSVESARRIFNSVM--KKEFED--GVINWGRI
G3WSP8_BCL2A1-01        METFL-----STL-DI--TSVDCARRIFNSVM--EKEFED--GIINWGRI
F6S8G3_BCL2A1-01        LKPCF-----DSL-DV--GSVGAARRIFGQIV--EKEFED--GIVNWGRI
O55178_BCL2A1-01        LKSYL-----DDF-HV--ESIDTTRIIFNQVM--EKEFED--GIINWGRI
Q0P538_BCL2A1-01        LKSYL-----DDF-HV--ESIDTTRIIFNQVM--EKEFEN--GIINWGRI
G3V977_BCL2A1-01        LKPYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
Q925A9_BCL2A1-01        LKPYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
Q07440_BCL2A1-01        LKSYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
O55179_BCL2A1-01        LKSYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
O55177_BCL2A1-02        LKSYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
Q497M6_BCL2A1-01        LKSYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
Q8K164_BCL2A1-01        LKSYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
Q4FK02_BCL2A1-01        LKSYL-----DDF-HV--ESIDTARIIFNQVM--EKEFED--GIINWGRI
A0A452SIR9_BCL2A1-      LKPCL-----DSF-DV--VSVDSARTIFNQVM--EKEFED--GIINWGRI
M3YVH4_BCL2A1-01        LRPCL-----DSF-DV--GSIDTARTIFNQVM--EKEFED--GIINWGRI
U6CQS8_BCL2A1-01        LKPCL-----DSF-DV--GSIDTARTIFNQVM--EKEFED--GIINWGRI
I3MCZ7_BCL2A1-01        LKPFL-----DNF-DV--VSADTARTIFNQVM--EKEFED--GIMNWGRI
G3T8E6_BCL2A1-01        LKPCL-----DNF-VV--ISIDTAQTIFKQVM--EKEFED--GIINWGRI
H0WZ23_BCL2A1-01        LKPCL-----DNF-NV--VSIDTARTIFNQVM--EKEFED--GIINWGRI
A0A2K6TLJ5_BCL2A1-      LKPCL-----DNV-HI--VSMDNARTIFSQVM--EKEFED--GIINWGRI
A0A2K5D2I1_BCL2A1-      LKPCL-----DNV-NI--VSIDNARMIFSQVM--EKEFED--GIINWGRI
B4E1X9_BCL2A1-01        LKSCL-----DNV-NV--VSVDTARTLFNQVM--EKEFED--GIINWGRI
A0A2I2YML2_BCL2A1-      LKSCL-----DNV-NV--VSIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2R8ZJX9_BCL2A1-      LKSCL-----DNV-NV--VSVDTARTLFNQVM--EKEFED--GIINWGRI
A0A2I3HBP6_BCL2A1-      LKPCL-----DNV-NV--VSIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6PHF2_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6LV19_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K5TMD1_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K5KAA3_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTIFNQVM--EKEFED--GIINWGRI
A0A2K6DS18_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A096NMX5_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6AD27_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
F7HXW0_BCL2A1-01        LKSCL-----DNV-DI--ASIDNARTIFSQVM--EKEFED--GIINWGRI
A0A2K6TLJ5_BCL2A1-      LKPCL-----DNV-HI--VSMDNARTIFSQVM--EKEFED--GIINWGRI
A0A2I3HBP6_BCL2A1-      LKPCL-----DNV-NV--VSIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6EKG1_BCL2A1-      LKACL-----DNV-NV--ASIDAARTIFNQVM--EKEFED--GIVNWGRI
A0A452EK63_BCL2A1-      LKQCL-----DKF-DV--VSVDTARTIFNQVM--EKEFED--GIVNWGRI
W5Q0N6_BCL2A1-01        LKQCL-----DKF-DV--VSVDTARTIFNQVM--EKEFED--GIVNWGRI
L8IZT5_BCL2A1-01        LKQCL-----DKF-DV--VSVDTARTIFNQVM--EKEFED--GIVNWGRI
Q3C2I0_BCL2A1-01        LKQCL-----DKF-DV--VSVDTARTIFNQVM--EKEFED--GIVNWGRI
F7CP56_BCL2A1-04        LKPCL-----DNF-HV--VSIDAARTIFNQVM--EKQFED--GIINWGRI
C7F841_BCL2A1-01        LKPCL-----DNF-DV--VSIDTARIIFNQVM--EKEFED--GIINWGRI
A0A2K5D2I1_BCL2A1-      LKPCL-----DNV-NI--VSIDNARMIFSQVM--EKEFED--GIINWGRI
H2NNZ9_BCL2A1-01        LKPCL-----DNV-NV--VSVDTARTLFNQVM--EKEFED--GIINWGRI
A0A2I2YML2_BCL2A1-      LKSCL-----DNV-NV--VSIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6LV19_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6PHF2_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K5KHH8_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K5KHH8_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K5KAA3_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTIFNQVM--EKEFED--GIINWGRI
A0A2K5TMD1_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
F7E8V5_BCL2A1-01        LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6DS18_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A2K6AD27_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A096NMX5_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
A0A0D9RRC3_BCL2A1-      LKPCL-----DNV-NV--ASIDTARTLFNQVM--EKEFED--GIINWGRI
Q16548_BCL2A1-01        LKSCL-----DNV-NV--VSVDTARTLFNQVM--EKEFED--GIINWGRI
A0A2R8ZJX9_BCL2A1-      LKSCL-----DNV-NV--VSVDTARTLFNQVM--EKEFED--GIINWGRI
G1QEX2_BCL2L10-01       LEQMV-----DQI---------------------ESLVPDGTD-PNWLSV
A0A3Q1FR00_BCL2L1-      FSDLH-----SQL-HI--TPATAYQS-FENVM--DEVFRD--G-VNWGRI
F6VJQ0_BCL2L10-01       FECAL-----NQLLDR--EPEQVIVN-----V--AELMDR--GEFNWGRV
H3AR18_MCL1-01          FNGMQ-----QKL-NI--HKEDDLHI-IPEIG--NQIFKD--GATNWGRI
J7H260_MCL1-01          FQGML-----QKL-SI--QRPEDIQK-LSEVP--SMVFSD--GVTNWGRI
G1PZ39_MCL1-01          FQG-----------------ERGPRA-LCLVR--DRWAPV--GGNRDEPG
Q95KR3_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVLSD--GVTNWGRI
A0A2K5EPX0_MCL1-02      C--ML-----RKL-DI--KNKDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5EPX0_MCL1-01      SPGML-----RKL-DI--KNKDDVKS-LSRVM--VHVFSD--GVTNWGRI
Q9Z1P3_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-FSRVM--THVFKD--GVTNWGRI
A5PJR2_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A452GA25_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
G1L3L7_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
G1T2Q0_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
F7AVA6_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--AHVFSD--GVTNWGRI
A0A337S3J9_MCL1-01      FQGML-----RKL-DI--KNENDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A337S3J9_MCL1-03      FQGML-----RKL-DI--KNENDVKS-LSRVM--VHVFSD--GVTNWGRI
Q7YRZ9_MCL1-01          FQGML-----RKL-DI--KNENDVKS-LSRVM--VHVFSD--GVTNWGRI
F1PAP1_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVI--VHVFSD--GVTNWGRI
Q8HYS5_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVI--VHVFSD--GVTNWGRI
M3XZZ5_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A452RHX5_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
H0XFB7_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
F7GTF7_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5CFH3_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K6V5Y3_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K6KRW9_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5XSB2_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A0D9RZP5_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
I7G687_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5LXU8_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2I3GJZ3_MCL1-02      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
H2N5Y9_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2R9BPJ5_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2I3RTV4_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2I2YQH7_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2K5C7L5_MCL1-01      FQ----------V-----------------------LPCR--RPRRW---
A0A2K5I9I0_MCL1-02      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K6GI15_MCL1-01      FQGWV-----CGV-----------------------LPCR--GPRRR---
A0A2I3GJZ3_MCL1-01      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K5CFH3_MCL1-03      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K5R5E2_MCL1-03      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K5W0W9_MCL1-01      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K6ECR0_MCL1-02      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2I3LFM0_MCL1-01      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K6KRW9_MCL1-02      FQGWV-----CGV-----------------------LPCR--GPRRW---
A0A2K6PPI3_MCL1-02      FQGWV-----CGV-----------------------LPCR--GPRRW---
G3WBC5_MCL1-01          FQGML-----RKL-DI--KNEEDIKA-VSRVV--THVFSD--GVTNWGRI
W5QI41_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
F1MQX4_MCL1-01          FQGML-----QKL-DI--KNEDDVKS-LSRVM--VHVFSD--RVTNWGRI
B4DLY8_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
B4DG83_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
B4E3L8_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--SVTNWGRI
A0A2K5DMS4_MCL1-01      LQGML-----RNL-DN--KNEDNVKS------------FY--GVTNWGRI
U3KKY6_MCL1-01          LPGML-----RKL-EI--QQEEDLQS-VVEVA--AHVFSD--GVTNWGRV
G1MPY7_MCL1-01          FSGML-----RKL-EI--KKEEDLQA-VCEVA--AHVFSD--GVTNWGRV
K7FPN7_MCL1-01          --GML-----RKL-DI--KNEEDLKS-VSSVA--THVFSD--GITNWGRI
H3AR18_MCL1-02          FNGMQ-----QKL-NI--HKEDDLHI-IPEIG--NQIFKD--GATNWGRI
E2RS00_BCL2A1-01        LKPCL-----DSF-DV--VSVDTARTIFNQVM--EKEFED--GVINWGRI
B6V6J0_MCL1-01          FTGML-----QRL-SI--HSREDLQK-LSEVP--ALVFND--GVTNWGRI
A0A3L7HT14_BCL2A1-      LKLYL-----DDF-DV--RSIDTARTIFNQVM--EKEFED--GIINWGRI
H0XHA5_MCL1-01          MEIIS-----RYLWEQ--ETGEDINS-LSRVM--AHVFSY--GVTNWGRI
A0A2I2YPX6_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6TM77_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K5RUN8_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6GWM6_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
W5QDH4_BCL2L2-01        FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6ME72_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6RW35_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A287ATE4_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2R8M4C0_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K5MZX9_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K5HEJ9_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K5V0Q3_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
F7G4L5_BCL2L2-02        FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6EA59_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6AI25_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A1U7RC37_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2I3GEA7_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2R9A2Q3_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
H2Q805_BCL2L2-02        FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A096NX09_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A287ATE4_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A4D6NWN1_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A1U7UJF2_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A452UF16_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A452UF16_BCL2L2-      FSDLA-----AQL-HV--TPGSAQQR-FTQVS--DELFQG--G-PNWGRL
A0A2K6F6N9_MCL1-01      FQGML-----QKL-DI--KNEDDVKS-LSRVM--VHVFSD--SVTNWGRI
G1QAV8_MCL1-01          FLGML------EL-DT--ENEDNVKS-SSQAM--VHAFRD--GVTN-GRI
H9GEA6_MCL1-01          FQGML-----RKL-EI--KKEEDLAS-VAEVT--TEVFRD--GIINWGRI
H9GEA6_MCL1-02          FQGML-----RKL-EI--KKEEDLAS-VAEVT--TEVFRD--GIINWGRI
A0A493U0E8_MCL1-01      SLGML-----RKL-EI--KKEEDLQA-VGEVA--AHLFSD--GVTNWGRV
A0A1L1RNM6_MCL1-01      FQGML-----RKL-EI--KKEDDLQA-VCEVA--AHVFND--GVTNWGRV
A0A1L1RNM6_MCL1-02      FQGML-----RKL-EI--KKEDDLQA-VCEVA--AHVFND--GVTNWGRV
G2HFR3_MCL1-01          ------------L-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
F6ZMX1_MCL1-01          FQGML-----RKL-DI--KNEEDIKA-VSRVA--THVFSD--GITNWGRI
F6ZMX1_MCL1-02          FQGML-----RKL-DI--KNEEDIKA-VSRVA--THVFSD--GITNWGRI
F6ZMX1_MCL1-03          FQGML-----RKL-DI--KNEEDIKA-VSRVA--THVFSD--GITNWGRI
G1T2Q0_MCL1-02          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
F1PAP1_MCL1-02          FQGML-----RKL-DI--KNEDDVKS-LSRVI--VHVFSD--GVTNWGRI
A0A337S3J9_MCL1-04      FQGML-----RKL-DI--KNENDVKS-LSRVM--VHVFSD--GVTNWGRI
F7AVA6_MCL1-02          FQGML-----RKL-DI--KNEDDVKS-LSRVM--AHVFSD--GVTNWGRI
A0A2K6GI15_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
C8YZ26_MCL1-01          FQGML-----RRL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
F7GTF7_MCL1-02          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5R5E2_MCL1-04      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K6V5Y3_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5LXU8_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5I9I0_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2I2YQH7_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
Q07820_MCL1-04          FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2K5W0W9_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K6ECR0_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K5XSB2_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2R9BPJ5_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2I3RTV4_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A2I3LFM0_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A2K6PPI3_MCL1-03      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A286Y1M5_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVV--ALVFSD--GVTNWGRI
P97287_MCL1-01          FQGML-----RKL-DI--KNEGDVKS-FSRVM--VHVFKD--GVTNWGRI
A0A452GA25_MCL1-02      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
G3T756_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--AHVFSD--GITNWGRI
A0A1S3F3I1_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
G1L3L7_MCL1-02          FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A287BK44_MCL1-02      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A287BK44_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
B4DU51_MCL1-01          FQGML-----RKL-DI--KNEDDVKS-LSRVM--IHVFSD--GVTNWGRI
A0A287DCH9_MCL1-02      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
A0A287DCH9_MCL1-01      FQGML-----RKL-DI--KNEDDVKS-LSRVM--VHVFSD--GVTNWGRI
W5MMB7_MCL1-01          YHGMI-----AKL-EL--ENKGEDVSFVTGVA--KSLFSD--GKTNWGRI
A0A3B3SG34_MCL1-01      YNGMI-----GKL-SL--NQQSDDMTVIKTVA--ERIFSD--GTTNWGRI
Q4SW32_MCL1-01          YRGMI-----NKL-FM--EDRVGDVSFVGAVA--KSTFED--GNTNWGRV
Q0KFR9_MCL1-01          YNGMV-----AKL-DL--DDRCDDMGVINSVA--KTMFSD--GITNWGRI
A0A3P8Y1W8_MCL1-02      YKGMI-----SKL-CL--DDQGDDMGFITSVA--KSLFSD--GTTNWGRI
A0A3P8Y1W8_MCL1-01      YKGMI-----SKL-CL--DDQGDDMGFITSVA--KSLFSD--GTTNWGRI
D2ITA0_MCL1-03          YKGMI-----QKL-EL--DGRGEDMSFVTSVA--KSLFAD--STTNWGRI
D2ITA0_MCL1-04          YKGMI-----QKL-EL--DGRGEDMSFVTSVA--KSLFAD--STTNWGRI
A0A3P9ILF6_MCL1-02      YNGMI-----VRL-SL--DDQGDDMSFVSSVA--KSLFAD--GTTNWGRI
A0A3P9ILF6_MCL1-01      YNGMI-----VRL-SL--DDQGDDMSFVSSVA--KSLFAD--GTTNWGRI
A0A3Q2XZL8_MCL1-01      YNGII-----NKL-SL--DDRGDNVSFISEVA--KSLFSD--GTTNWGRV
A0A3B4AFB7_MCL1-02      YNGMI-----NKL-AL--DDRGDDVSFIGTVA--KSIFED--GTTNWGRI
A0A3B3VM25_MCL1-01      YNGML-----NRL-AL--DNQPDNMGFVTEVA--QNLFSD--GTTNWGRI
I3KXG5_MCL1-01          YNGMI-----NKL-SL--DEREEDMSF---VA--KSLFGD--HTTNWGRI
A0A3Q0R633_MCL1-01      YNGMV-----NKL-SL--DERGEDVTFVSAVA--KSLFAD--KTTNWGRI
A0A3Q0R633_MCL1-03      YNGMV-----NKL-SL--DERGEDVTFVSAVA--KSLFAD--KTTNWGRI
A0A3B4T8L9_MCL1-02      YNGMI-----NKL-SL--DNTGDDVRFVGAVA--KSLFAD--GTTNWGRI
A0A3B4T8L9_MCL1-01      YNGMI-----NKL-SL--DNTGDDVRFVGAVA--KSLFAD--GTTNWGRI
A0A3Q1EQB9_MCL1-02      YNGMI-----NKL-SL--DDIGDDVSFVSAVA--KSLFAD--RTTNWGRI
A0A3B4ZKP6_MCL1-01      YNGMI-----NKL-SL--DDRGDDVSFVSAVA--KSLFAD--RTTNWGRI
A0A3Q1BKL8_MCL1-02      YNGMI-----NKL-SL--DDRGDDVSFVSAVA--KSLFAD--RTTNWGRI
A0A3Q1EQB9_MCL1-01      YNGMI-----NKL-SL--DDIGDDVSFVSAVA--KSLFAD--RTTNWGRI
A0A3Q1BKL8_MCL1-01      YNGMI-----NKL-SL--DDRGDDVSFVSAVA--KSLFAD--RTTNWGRI
A0A3P8RQX7_MCL1-02      YNGMI-----NKL-SL--DDRGDDVSFVSAVA--KSLFAD--RTTNWGRI
A0A3P8RQX7_MCL1-01      YNGMI-----NKL-SL--DDRGDDVSFVSAVA--KSLFAD--RTTNWGRI
G3PJT0_MCL1-01          FNGMV-----NKL-SL--DDRGDDASFVREVA--TSLFAD--GTTNWGRI
A0A3B3IJ04_MCL1-01      YNGMI-----VRL-SL--DDQGDDMSFVSSVA--KSLFAD--GTTNWGRI
A0A3P9L1F3_MCL1-01      YNGMI-----VRL-SL--DDQGDDMSFVSSVA--KSLFAD--GTTNWGRI
A0A3B3IJ04_MCL1-02      YNGMI-----VRL-SL--DDQGDDMSFVSSVA--KSLFAD--GTTNWGRI
A0A3P9L1F3_MCL1-02      YNGMI-----VRL-SL--DDQGDDMSFVSSVA--KSLFAD--GTTNWGRI
A0A3B3CEX1_MCL1-01      FNGMI-----NRL-SL--EDNLDDMSFISRVA--ENMFAD--RTTNWGRI
A0A3B3CEX1_MCL1-02      FNGMI-----NRL-SL--EDNLDDMSFISRVA--ENMFAD--RTTNWGRI
A0A3Q3VP02_MCL1-01      YNGMT-----KRL-SL--ADTQDNVSFVSTVS--RDLFSD--GATNWGRI
A0A3Q3B4P5_MCL1-01      YNGII-----KKL-SL--DDKSEDMTFVTKTA--RSLFAD--GITNWGRI
A0A3Q3B4P5_MCL1-02      YNGII-----KKL-SL--DDKSEDMTFVTKTA--RSLFAD--GITNWGRI
A0A3Q2EDX8_MCL1-01      YNGMM-----NKL-CL--DEVPDNMGFVSSVA--TSLFSD--GTTNWGRI
A0A3Q2P7X9_MCL1-01      YTGMI-----RKL-NL--DQKSDDMGFVTSVA--VSLFSD--GTTNWGRI
A0A3Q2P7X9_MCL1-02      YTGMI-----RKL-NL--DQKSDDMGFVTSVA--VSLFSD--GTTNWGRI
A0A3B5PQ55_MCL1-01      YNGMV-----NRL-AL--DNEPDDMEFVTEIA--ESLFSD--GITNWGRI
A0A3B5PQ55_MCL1-02      YNGMV-----NRL-AL--DNEPDDMEFVTEIA--ESLFSD--GITNWGRI
A0A3P9Q4I8_MCL1-01      YNGML-----SKL-AL--DNQPDNMGFVTEVA--ESLFSD--GTTNWGRI
A0A3P9Q4I8_MCL1-02      YNGML-----SKL-AL--DNQPDNMGFVTEVA--ESLFSD--GTTNWGRI
A0A087X830_MCL1-01      YNGML-----NRL-AL--DNQPDNMGFVTEVA--ENLFSD--GTTNWGRI
A0A3B3YCD0_MCL1-01      YNGML-----NRL-AL--DNQPDNMGFVTEVA--ENLFSD--GTTNWGRI
I3JHR5_MCL1-02          YNGMI-----NKL-SL--DERHEDMSFVGAVA--KSLFAD--HTTNWGRI
I3JHR5_MCL1-03          YNGMI-----NKL-SL--DERHEDMSFVGAVA--KSLFAD--HTTNWGRI
I3JHR5_MCL1-01          YNGMI-----NKL-SL--DERHEDMSFVGAVA--KSLFAD--HTTNWGRI
A0A3Q4HLQ8_MCL1-01      YNGMI-----NKL-SL--DERDEDMSFVGAVA--KSLFGD--HTTNWGRV
A0A3P8NP63_MCL1-02      YNGMI-----NKL-SL--DERDEDMSFVGAVA--KSLFGD--HTTNWGRI
A0A3Q2VNL8_MCL1-01      YNGMI-----NKL-SL--DERDEDMSFVGAVA--KSLFGD--HTTNWGRI
A0A3P8NP63_MCL1-01      YNGMI-----NKL-SL--DERDEDMSFVGAVA--KSLFGD--HTTNWGRI
A0A3P9BVM3_MCL1-01      YNGMI-----NKL-SL--DERDEDMSFVGAVA--KSLFGD--HTTNWGRI
A0A3B4G4Z6_MCL1-01      YNGMI-----NKL-SL--DERDEDMSFVGAVA--KSLFGD--HTTNWGRI
A0A2U9CJ81_MCL1-01      YNGMM-----NRL-SL--DNRRDDVTFVGAVA--RSLFGD--GNTNWGRV
A0A3P8VKM5_MCL1-03      YNGMI-----NKL-SL--ENRQGDLTFISSVA--KSLFGD--GTTNWGRI
A0A3P8VKM5_MCL1-04      YNGMI-----NKL-SL--ENRQGDLTFISSVA--KSLFGD--GTTNWGRI
A0A3P8VKM5_MCL1-05      YNGMI-----NKL-SL--ENRQGDLTFISSVA--KSLFGD--GTTNWGRI
A0A3Q3IZW0_MCL1-01      YKGMI-----NKL-SL--DERGDDMSFVGSVA--QSIFAD--GTTNWGRI
A0A3Q1GX28_MCL1-02      YNGMI-----NKL-SL--DDKVDDVSFITAVA--QSLFSD--GTTNWGRI
A0A3Q1GX28_MCL1-01      YNGMI-----NKL-SL--DDKVDDVSFITAVA--QSLFSD--GTTNWGRI
A0A3B4XKA5_MCL1-01      YNGMI-----NKL-SL--DNRGDDVRFVGAVA--KSLFAD--GTTNWGRI
A0A3Q3GP42_MCL1-01      YNGMI-----NKL-SL--EDRGDDASFVSAVA--KSLFAD--GTTNWGRI
A0A3Q3M6G2_MCL1-01      YNGMI-----NKL-SL--DDRGDDVRFVSTVA--KSLFAD--GTTNWGRI
A0A3Q3M6G2_MCL1-02      YNGMI-----NKL-SL--DDRGDDVRFVSTVA--KSLFAD--GTTNWGRI
A0A3B1IEV7_MCL1-01      YNGMV-----QKL-NL--EEQDDSMDIISSVA--KALFSD--GTTNWGRI
A0A3B4CGU9_MCL1-03      YNGMV-----QRL-CL--EQQDDSMEFISSVA--KTLFND--GTTNWGRI
A0A3B4CGU9_MCL1-02      YSGMV-----QRL-CL--EQQDDSMEFISSVA--KTLFDD--GITNWGRI
Q8UWD6_MCL1-01          YKGMI-----ARL-NL--EQKGEDVSFIKQVA--TELFSD--GTTNWGRI
A2BF68_MCL1-01          YKGMI-----ARL-NL--EQKGEDVSFIKQVA--TELFSD--GTTNWGRI
Q568W5_MCL1-01          YKGMI-----ARL-NL--EQKGEDVSFIKQVA--TELFSD--GTTNWGRI
A0A3B1K5R1_MCL1-01      YKGML-----NKL-GM--EDRGDDMYVIRAVA--KELFSD--GITNWGRV
A0A3B4C6H5_MCL1-03      YKGMF-----TRL-GM--EDRGDDMHIIRTVA--KELFSD--GITNWGRI
A0A3B4C6H5_MCL1-01      YKGMF-----TRL-GM--EDRGDDMHIIRTVA--KELFSD--GITNWGRI
Q9Z0F3_BCL2L10-01       FSSFCES-RGNRL-ELVKQMA-------------DKLLSKDQD-FSWSQL
E1B9B3_BCL2L10-01       LPLYRRC-RRHRV-ELVARMA-------------QRLLDEDPG-PSWGRV
A0A1U7QVA0_BCL2L10      FSSFVGY-QGNRV-ELMTQMV-------------DAVLPDGQD-LNWGRL
F1RZB9_BCL2L10-01       LSVYRGF-RWNRV-ELVAWMA-------------QKLLASPRG-PNWYRV
F1MV39_BCL2L10-01       LPLYRRC-RRHRV-ELVARMA-------------QRLLDEDPG-PSWGRV
W5QIG4_BCL2L10-01       LPLYRRY-RRHRV-ELVARMA-------------QRLLDEDPG-PSWGRV
Q99M66_BCL2L10-01       FNSFRDY-QGNRL-ELVTQMA-------------DELLSNDQE-FNWGRL
F6ZPD4_BCL2L10-01       LSRYRGF-RGDHV-GLAARMA-------------QAIFGDRHV-PSWGRV
A0A2K6F2Q2_BCL2L10      FSAYVGY-PGNRV-YLLERMA-------------EAVLCDS---LSWGRV
H0WZ06_BCL2L10-01       FSAYIGY-PGNRV-QVVERMV-------------KAMLSDNQR-LNWGRV
A0A1U7UZD8_BCL2L10      FSAFVDY-PGSRV-DLTARMA-------------DAVLSGSRD-LSWGRV
G1T264_BCL2L10-01       FSVYRGY-PGNRI-ELAARVA-------------EAVLSDGHD-LSWGRV
A0A0D9RG38_BCL2L10      FSAYLGY-PGNRV-ELVALMA-------------DAVLSDSPG-PTWGRV
A0A2K5RIU7_BCL2L10      FSAYLGY-PGNRV-ELVARMA-------------EALLSDSPG-PTWGNV
A0A2K5F974_BCL2L10      FSAYLGY-PGNRV-ELVARMA-------------EALLSDSPG-PTWGNV
A0A2K6TIT7_BCL2L10      FSAYRGY-PRNRV-ELVARMA-------------EALLSDSPG-PTWGNV
F7CT87_BCL2L10-01       FSAYLGY-PGNRV-ELVARMA-------------EALLSDSPG-PTWGNV
A0A096NM44_BCL2L10      FSAYRGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
A0A2K6R5T5_BCL2L10      FSAYLGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
Q9HD36_BCL2L10-02       FSAYLGY-PGNRF-ELVALMA-------------DSVLSDSPG-PTWGRV
G1R3W6_BCL2L10-01       FSAYLGY-PGNRV-ELVVLMA-------------DSVLSDSPG-PTWGRV
A0A2K5K3B0_BCL2L10      FSAYLGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
A0A2K6M5H5_BCL2L10      FSAYLGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
A0A2K5TKG9_BCL2L10      FSAYRGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
F7H6U5_BCL2L10-01       FSAYRGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
A0A2K6B2D9_BCL2L10      FSAYRGY-PGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
A0A2K5MMZ4_BCL2L10      FSAYRGY-RGNRV-ELVALMA-------------EAVLSDSPG-PTWGRV
H2NN92_BCL2L10-01       FSAYLGY-PGNRV-ELVALMA-------------DSVLSDSPS-PTWGRV
A0A2R9BCD9_BCL2L10      FSAYLGY-PGNRF-ELVALMA-------------DSVLSDSPG-PTWGRV
H2Q9G4_BCL2L10-01       FSAYLGY-PGNRF-ELVALMA-------------DSVLSDSPG-PTWGRV
G3QLU6_BCL2L10-01       FSAYLGY-PGNRF-ELVALMA-------------DSVLSDSPG-PTWGRV
A0A337RYG8_BCL2L10      LSAYRGY-RGNRV-ELVARLE-------------QDLLSNPQT-LSWGHV
G1LKR4_BCL2L10-01       LSDYRGYAGGNRV-ELVAQVE-------------REILAHPQP-LSWGRV
A0A452QJG0_BCL2L10      LSDYRGY-GGNRV-ELVAQVE-------------REILAHPQP-LSWGRV
A0A3Q4MN81_BCL2L10      FDNLA-----QTF-LVQ-CGP-DHCLSLRKVM--KELVGD--GHLNWGRV
A0A3B4ETX9_BCL2L10      FDNLA-----QTF-LVQ-CGP-DHCLSLRKVM--KELVGD--GHLNWGRV
A0A3Q2PJS5_BCL2L10      FHALA-----QSF-LRH-SQT-DLCTSLWKVM--DEMVGD--GHFNWGRV
A0A3Q2GL87_BCL2L10      FHTLA-----QSF-LRH-SGT-DLCSSLRKVM--DEMVGD--GLFNWGRV
A0A3B5MJ12_BCL2L10      FHSLA-----QGF-LKH-CGS-DLCSNLRKVM--DEMVGD--GHFNWGRV
M4AUW7_BCL2L10-01       FHSLA-----QGF-LKH-CGS-DLCSNLRKVM--DEMVGD--GHFNWGRV
A0A096ME02_BCL2L10      FHSLA-----QGF-LKH-CGT-DLCSNLRKVM--DEMVGD--GHFNWGRV
A0A3B3TYN4_BCL2L10      FHSLA-----QGF-LKH-CGT-DLCSNLRKVM--DEMVGD--GHFNWGRV
A0A3B3YT99_BCL2L10      FHSLA-----QGF-LKH-CGT-DLCSNLRKVM--DEMVGD--GHFNWGRV
A0A3P9NE65_BCL2L10      FHSLA-----QGF-LKH-CGT-DLCSNLRKVM--DEMVGD--GHFNWGRV
A0A3P9IIZ2_BCL2L10      FSTLA-----QNF-RKH-SGQ-DLCSSLRKVM--EELVGD--ERLNWGRV
A0A3P9LM07_BCL2L10      FSTLA-----QNF-RKH-SGP-DLCSSLRKVM--EELVGD--ERLNWGRV
H2MBQ3_BCL2L10-01       FSTLA-----QNF-RKH-SGP-DLCSSLRKVM--EELVGD--ERLNWGRV
A0A3B4AAV4_BCL2L10      FHSLS-----QTF-LKQ-CGP-DPCSSLRKVM--EELVGD--GHLNWGRV
A0A3Q3EZT5_BCL2L10      FQSLA-----QTF-LRQ-CGP-DPCSGLRKVM--EELVGD--GHLNWGRV
A0A3Q3EZT5_BCL2L10      FQSLA-----QTF-LRQ-CGP-DPCSGLRKVM--EELVGD--GHLNWGRV
A0A3Q3JQ78_BCL2L10      FHSLA-----QTF-LKQ-CGP-DPCSSLRKVM--EELVGD--GHLNWGRV
A0A3B4TIY6_BCL2L10      FHTLA-----QTF-VTQ-CGL-DPCSSLRKVM--EELVGD--GHLNWGRV
A0A3B4WGF4_BCL2L10      FHTLA-----QTF-VTQ-CGL-DPCSSLRKVM--EELVGD--GHLNWGRV
A0A3Q3KZW1_BCL2L10      FHSLT-----QTF-LKQ-CGP-DPCSSLRKVI--EELVAD--GHLNWGRV
A0A3B5KD08_BCL2L10      FNSLA-----QTF-LRQ-CGP-DLCSSLRKVM--EELVGD--GHLNWGRV
A0A3Q3VI28_BCL2L10      FHSLA-----QTF-LRQ-CGT-DPCSSLRNVM--EELVGD--GHLNWGRV
A0A3Q1GM98_BCL2L10      FHSLT-----QAF-LRQ-CGP-DFCSSLRMVM--EELVED--GHLNWGRV
A0A3Q1D2L0_BCL2L10      FHSLT-----QTF-LRQ-CGP-DLCSSLRKVM--EELVGD--GHLNWGRV
A0A3P8RL82_BCL2L10      FHSLT-----QTF-LRQ-CGP-DLCSSLRKVM--EELVGD--GHLNWGRV
A0A3B4ZFS0_BCL2L10      FHSLT-----QTF-LRQ-PGP-DLCSSLRRVM--EELVGD--GHLNWGRV
A0A3Q2UUN9_BCL2L10      FDNLA-----QTF-LVQ-CGP-DHCLSLRKVM--KELVGD--GHLNWGRV
A0A3P8PVZ8_BCL2L10      FDNLA-----QTF-LVQ-CGP-DHCLSLRKVM--KELVGD--GHLNWGRV
A0A3Q2UUN9_BCL2L10      FDNLA-----QTF-LVQ-CGP-DHCLSLRKVM--KELVGD--GHLNWGRV
A0A3P9BLI0_BCL2L10      FDNLA-----QTF-LVQ-CGP-DHCLSLRKVM--KELVGD--GHLNWGRV
A0A3Q0S9R1_BCL2L10      FDNLA-----QTF-LRH-CGP-DHCSSLRKVM--EELVGD--GHLNWGRV
D2IT42_BCL2L10-02       FQALA-----QSF-LAQ-CEA-DACAGLRKVM--EELVGD--GQLNWGRV
A0A3B3C5I4_BCL2L10      FSTLA-----QDF-RKH-CGP-DLCSSLRKVM--EELVGD--EHLNWGRV
A0A3Q1IAB0_BCL2L10      FHSLA-----QTF-LKQ-CGP-DPCSSLRKVM--EELVGD--GHMNWGRV
A0A3P8W7K5_BCL2L10      FQTLS-----QSF-LRQ-CGS-EPCVCLRKVM--EELVGD--GHLNWGRV
H3AAS7_BCL2L2-02        FNSLS-----SHL-HI--TPG-TAYRRFAETA--DSLFQD--G-VNWGRV
H3AAS7_BCL2L2-01        FNSLS-----SHL-HI--TPG-TAYRRFAETA--DSLFQD--G-VNWGRV
G1Q051_BCL2L2-01        FSDLV-----AQL-HV--TPG-SAQQCFTQVS--DELFQG--G-PNWGYL
G3WPT1_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-ANWGRL
A0A287D9B3_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A482LX62_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
W5QDH4_BCL2L2-02        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
Q7TS60_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
G1LMC3_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
M3Y5X5_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
G1P3J2_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
G3WPT1_BCL2L2-02        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-ANWGRL
G1TV33_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQSFTQVC--DELFQR--G-PNWGRV
P70345_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
O88996_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A3Q9B4M8_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
H0XR82_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A250YBR2_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A250YBR2_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
L8HP19_BCL2L2-02        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
L8HP19_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
Q1RMX3_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A452ECF0_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A286XQQ9_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5RUN8_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5MZX9_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A0D9RU30_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5HEJ9_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A1S3FYD8_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2I2UAE3_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2I2YPX6_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A287D9B3_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5V0Q3_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
F7G4L5_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6EA59_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6AI25_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A1U7RC37_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2I3GEA7_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2R9A2Q3_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
H2Q805_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A096NX09_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6GWM6_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6ME72_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6RW35_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6RW35_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K6TM77_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A287ATE4_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A1U7UJF2_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A452SHI1_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
Q05KI8_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
Q2TAP5_BCL2L1-01        FSDLT-----SQL-HI--TQD-TAQQSFQQVM--GELFRD--G-TNWGRI
Q91828_BCL2L1-01        FSDLT-----SQL-HI--TQD-TAQQSFQQVM--GELFRD--G-TNWGRI
I7GKS6_BCL2L1-01        RPPVP-----SMA-THPGTPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5EBP4_BCL2L1-      RPPVP-----SML-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5Q6R6_BCL2L1-      RPPVP-----SML-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6UWY8_BCL2L1-      RPPVP-----SML-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q5XGJ4_BCL2L2-01        FSEIS-----TQI-HV--TPG-TAYARFAEVA--GSLFQG--G-VNWGRI
F7G6M3_BCL2L2-01        FSDLA-----SQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5CWY6_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5CWY6_BCL2L2-      FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
G3TMU7_BCL2L2-01        FSDLA-----AQL-HV--TPG-SAQQRFTQVS--DELFQG--G-PNWGRL
A0A2K5M8B1_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5H963_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5VPG2_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5YR37_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2R8Z9D7_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A096NV05_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6QFA2_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A1U7T4L4_BCL2L1-      WRPPV-----PSM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6G3C5_BCL2L1-      WRPPV-----PLM-AT--HPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A3Q1LRT3_BCL2L1-      FSDLM-----SQL-RI--TPG-TACQSFEQVI--NELFRD--R-VKWGHV
H9GHK7_BCL2L1-01        FSDLT-----SQL-HI--TLG-TAYQSFEQVV--NELFHD--G-VNWGRI
Q07816_BCL2L1-04        VRGER-----GQG-DA--GTG-GTHCVLDDHV--LDRPSR--S-LDPGEW
A0A493TIA6_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q07816_BCL2L1-02        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFHD--G-VNWGRI
Q07816_BCL2L1-03        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFHD--G-VNWGRI
Q07816_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFHD--G-VNWGRI
G1N5N5_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFHD--G-VNWGRI
A0A452ILL8_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A452ILL8_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
K7F655_BCL2L1-01        FSDLT-----SQL-HI--TLG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A452E1B1_BCL2L1-      FSDLT-----SQL-HI--TPG-TTYQSFEQVI--NELFQD--G-VNWCRN
W5PSA5_BCL2L1-01        FSDLT-----SQL-HI--TPG-KAYQSFEQVI--NELFQD--G-VNWGRN
P53563_BCL2L1-03        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
P53563_BCL2L1-02        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A287CZ07_BCL2L1-      FSDLT-----SQL-HI--TLG-TAYQSFEQVV--NELFRD--G-VNWGHI
F6WA14_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
G3WKX6_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
M3XA94_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
M3XA94_BCL2L1-02        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A3Q2H0F6_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
H0X6V2_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
G3SPN0_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q2PFS6_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
O35843_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
M3XA94_BCL2L1-03        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
G1RER8_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A1S2ZQT6_BCL2L1-      FSDLT-----SQL-HI--TPA-TAYQSFEQVV--NELFRD--G-VNWGRI
Q64373_BCL2L1-09        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q64373_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
P53563_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
O77737_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVL--NELFRD--G-VNWGRI
Q9MYW4_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A3Q2H0F6_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
L8J061_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q05KJ0_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q05KJ0_BCL2L1-02        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
E2IV76_BCL2L1-01        FSDLT-----SQL-HI--TLG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6G3C5_BCL2L1-      FSDLT-----SQL-HI--TLG-TAYQSFEQVV--NELFRD--G-VNWGRI
B2Z3Z4_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
G3HEA7_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
G3HEA7_BCL2L1-02        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A1U7T4L4_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
M3Z2H9_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A1U7QU73_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A0D9RJZ8_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A286Y5D6_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A250YD48_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A1L5BWY3_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
I3MUP5_BCL2L1-02        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
I3MUP5_BCL2L1-03        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
I3MUP5_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
G1P9D2_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5EBP4_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
E2IV75_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
F7IT34_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q76LT7_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5Q6R6_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5Q6R6_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5M8B1_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5H963_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q8SQ42_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5VPG2_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K5YR37_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2R8Z9D7_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A096NV05_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2J8VIH3_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6QFA2_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6QFA2_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A2K6UWY8_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
E2IV77_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A452SDS4_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A384D3U1_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A452FWV3_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
Q9MZS7_BCL2L1-01        FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A3B3E2W4_BCL2L1-      FSDLS-----LQF-HI--TPD-TAYQNFKSVL--DELFKD--G-INWGRV
A0A3B3I2Q5_BCL2L1-      FSDLS-----VQL-HI--TPD-TAYQNFKRVL--DELFKD--G-INWGRV
A0A3P9I2N4_BCL2L1-      FSDLS-----VQL-HI--TPD-TAYQNFKRVL--DELFKD--G-INWGRV
A0A3P9MKK4_BCL2L1-      FSDLS-----VQL-HI--TPD-TAYQNFKRVL--DELFKD--G-INWGRV
A0A3B5B4X7_BCL2L1-      FSDLS-----SQL-DI--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A3B4BFZ8_BCL2L1-      FSNLS-----SQL-DI--TPD-TAYNSFKSVM--DEVFKD--G-VNWGRI
A0A3Q3FUB6_BCL2L1-      FSDLS-----SQL-DI--TPN-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A3B5MGS2_BCL2L1-      FKHLS-----LQL-DI--TPD-TAYHSFKTVL--DELFKG--G-VNWGRV
M4A558_BCL2L1-01        FKHLS-----LQL-DI--TPD-TAYHSFKTVL--DELFKG--G-VNWGRV
A0A3P9QFB3_BCL2L1-      FKHLS-----LQL-DI--TPD-TAYHSFKTVL--DELFKG--E-VNWGRV
A0A087YBW4_BCL2L1-      FKHLS-----LQL-DI--TPD-TAYQSFKTVL--DELFKG--E-VNWGRV
A0A3B3VWI7_BCL2L1-      FKHLS-----LQL-DI--TPD-TAYQSFKTVL--DELFKG--E-VNWGRV
A0A3B3XN57_BCL2L1-      FKHLS-----LQL-DI--TPD-TAYQSFKTVL--DELFKG--E-VNWGRV
A0A3Q2C6K4_BCL2L1-      FSDLS-----MQL-DI--TPD-TAYHSFKAVL--DELFKD--G-INWGRV
A0A3Q2NRP4_BCL2L1-      FSHLS-----LQL-DI--TPD-TAYHSFKAVL--DELFKD--G-VNWGRV
A0A0B4KJI5_BCL2L1-      FSDLS-----TQL-DI--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRV
A0A3Q1JZ46_BCL2L1-      FSDLS-----SQL-DV--TPD-TAYQSFKSVM--DELFKD--G-VNWGRI
A0A3Q1JZ46_BCL2L1-      FSDLS-----SQL-DV--TPD-TAYQSFKSVM--DELFKD--G-VNWGRI
A0A3Q3NFM4_BCL2L1-      FSDLS-----SQL-DI--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A3Q3NFM4_BCL2L1-      FSDLS-----SQL-DI--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A3B4V9K8_BCL2L1-      FSDLS-----TQL-DI--TPD-TAYHSFKSVM--DELFKD--G-VNWGRI
A0A3B4XS24_BCL2L1-      FSDLS-----TQL-DI--TPD-TAYHSFKSVM--DELFKD--G-VNWGRI
A0A2U9BY16_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFESVM--NEVFRD--G-VNWGRI
C1BLI0_BCL2L1-01        FNDPS-----SQL-HI--TPA-TAYHSFESVM--NEVFRD--G-VNWGRV
C0HAD8_BCL2L1-01        FSDLS-----SQL-HI--TPA-TAYHSFESVM--DEVFRD--G-VNWGRV
A0A3B3ZMX9_BCL2L1-      FSDLH-----RQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRV
A0A3B3TFR4_BCL2L1-      FSDLS-----SQL-HI--TPA-TAYQSFESVM--NEVFRD--G-VNWGRV
H3CH49_BCL2L1-01        FSDLH-----NQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q2FR43_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--NEVFRD--G-VNWGRI
A0A3P8XYL5_BCL2L1-      FSDLS-----SQL-HL--TPA-TAYQSFASVM--DEVFRD--G-VNWGRV
Q90Z98_BCL2L1-02        FNDLS-----SQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRI
Q90Z98_BCL2L1-01        FNDLS-----SQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRI
A0A059PJI5_BCL2L1-      FSDLS-----SQL-HI--TPV-TVYQSFESVM--DEVFRD--G-VNWGRI
A0A3B4DTL9_BCL2L1-      FSDLS-----SQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRV
B5XAY3_BCL2L1-01        FSDLS-----SQL-HI--TPS-TAYQSFENVM--DEVFRD--G-VNWGRV
W5MG74_BCL2L1-01        FSDLS-----SQL-HI--TPA-TAYQSFEHVM--DEVFRD--G-VNWGRI
A0A3Q3B3X5_BCL2L1-      FSDLH-----SQL-HI--TPG-TVYQSFENVM--DEVFRD--G-VNWGRI
A0A3B3IB64_BCL2L1-      FNNLH-----SQL-HI--TPA-TAYQSFENVM--NELFRD--N-INWGRI
A0A3P9JYH1_BCL2L1-      FNNLH-----SQL-HI--TPA-TAYQSFENVM--NELFRD--N-INWGRI
A0A3B3DHA1_BCL2L1-      FNNLH-----SQL-HI--TPA-TAYQSFENVM--NELFRD--N-INWGRI
A0A3Q0RTF8_BCL2L1-      FNDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
I3IZK7_BCL2L1-01        FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A2U9BY16_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFESVM--NEVFRD--G-VNWGRI
A0A2U9BY16_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFESVM--NEVFRD--G-VNWGRI
A0A2U9BY16_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFESVM--NEVFRD--G-VNWGRI
A0A0D6DR75_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFANVM--DEVFRD--G-VNWGRI
A0A3Q3WIW8_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A219P0Y3_BCL2L1-      FSDLH-----HQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q3MX20_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRI
A0A3Q3G2E1_BCL2L1-      FSDLH-----NQL-HI--TPA-TTHQSFENVM--DEVFRD--G-VNWGRI
A0A3Q3G2E1_BCL2L1-      FSDLH-----NQL-HI--TPA-TTHQSFENVM--DEVFRD--G-VNWGRI
A0A3Q3G2E1_BCL2L1-      FSDLH-----NQL-HI--TPA-TTHQSFENVM--DEVFRD--G-VNWGRI
A0A3Q1GZ93_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q1GZ93_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q1GZ93_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B4V3T1_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFANVM--DEVFRD--G-FNWGRI
A0A3B4XU17_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFANVM--DEVFRD--G-FNWGRI
H3ANS8_BCL2L1-01        FSDLS-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRV
A0A452FHY1_BCL2L1-      VSDLT-----SQL-HT--TPG-TAYQSFEQVM--YELFWD--G-VNWDHT
A0A452FHY1_BCL2L1-      VSDLT-----SQL-HT--TPG-TAYQSFEQVM--YELFWD--G-VNWDHT
A0A1S3EPX7_BCL2L1-      FSDLT-----SQL-HI--TPG-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A218USB3_BCL2L1-      FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A218USB3_BCL2L1-      FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
U3JSL7_BCL2L1-01        FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A218USB3_BCL2L1-      FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
A0A218USB3_BCL2L1-      FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
H0Z8G3_BCL2L1-01        FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
Q4U2V6_BCL2L1-01        FSDLT-----SQL-HI--TPS-TAYQSFEQVV--NELFRD--G-VNWGRI
R4JQR8_BCL2L1-01        FDDMV-----NQL-HI--TEA-TAYPTFQRVV--QELFID--GNINWGRI
A0A346RRN1_BCL2L1-      FDDMV-----DQL-HI--TEA-TAYPTFQRVV--QELFID--GNINWGRV
Q568V1_MCL1-01          YKGMI-----QRL-QL--DSQPASLDFIRCIA--STMFKD--GVTNWGRI
Q1L8X3_MCL1-01          YKGMI-----QRL-QL--DSQPASLDFIRCIA--STMFKD--GVTNWGRI
Q9I9N3_MCL1-01          YKGMI-----QRL-QL--DSQPASLDFIRCIA--STMFKD--GVTNWGRI
A0A286XUI2_BCL2A1-      LKPWL-----DRI-DV--ESIDTAKSIFNQVM--EKEFED--GIINWGRI
A0A452U285_BCL2A1-      LKPCL-----DSF-DV--VSVDSARTIFNQVM--EKEFED--GIINWGRI
A0A452U285_BCL2A1-      LKPCL-----DSF-DV--VSVDSARTIFNQVM--EKEFED--GIINWGRI
A0A3B3R4U0_MCL1-01      YNGMI-----KKL-EL--DKRGDDTSFVTKVA--EEIFSD--KVTNWGRI
F7CP56_BCL2A1-03        SNHMDMV-KLASP-EE--ILS-LPKTSWNIHQPGEEEVRE--EALSTGGL
A0A3P8V8T6_MCL1-01      FSGMI-----NNL-SF--ENGVYNIGVVGAVA--RSLFRD--GTSNWGRI
A0A3P8YNB4_BCL2-01      FLEMS-----HQL-YL--TSS-VAERRFREVI--DELFRD--G-VNWGRI
A0A3P8WUE9_BCL2-01      FSEMS-----RQL-YL--TSS-TAQRRFTEVI--DELFRD--G-VNWGRI
A0A3B4A3G8_BCL2-01      FTEMS-----RQL-YL--TSS-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q3G1D7_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q2XQX2_BCL2-02      FTEMS-----RQL-YL--SST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q2XQX2_BCL2-01      FTEMS-----RQL-YL--SST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q3B0R2_BCL2-01      FVEMS-----RQL-GL--ASA-AAKARFAEVM--DELFRD--G-VNWGRI
A0A3Q2PN77_BCL2-01      FAEMS-----QQL-YI--TRD-TARTRFAEVV--DELFRD--G-VNWGRI
A0A3P9J8Y9_BCL2-01      FTEMS-----RQL-YL--TST-TAKTRFAEVI--DELFRD--G-VNWGRI
A0A3Q0S5Z7_BCL2-01      FTEMS-----RQL-HL--TSA-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3P8QVM8_BCL2-01      FTEMS-----RQL-HL--TSS-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3P9DIG5_BCL2-01      FTEMS-----RQL-HL--TSS-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q2UYW8_BCL2-01      FTEMS-----RQL-HL--TSA-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3B4G3K4_BCL2-01      FTEMS-----RQL-HL--TSA-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A2U9BJ09_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q1I5N1_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q3K1K1_BCL2-01      FTEMS-----RQL-HL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q3MEY1_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A1X9JZA1_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFADVI--DELFRD--G-VNWGRI
A0A4D6FTA2_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q1FLK7_BCL2-01      FTEMS-----RQL-YL--TTT-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3Q1B8C3_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3P8S9L3_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3B5BBQ0_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3B4TX71_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
A0A3B4YAG2_BCL2-01      FTEMS-----RQL-YL--TST-TAQRRFAEVI--DELFRD--G-VNWGRI
G1TW27_BCL2-02          FAEMS-----SQL-HL--TPF-HARGRFATVV--EELFRD--G-VNWGRI
E2RS00_BCL2A1-02        LKPCL-----DSF-DV--VSVDTARTIFNQVM--EKEFED--GVINWGRI
A0A3B3TCS4_BCL2-01      FSEMH-----EEL-HI--TPS-TAQRRFTAVI--EELFSD--G-VNWGRI
A0A0U3DHY6_BCL2-01      FAEMS-----GQL-HF--TPS-TAQXRFTAVI--DELFSD--G-VNWGRI
A0A3P9AAB2_BCL2-01      FAEMS-----GQL-HI--TPS-TAHGRFTAVI--DELFSD--G-VNWGRI
X4ZGI8_BCL2-01          FEEMS-----HQM-TF--SPS-AAQRSFLAVA--EELFRD--G-VNWGRI
A0A3P9MKK4_BCL2L1-      FSDLS-----VQL-HI--TPD-TAYQNFKRVL--DELFKD--G-INWGRV
A0A3B3I2Q5_BCL2L1-      FSDLS-----VQL-HI--TPD-TAYQNFKRVL--DELFKD--G-INWGRV
A0A3P9I2N4_BCL2L1-      FSDLS-----VQL-HI--TPD-TAYQNFKRVL--DELFKD--G-INWGRV
A0A3B4AFB7_MCL1-01      YNGMI-----NKL-AL--DDR-GDDVSFIGTV-AKSIFED--GTTNWGRI
G3TVG9_MCL1-01          SQGML-----RKP-DF--KNE-NDVKSLSGAM--VHVFSG--GITKWGRI
B9ZYL7_BCL2-01          FRQIS-----GLL-HL--TPS-TVRVRFATVV--EELFHD--G-VNWGRI
A0A3L7HT14_BCL2A1-      FDVRS--------------ID-TARTIFNQVM--EKEFED--GIINWGRI
F6YNL8_BCL2-01          FDEMS-----GQL-HL--TPV-TARGRFATVV--EELFRD--G-VNWGRI
A0A218UQA0_BCL2-01      FSQMS-----GQL-HL--TPF-TARSRFVAVV--EELFRD--G-VNWGRI
Q00709_BCL2-01          FAQMS-----GQL-HL--TPF-TAHGRFVAVV--EELFRD--G-VNWGRI
A0A493T1X3_BCL2-01      FAQMS-----GQL-HL--TPF-TARGRFVAVV--EELFRD--G-VNWGRI
U3KEW4_BCL2-01          FAQMS-----GQL-HL--TPF-TARSRFVAVV--EELFRD--G-VNWGRI
G3WZW9_BCL2-01          FDEMS-----GQL-HL--TPV-TARGRFATVV--EELFRD--G-VNWGRI
M3YYK3_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
M3X1R9_BCL2-02          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K6R2I5_BCL2-02      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2R9APW6_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
G3SLZ1_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
Q75SV7_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
M3X1R9_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
Q8I008_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A076FU27_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A4P8GLJ2_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
F6R2C4_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
O02718_BCL2-01          FAEMS-----SQL-HL--TPF-TARERFATVV--EELFRD--G-VNWGRI
A0A076FZV9_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A452EV13_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A250YD83_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A9QXG9_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K5NZS5_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A0D9S017_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K6CIX3_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K5XRD4_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K6KHG1_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K6R2I5_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K5HK49_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
G3QES9_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
H2QEM8_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2I3GZF9_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K6UEL3_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
E2QWA1_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
G1LIC9_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A452R110_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A452R110_BCL2-02      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
G3WZW9_BCL2-02          FDEMS-----GQL-HL--TPV-TARGRFATVV--EELFRD--G-VNWGRI
G3SLZ1_BCL2-02          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A452T603_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
M3Y8D1_BCL2L10-01       LSDYRGY-GGNRV-EL--VAQ-LEREILAHPQ----------A-LSWGRV
A0A3Q2Y539_MCL1-01      FNNMV-----NEL-SL--DQR-GLDRSFVSQVAQTEFANG--N-INWGRI
A0A3Q3BEB7_BCL2L1-      FSHLS-----LQL-DI--SPD-TVYHSFKSVL--DELFKD--G-VNWGRV
A0A3P8VMA1_BCL2L1-      FRNLF-----LKL-DL--TPD-TVYHSFKSVM--DEVFRD--G-VNWGRI
A0A345BSW9_BCL2L1-      FNDLS-----SQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRI
A0A286MU87_BCL2L1-      FSDLS-----SQL-HI--TPA-TAYHSFESVM--DEVFRD--G-VNWGRV
A0A3P8XFS0_BCL2L1-      FSDLS-----SQL-HI--TPA-TAYHSFESVM--DEVFRD--G-VNWGRV
A0A3P8XFS0_BCL2L1-      FSDLS-----SQL-HI--TPA-TAYHSFESVM--DEVFRD--G-VNWGRV
A0A0F7L1T6_BCL2L1-      FSDLS-----SQL-DI--TPD-TAYQSFKNVM--DEVFKD--G-DNWGRV
H2U5I3_BCL2L1-01        FSDLS-----SQL-DI--TPD-TAYQSFKNVM--DEVFKD--G-VNWGRV
A0A3Q3J5K3_BCL2L1-      FSDLS-----SQL-VI--TPD-TAYNSFKSVM--DEVFKD--G-VNWGRI
A0A3Q1EVP6_BCL2L1-      FSDLS-----SQI-DI--TPE-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A3Q1BQA0_BCL2L1-      FSDLS-----SQL-DI--TPE-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A3P8U812_BCL2L1-      FSDLS-----SQL-DI--TPE-TAYHSFKSVM--DEVFKD--G-VNWGRI
E6ZFR0_BCL2L1-01        FSDLS-----SQI-DI--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRI
G3P7B4_BCL2L1-01        FSDLS-----LQL-DV--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRV
A0A3Q3X5M5_BCL2L1-      FSDLS-----SQL-DI--TPD-TAYHSFKSVM--DEVFKD--G-VNWGRI
A0A2U9BIG9_BCL2L1-      FSDLS-----LQL-DI--TPD-TAYQSFKSVM--DEVFKD--G-VNWGRI
D2ITA2_BCL2L1-02        FSDLS-----SQL-PI--TPA-TAYGSFESVM--DEVFRD--S-INWGRI
A0A3B3ZMX9_BCL2L1-      FSDLH-----RQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRV
G3NJY1_BCL2L1-01        FSDLH-----NQL-HI--TPA-TAYQSFEDVM--DEVFRD--G-VNWGRI
A0A2U9BY16_BCL2L1-      FSDLH-----NQL-HI--TPA-TAYQSFESVM--NEVFRD--G-VNWGRI
A0A3Q3DUT7_BCL2L1-      FSDLD-----KQL-HI--TPA-TAYQSFENVV--DEVFQD--D-VNWGRI
A0A3Q3DUT7_BCL2L1-      FSDLD-----KQL-HI--TPA-TAYQSFENVV--DEVFQD--D-VNWGRI
A0A3Q3DUT7_BCL2L1-      FSDLD-----KQL-HI--TPA-TAYQSFENVV--DEVFQD--D-VNWGRI
A0A3B1JJ42_BCL2L1-      FSDLS-----SQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRV
A0A3P8UWG7_BCL2L1-      FSDLH-----QQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q3IVF5_BCL2L1-      FSDLH-----HQL-HI--TPA-TAYQSFESVM--DEVFRD--G-VNWGRI
A0A3Q1DHJ3_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q1DHJ3_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q1DHJ3_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3P8TL99_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3P8TL99_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q1FR00_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B4Z3X2_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B4Z3X2_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
C3VIT1_BCL2L1-01        FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3P8P0F1_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q2X557_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3P9D632_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3P9D632_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q4N4B5_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B4FNX1_BCL2L1-      FSDLH-----SQL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3Q2QPL9_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--NEVFRD--G-VNWGRI
A0A3B5PQJ0_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A087X9B7_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B3TUS7_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B3WI27_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3P9N9Y4_BCL2L1-      FNDLH-----STL-HI--TPA-TAYQSFENVM--DEVFRD--G-VNWGRI
A0A3B3QRZ2_BCL2L1-      FSDLS-----SQL-HI--TPV-TAYQSFESVM--NEVFRD--G-INWGRI
Q564A4_BCL2-01          FEEMS-----QQM-VF--NPN-SAQRSFLTVA--EELFRD--G-VNWGRI
H9GPE7_BCL2-01          FAQMS-----GQL-HL--TPS-TARSRFVAVV--EELFQD--G-VNWGRI
A0A452I9V7_BCL2-01      FAQMS-----GQL-HL--TPF-TARGRFVAVV--EELFRD--G-VNWGRI
W5N4F7_BCL2-01          FAEMS-----DQL-HF--TPN-TARRKFTAVV--EELFRD--G-VNWGRI
K7F5Y3_BCL2-02          FAQMS-----GQL-HL--TPF-TARGRFVAVV--EELFRD--G-INWGRI
A0A3Q2HRY3_BCL2-02      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
K7F5Y3_BCL2-01          FAQMS-----GQL-HL--TPF-TARGRFVAVV--EELFRD--G-INWGRI
F1LNV0_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
P49950_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
G1TW27_BCL2-01          FAEMS-----SQL-HL--TPF-HARGRFATVV--EELFRD--G-VNWGRI
A0A2K5EB04_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2R8MY14_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
H2NWH5_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A096MPU7_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K5PP81_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
H0WKI0_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K5UDI5_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
P10417_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
Q7TSN8_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A3Q2HRY3_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
E2QWA1_BCL2-02          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
A0A2K6G3I7_BCL2-01      FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
Q6R755_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
Q9JJV8_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
Q923R6_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
H0W1T3_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFAT------LFRD--G-VNWGRI
G1LIC9_BCL2-02          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
I3MVK9_BCL2-01          FAEMS-----SQL-HL--TPF-TARGRFATVV--EELFRD--G-VNWGRI
                                                                          

P70345_BCL2L2-02        -----------------------------------------------Q--
G1MZW1_BCL2-01          VAFFEFGGVMC-------------------VE---SVNREMSP-------
A2BF68_MCL1-02          ASLLTFGAMLC------------------------KYQNDRGHSKYVR--
A0A3L7HT14_BCL2A1-      HVMAAVAASSA----------------KRSLRAELKQRLRALS----A--
F7CP56_BCL2A1-02        MTIFAFEGILI----------------KKLLPERIAPDVDTYK----E--
F7CP56_BCL2A1-01        MTIFAFEGILI----------------KKLLPERIAPDVDTYK----E--
H0ZCL9_BCL2A1-01        MTIFTFGGLLT----------------KKLQEHGVQLTAEEKE----Q--
U3JTB2_BCL2A1-01        MTIFTFGGLLT----------------KKLQEHGVQLTAEEKE----E--
A0A218V8Z6_BCL2A1-      MTIFTFGGLLT----------------KKLQEHGVQLTAEEKE----E--
Q9W6F2_BCL2A1-01        MTIFTFGGLLT----------------KKLQEHGVQLTGEEKE----K--
A0A493SSZ7_BCL2A1-      TTIFTFGGLLT----------------KKLQEHGVQLTGEKKE----Q--
G1N8C5_BCL2A1-01        MTIFTFGGLLT----------------KKLQEQGVQLTGEEKE----Q--
A0A452J3N6_BCL2A1-      LTIFMFGGILS----------------KKLQEHRVQLTGENKK----Q--
K7G130_BCL2A1-01        LTIFMFGGILS----------------KRLQEHKVQLTGDNKE----Q--
A0A2K5PYQ3_BCL2A1-      VTIFAFEGILI----------------KKLLQERIAPDVDTYK----E--
A0A2K5PYQ3_BCL2A1-      VTIFAFEGILI----------------KKLLQERIAPDVDTYK----E--
F6SFL4_BCL2A1-01        VTIFAFGGILI----------------KKLLRHRAPLTMGTQE----E--
G3WSP8_BCL2A1-01        VTIFAFGGILI----------------KKLLRHRAPLTMDTHE----E--
F6S8G3_BCL2A1-01        VTIFVLGGILT----------------KKLQRSGVPLTRETRE----E--
O55178_BCL2A1-01        VTIFAFGGVLL----------------KKTSTRADCPGCTCLQ----T--
Q0P538_BCL2A1-01        VTIFAFGGVLL----------------KKTSTRADCPGCTCLQ----T--
G3V977_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIALDVDTYK----Q--
Q925A9_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIGLDVDTYK----Q--
Q07440_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIALDVCAYK----Q--
O55179_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIALDVGAYK----Q--
O55177_BCL2A1-02        VTIFAFGGVLL----------------KKLPQEQIALDVGAYK----Q--
Q497M6_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIALDVGAYK----Q--
Q8K164_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIALDVGAYK----Q--
Q4FK02_BCL2A1-01        VTIFAFGGVLL----------------KKLPQEQIALDVGAYK----Q--
A0A452SIR9_BCL2A1-      VTIFAFEGILT----------------KKLLQERISPDVDASR-------
M3YVH4_BCL2A1-01        VTVFAFEGILS----------------KKLLRERISPDVDASR-------
U6CQS8_BCL2A1-01        VTVFAFEGILS----------------KKLLRERISPDVDASR-------
I3MCZ7_BCL2A1-01        VTIFAFGGVLV----------------KKLLRERIAPAVDSDE----E--
G3T8E6_BCL2A1-01        VTIFAFGGILI----------------KKLLRERIAPDVDTYK----K--
H0WZ23_BCL2A1-01        VTIFAFGGILL----------------KKLLQQRIALDVDTYK----E--
A0A2K6TLJ5_BCL2A1-      VTIFAFEGILI----------------KKLLRERIAPDVDTYK----E--
A0A2K5D2I1_BCL2A1-      VTIFAFEGILI----------------KKLLRERIAPDVDTYK----E--
B4E1X9_BCL2A1-01        VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2I2YML2_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2R8ZJX9_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2I3HBP6_BCL2A1-      VTIFAFEGILV----------------KKLLRQRTAPDVDTYK----E--
A0A2K6PHF2_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2K6LV19_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2K5TMD1_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K5KAA3_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K6DS18_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A096NMX5_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K6AD27_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
F7HXW0_BCL2A1-01        VTIFAFEGILI----------------KKLLRERIAPDVDTYK----E--
A0A2K6TLJ5_BCL2A1-      VTIFAFEGILI----------------KKLLRERIAPDVDTYK----E--
A0A2I3HBP6_BCL2A1-      VTIFAFEGILV----------------KKLLRQRTAPDVDTYK----E--
A0A2K6EKG1_BCL2A1-      VTVFAFGGILI----------------KKLLREQIALDVDTYK----E--
A0A452EK63_BCL2A1-      VTIFAFEGILT----------------KKLLSKRIASDMDMCK----D--
W5Q0N6_BCL2A1-01        VTIFAFEGILT----------------KKLLSKRIASDMDMCK----D--
L8IZT5_BCL2A1-01        VTIFAFEGILT----------------KKLLGKCIASDMDMCK----D--
Q3C2I0_BCL2A1-01        VTIFAFEGILT----------------KKLLGKCIASDMDMCK----D--
F7CP56_BCL2A1-04        MTIFAFEGILI----------------KKLLPERIAPDVDTYK----E--
C7F841_BCL2A1-01        VTIFAFEGILM----------------KKLLRKRIAPDVDTYK----E--
A0A2K5D2I1_BCL2A1-      VTIFAFEGILI----------------KKLLRERIAPDVDTYK----E--
H2NNZ9_BCL2A1-01        VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2I2YML2_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2K6LV19_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2K6PHF2_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2K5KHH8_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K5KHH8_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K5KAA3_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K5TMD1_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
F7E8V5_BCL2A1-01        VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K6DS18_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A2K6AD27_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A096NMX5_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
A0A0D9RRC3_BCL2A1-      VTIFAFEGILI----------------KKLLRQRIAPDVDTYK----E--
Q16548_BCL2A1-01        VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
A0A2R8ZJX9_BCL2A1-      VTIFAFEGILI----------------KKLLRQQIAPDVDTYK----E--
G1QEX2_BCL2L10-01       VALVSFAGALL--------ERPPPGHSQARREWDATVDQDCQR-------
A0A3Q1FR00_BCL2L1-      VGLFAFGGALC-----------------VECV---EKEMSPLV----G--
F6VJQ0_BCL2L10-01       AVLVVFAGALL-----------------EMEE---LLKEEQVLQLRRETS
H3AR18_MCL1-01          VSLIAFGAVVA-----------------KKLK---KMNLEDSI----E--
J7H260_MCL1-01          VTVISFGAFVA-----------------KHLK---SIHMENCV----G--
G1PZ39_MCL1-01          LEGLS-ARFRN-----------------QHIL---AMSH--CF----R--
Q95KR3_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A2K5EPX0_MCL1-02      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5EPX0_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
Q9Z1P3_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A5PJR2_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A452GA25_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
G1L3L7_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQEGCI----E--
G1T2Q0_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
F7AVA6_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A337S3J9_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A337S3J9_MCL1-03      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
Q7YRZ9_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
F1PAP1_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
Q8HYS5_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
M3XZZ5_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A452RHX5_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
H0XFB7_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
F7GTF7_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5CFH3_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K6V5Y3_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K6KRW9_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5XSB2_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A0D9RZP5_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
I7G687_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5LXU8_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2I3GJZ3_MCL1-02      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
H2N5Y9_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2R9BPJ5_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2I3RTV4_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2I2YQH7_MCL1-01      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5C7L5_MCL1-01      --------------------------------------HQKCA----A--
A0A2K5I9I0_MCL1-02      --------------------------------------HQKCA----A--
A0A2K6GI15_MCL1-01      --------------------------------------HQKCA----A--
A0A2I3GJZ3_MCL1-01      --------------------------------------HQKCA----A--
A0A2K5CFH3_MCL1-03      --------------------------------------HQKCA----A--
A0A2K5R5E2_MCL1-03      --------------------------------------HQKCA----A--
A0A2K5W0W9_MCL1-01      --------------------------------------HQKCA----A--
A0A2K6ECR0_MCL1-02      --------------------------------------HQKCA----A--
A0A2I3LFM0_MCL1-01      --------------------------------------HQKCA----A--
A0A2K6KRW9_MCL1-02      --------------------------------------HQKCA----A--
A0A2K6PPI3_MCL1-02      --------------------------------------HQKCA----A--
G3WBC5_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----D--
W5QI41_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
F1MQX4_MCL1-01          VTLISFGAFVA-----------------KHFK---SINQESCI----E--
B4DLY8_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
B4DG83_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
B4E3L8_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5DMS4_MCL1-01      VTLSSFGAFVA-----------------KHLK---TINQESCI----E--
U3KKY6_MCL1-01          VTLIAFGAFVA-----------------KHLK---SIKQEQSI----T--
G1MPY7_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQEKCI----S--
K7FPN7_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQENCI----N--
H3AR18_MCL1-02          VSLIAFGAVVA-----------------KKLK---KMNLEDSI----E--
E2RS00_BCL2A1-01        VTVFAFEGILT-----------------KKLL---EQRISSDV----DAE
B6V6J0_MCL1-01          VTVISFGAFVA-----------------KHLK---SLNLEDCI----G--
A0A3L7HT14_BCL2A1-      VTVFAFGGVLL-----------------KKLA---QEQIGLDV----GAY
H0XHA5_MCL1-01          MTLI-FGGFVA-----------------KHLK---TINQEGYI----K--
A0A2I2YPX6_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6TM77_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K5RUN8_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6GWM6_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
W5QDH4_BCL2L2-01        VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6ME72_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6RW35_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A287ATE4_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2R8M4C0_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K5MZX9_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K5HEJ9_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K5V0Q3_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
F7G4L5_BCL2L2-02        VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6EA59_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6AI25_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A1U7RC37_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2I3GEA7_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2R9A2Q3_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
H2Q805_BCL2L2-02        VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A096NX09_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A287ATE4_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A4D6NWN1_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A1U7UJF2_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A452UF16_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A452UF16_BCL2L2-      VAFFVFGAALC-----------------AESV---NKEMEPLV----G--
A0A2K6F6N9_MCL1-01      VTLISFCAFVS-----------------KHLK---TINQESCI----E--
G1QAV8_MCL1-01          VTHFFWC--LC-----------------SHLK---SINQESCI----E--
H9GEA6_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQENAI----N--
H9GEA6_MCL1-02          VTLISFGAFVA-----------------KHLK---SINQENAI----N--
A0A493U0E8_MCL1-01      VTLISFGAFVA-----------------RHLK---SVKQEKSI----G--
A0A1L1RNM6_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQEKCI----T--
A0A1L1RNM6_MCL1-02      VTLISFGAFVA-----------------KHLK---SINQEKCI----T--
G2HFR3_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
F6ZMX1_MCL1-01          VTLISFGAFVA-----------------KHLK---SINQESCI----D--
F6ZMX1_MCL1-02          VTLISFGAFVA-----------------KHLK---SINQESCI----D--
F6ZMX1_MCL1-03          VTLISFGAFVA-----------------KHLK---SINQESCI----D--
G1T2Q0_MCL1-02          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
F1PAP1_MCL1-02          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A337S3J9_MCL1-04      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
F7AVA6_MCL1-02          VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A2K6GI15_MCL1-03      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
C8YZ26_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
F7GTF7_MCL1-02          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5R5E2_MCL1-04      VTLIYFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K6V5Y3_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5LXU8_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5I9I0_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2I2YQH7_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
Q07820_MCL1-04          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5W0W9_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K6ECR0_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K5XSB2_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2R9BPJ5_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2I3RTV4_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2I3LFM0_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A2K6PPI3_MCL1-03      VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A286Y1M5_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
P97287_MCL1-01          VTLISFGAFVA-----------------KHLK---SVNQESFI----E--
A0A452GA25_MCL1-02      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
G3T756_MCL1-01          VTLISFGAFVA-----------------KHLK---SVNQESRI----E--
A0A1S3F3I1_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
G1L3L7_MCL1-02          VTLISFGAFVA-----------------KHLK---SINQEGCI----E--
A0A287BK44_MCL1-02      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A287BK44_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
B4DU51_MCL1-01          VTLISFGAFVA-----------------KHLK---TINQESCI----E--
A0A287DCH9_MCL1-02      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
A0A287DCH9_MCL1-01      VTLISFGAFVA-----------------KHLK---SINQESCI----E--
W5MMB7_MCL1-01          ASLVSFGAVVA-----------------KQMK---DSGRESCV----E--
A0A3B3SG34_MCL1-01      ASLVAFGAEVC-----------------KYLK---ETGREHCV----E--
Q4SW32_MCL1-01          ASLLAFAAVVA-----------------QYLN---DHGQRDCV----E--
Q0KFR9_MCL1-01          ASLVAFGAVVS-----------------QHLK---ERGRGHCV----E--
A0A3P8Y1W8_MCL1-02      ASLVGFGAVVS-----------------QHLK---EMGKGNCV----E--
A0A3P8Y1W8_MCL1-01      ASLVGFGAVVS-----------------QHLK---EMGKGNCV----E--
D2ITA0_MCL1-03          ASLVAFGAALC-----------------QYLE---ARGKEGCV----S--
D2ITA0_MCL1-04          ASLVAFGAALC-----------------QYLE---ARGKEGCV----S--
A0A3P9ILF6_MCL1-02      VSLLAFGAAVC-----------------QSLK---EKGRGHCV----D--
A0A3P9ILF6_MCL1-01      VSLLAFGAAVC-----------------QSLK---EKGRGHCV----D--
A0A3Q2XZL8_MCL1-01      ASLVAFGAIVS-----------------QHLK---EKGRAHCV----E--
A0A3B4AFB7_MCL1-02      ASLIAFGAVVC-----------------QYLK---TKGRESCV----E--
A0A3B3VM25_MCL1-01      VSLVAFGAAVC-----------------QHLK---ERGREHCV----E--
I3KXG5_MCL1-01          VSFVAFGAVVS-----------------QHLK---EKGRDNCV----V--
A0A3Q0R633_MCL1-01      ASLMAFGAVVC-----------------QRLK---EKGRDNCV----E--
A0A3Q0R633_MCL1-03      ASLMAFGAVVC-----------------QRLK---EKGRDNCV----E--
A0A3B4T8L9_MCL1-02      ASLVAFGAVVC-----------------QRMK---ETGRENCV----E--
A0A3B4T8L9_MCL1-01      ASLVAFGAVVC-----------------QRMK---ETGRENCV----E--
A0A3Q1EQB9_MCL1-02      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
A0A3B4ZKP6_MCL1-01      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
A0A3Q1BKL8_MCL1-02      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
A0A3Q1EQB9_MCL1-01      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
A0A3Q1BKL8_MCL1-01      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
A0A3P8RQX7_MCL1-02      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
A0A3P8RQX7_MCL1-01      TSLVAFGAVVC-----------------QYLK---ERGRENCV----D--
G3PJT0_MCL1-01          ASLVAFGAVVC-----------------QHLA---ERGRGNCV----E--
A0A3B3IJ04_MCL1-01      VSLLAFGAAVC-----------------QSLK---EKGRGHCV----D--
A0A3P9L1F3_MCL1-01      VSLLAFGAAVC-----------------QSLK---EKGRGHCV----D--
A0A3B3IJ04_MCL1-02      VSLLAFGAAVC-----------------QSLK---EKGRGHCV----D--
A0A3P9L1F3_MCL1-02      VSLLAFGAAVC-----------------QSLK---EKGRGHCV----D--
A0A3B3CEX1_MCL1-01      ASLLAFGAAVC-----------------LQLK---EKGRGHSV----D--
A0A3B3CEX1_MCL1-02      ASLLAFGAAVC-----------------LQLK---EKGRGHSV----D--
A0A3Q3VP02_MCL1-01      ASLVAFGVVVS-----------------QCLK---ENGKSDRV----E--
A0A3Q3B4P5_MCL1-01      SSLVAFGAVVA-----------------VHLK---EKGREECV----E--
A0A3Q3B4P5_MCL1-02      SSLVAFGAVVA-----------------VHLK---EKGREECV----E--
A0A3Q2EDX8_MCL1-01      VSLVAFGAVVC-----------------QHLK---EKGRENCV----E--
A0A3Q2P7X9_MCL1-01      ASLVAFGAVLC-----------------QHLK---ESGRSHCV----D--
A0A3Q2P7X9_MCL1-02      ASLVAFGAVLC-----------------QHLK---ESGRSHCV----D--
A0A3B5PQ55_MCL1-01      ASLVTFGAAVC-----------------QRLK---ERGREHCV----E--
A0A3B5PQ55_MCL1-02      ASLVTFGAAVC-----------------QRLK---ERGREHCV----E--
A0A3P9Q4I8_MCL1-01      VSLVAFGAVVC-----------------QHLK---ERGREHCV----D--
A0A3P9Q4I8_MCL1-02      VSLVAFGAVVC-----------------QHLK---ERGREHCV----D--
A0A087X830_MCL1-01      VSLVAFGAAVC-----------------QHLK---ERGREHCV----E--
A0A3B3YCD0_MCL1-01      VSLVAFGAAVC-----------------QHLK---ERGREHCV----E--
I3JHR5_MCL1-02          VSFVAFGAVVS-----------------QHLK---EKGRDNCV----A--
I3JHR5_MCL1-03          VSFVAFGAVVS-----------------QHLK---EKGRDNCV----A--
I3JHR5_MCL1-01          VSFVAFGAVVS-----------------QHLK---EKGRDNCV----A--
A0A3Q4HLQ8_MCL1-01      VSFVAFGAVVS-----------------QHLK---EKGRDNCV----A--
A0A3P8NP63_MCL1-02      VSFMAFGAVVS-----------------QHLK---EKGRDNYV----A--
A0A3Q2VNL8_MCL1-01      VSFMAFGAVVS-----------------QHLK---EKGRDNYV----A--
A0A3P8NP63_MCL1-01      VSFMAFGAVVS-----------------QHLK---EKGRDNYV----A--
A0A3P9BVM3_MCL1-01      VSFMAFGAVVS-----------------QHLK---EKGRDNYV----A--
A0A3B4G4Z6_MCL1-01      VSFMAFGAVVS-----------------QHLK---EKGRDNYV----A--
A0A2U9CJ81_MCL1-01      SSLVAFGAVVS-----------------QHLK---ETGRGNCV----E--
A0A3P8VKM5_MCL1-03      TSLVAFGAVVC-----------------QHLK---ECGQENST----E--
A0A3P8VKM5_MCL1-04      TSLVAFGAVVC-----------------QHLK---ECGQENST----E--
A0A3P8VKM5_MCL1-05      TSLVAFGAVVC-----------------QHLK---ECGQENST----E--
A0A3Q3IZW0_MCL1-01      TSLLAFGAVVC-----------------QYLK---EKGRENCV----E--
A0A3Q1GX28_MCL1-02      ASLVAFGAAVC-----------------QHLK---EKHRENCV----D--
A0A3Q1GX28_MCL1-01      ASLVAFGAAVC-----------------QHLK---EKHRENCV----D--
A0A3B4XKA5_MCL1-01      ASLVAFGVVVC-----------------QHMK---DTGRENCV----E--
A0A3Q3GP42_MCL1-01      ASLVAFGAAVS-----------------QYLK---ENGRGHCV----E--
A0A3Q3M6G2_MCL1-01      ASLVAFGAVVC-----------------QYLK---EKGRGDCV----E--
A0A3Q3M6G2_MCL1-02      ASLVAFGAVVC-----------------QYLK---EKGRGDCV----E--
A0A3B1IEV7_MCL1-01      VSLVAFGAVVC-----------------DHLK---KKSRDHCV----E--
A0A3B4CGU9_MCL1-03      ASLVAFGAVVC-----------------EQMK---EAGREQCV----E--
A0A3B4CGU9_MCL1-02      ASLVALGAVVC-----------------EWLK---EVGREQCV----E--
Q8UWD6_MCL1-01          ASLLTFGAMLC-----------------KYQN---DRGHSKYV----R--
A2BF68_MCL1-01          ASLLTFGAMLC-----------------KYQN---DRGHSKYV----R--
Q568W5_MCL1-01          ASLLTFGAMLC-----------------KYQN---DRGHSKYV----R--
A0A3B1K5R1_MCL1-01      ASLVAFGAVVS-----------------KHQH---DMGRGHCV----S--
A0A3B4C6H5_MCL1-03      ASLLAFGAVVC-----------------QHQN---QMGRGHCV----S--
A0A3B4C6H5_MCL1-01      ASLLAFGAVVC-----------------QHQN---QMGRGHCV----S--
Q9Z0F3_BCL2L10-01       VMLLAFAGTLMNQGPYMAVK------QKRDLGNRVIVTRD----------
E1B9B3_BCL2L10-01       ASLVTFAGSLLERPPQTT--------RRQEKRDDDGVSRD----------
A0A1U7QVA0_BCL2L10      VLLLAFAGTIVSQE------------QRNRLKDKMKVLQD----------
F1RZB9_BCL2L10-01       ASLLTFAGMLLERHPREACGRKK---------KEGNVSRD----------
F1MV39_BCL2L10-01       ASLVTFAGSLLERPPQTT---------RRQKRDDDGVSRD----------
W5QIG4_BCL2L10-01       ASLVTFAGSLLERQPQTT---------RRQKRDDGSVSRD----------
Q99M66_BCL2L10-01       VMLLAFVGTLMNQDRTVK---RRRDQRNRLL-----LERD----------
F6ZPD4_BCL2L10-01       AALVTLAGTLLERAPRGTYRKPKRGYKLELREWKAGVDRD----------
A0A2K6F2Q2_BCL2L10      VMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARD----------
H0WZ06_BCL2L10-01       VTLVTFAGTLLQRPPVEARREKQD--KSQLKEGEDEVARD----------
A0A1U7UZD8_BCL2L10      VTLVTFAGTLLERGPLLPAGGQQRGFRPRRKKEEGDVARD----------
G1T264_BCL2L10-01       VTLVTFAGTLLDRGPPVTTQ----------RVRRNEIARD----------
A0A0D9RG38_BCL2L10      VSLVTFAGTLLEREPLMTAWWKKQSFQPRL-EQEGDVARD----------
A0A2K5RIU7_BCL2L10      VMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGNVSRD----------
A0A2K5F974_BCL2L10      VMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARD----------
A0A2K6TIT7_BCL2L10      VMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARD----------
F7CT87_BCL2L10-01       VMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARD----------
A0A096NM44_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARD----------
A0A2K6R5T5_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGEVARD----------
Q9HD36_BCL2L10-02       VTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARD----------
G1R3W6_BCL2L10-01       VTLVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARD----------
A0A2K5K3B0_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARD----------
A0A2K6M5H5_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARD----------
A0A2K5TKG9_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARD----------
F7H6U5_BCL2L10-01       VSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARD----------
A0A2K6B2D9_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARD----------
A0A2K5MMZ4_BCL2L10      VSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARD----------
H2NN92_BCL2L10-01       VTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARD----------
A0A2R9BCD9_BCL2L10      VTLVTFAGTLLERGPLVTTRWKKWGFQPRLKEQEGDVARD----------
H2Q9G4_BCL2L10-01       VTLVTFAGTLLERGPLVTTRWKKWGFQPRLNEQEGDVARD----------
G3QLU6_BCL2L10-01       VTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARD----------
A0A337RYG8_BCL2L10      VALLTFAGTLLERPPPGTYLNLTPDQQQEL-EWETNVGQD----------
G1LKR4_BCL2L10-01       VALLTFAGTLLERSPSGTYSNLGPDQELELGEWEAGVRQD----------
A0A452QJG0_BCL2L10      VALLTFAGTLLERSPSGTYSNLGPDQELELGEREAGVRQD----------
A0A3Q4MN81_BCL2L10      VSLFAFTGVLARKILEQK---PGLDP--GQQQ---ELGQE-P-----M--
A0A3B4ETX9_BCL2L10      VSLFAFTGVLARKILEQK---PGLDP--GQQQ---ELGQE-P-----M--
A0A3Q2PJS5_BCL2L10      VSLFTFAGVLARQLQEQQGRSPGPDP--GRQQ-------E-P-----V--
A0A3Q2GL87_BCL2L10      VSLFTFAGVLARQLQEQTGKNPGLDP--GRQQ---ELQTE-P-----V--
A0A3B5MJ12_BCL2L10      VSLFAFAGVLARQLREQTGKNPVPDS--GKQQ---ELQQE-P-----V--
M4AUW7_BCL2L10-01       VSLFAFAGVLARQLREQTGKNPVPDS--GKQQ---ELQQE-P-----V--
A0A096ME02_BCL2L10      VSLFAFAGVLARQLREQTGKNPGPDS--GKQQ---ELQQE-P-----V--
A0A3B3TYN4_BCL2L10      VSLFAFAGVLARQLREQTGKNPGPDS--GKQQ---ELQQE-P-----V--
A0A3B3YT99_BCL2L10      VSLFAFAGVLARQLREQTGKNPGPDS--GKQQ---ELQQE-P-----V--
A0A3P9NE65_BCL2L10      VSLFAFAGVLARQLREQTGKNPGPDS--GKQQ---ELQQE-T-----V--
A0A3P9IIZ2_BCL2L10      VSLFAFVGVLARQLREQTDMNPGLDP----GR---EVAAG-P-----V--
A0A3P9LM07_BCL2L10      VSLFAFVGVLARQLREQTDMNPGLDP----GR---EVAPG-P-----V--
H2MBQ3_BCL2L10-01       VSLFAFVGVLARQLREQTDMNPGLDP----GR---EVAPG-P-----V--
A0A3B4AAV4_BCL2L10      VSLFTFAGVLARHIKEQKSSRPGLDP--GQVQ---GLGQV-P-----S--
A0A3Q3EZT5_BCL2L10      VSLFTFTGVLARQLQEQEDVKLGLDP--VQGQ---KLGQG-P-----G--
A0A3Q3EZT5_BCL2L10      VSLFTFTGVLARQLQEQEDVKLGLDP--VQGQ---KLGQG-P-----G--
A0A3Q3JQ78_BCL2L10      VSLFAFTGVLARQLTEQNGMKPGLDP--GQGQ---ELGQG-P-----G--
A0A3B4TIY6_BCL2L10      VSIFTFTGVLARLLLEQNRVNPGLDP--GQGQ---GLG------------
A0A3B4WGF4_BCL2L10      VSIFTFTGVLARLLLEQNRVNPGLDP--GQGQ---GLR------------
A0A3Q3KZW1_BCL2L10      VSLFTFTGVLSRQLMEQKGMKPGLDS--GKGQ---ELGQG-P-----E--
A0A3B5KD08_BCL2L10      VSLFTFTGVLARLMQEQKSTKPGLDP--GQEQ---QLGQV-P-----E--
A0A3Q3VI28_BCL2L10      VSIFTFTGVLARQLLEQKSTKPGLEPRQDQDQ---ELGQV-P-----G--
A0A3Q1GM98_BCL2L10      VSLFTFTGVLARQLLEQKDTKPGLDP--GKRQ---ELGQR-P-----V--
A0A3Q1D2L0_BCL2L10      VSLFTFTGVLARQLLEQKDTKLGLDP--GKQQ---ELGQG-P-----V--
A0A3P8RL82_BCL2L10      VSLFTFTGVLARQLLEQKDTKPGLDP--GKQQ---ELGQG-P-----V--
A0A3B4ZFS0_BCL2L10      VSLFTFTGVLARQLQEQRDTKPGLEP--GKRQ---ELGQG-P-----V--
A0A3Q2UUN9_BCL2L10      VSLFAFTGVLARKILEQKP---GLDP--RQQQ---ELGQE-P-----M--
A0A3P8PVZ8_BCL2L10      VSLFAFTGVLARKILEQKP---GLDP--RQQQ---ELGQE-P-----M--
A0A3Q2UUN9_BCL2L10      VSLFAFTGVLARKILEQKP---GLDP--RQQQ---ELGQE-P-----M--
A0A3P9BLI0_BCL2L10      VSLFAFTGVLARKILEQKP---GLDP--RQQQ---ELGQE-P-----M--
A0A3Q0S9R1_BCL2L10      VSLFAFTGVLARKRLEQKP---GLDP--GQQQ---ELGQE-P-----I--
D2IT42_BCL2L10-02       VSLFTFTGVLARQLQEKKGVQLGQDP--GTGR---ALGQV-PG----G--
A0A3B3C5I4_BCL2L10      VSLFAFVGVLARQLREQTDTNPGLDL----GR---EAAPG-P-----V--
A0A3Q1IAB0_BCL2L10      VSLFTFTGVLARQMLEQKDKKPGLDL--GKGQ---ELGQE-P-----G--
A0A3P8W7K5_BCL2L10      VSIFTFTGVLAKQLLVQKGLKPGQEP--EAGQ---ELGPE-P-----G--
H3AAS7_BCL2L2-02        VALFVFSAALC-------------------VE---SVDKE-MA----S--
H3AAS7_BCL2L2-01        VALFVFSAALC-------------------VE---SVDKE-MA----S--
G1Q051_BCL2L2-01        VAFFVFGAALC-------------------VE---SVNKE-ME----P--
G3WPT1_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A287D9B3_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A482LX62_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
W5QDH4_BCL2L2-02        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
Q7TS60_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
G1LMC3_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
M3Y5X5_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
G1P3J2_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
G3WPT1_BCL2L2-02        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
G1TV33_BCL2L2-01        VAFFAFGAALC-------------------AE---SVNKE-ME----P--
P70345_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
O88996_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A3Q9B4M8_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
H0XR82_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A250YBR2_BCL2L2-      VAFFVFGAALC-------------------AE---SINKE-ME----P--
A0A250YBR2_BCL2L2-      VAFFVFGAALC-------------------AE---SINKE-ME----P--
L8HP19_BCL2L2-02        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
L8HP19_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
Q1RMX3_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A452ECF0_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A286XQQ9_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-MQ----P--
A0A2K5RUN8_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K5MZX9_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A0D9RU30_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K5HEJ9_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A1S3FYD8_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2I2UAE3_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2I2YPX6_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A287D9B3_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K5V0Q3_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
F7G4L5_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6EA59_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6AI25_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A1U7RC37_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2I3GEA7_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2R9A2Q3_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
H2Q805_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A096NX09_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6GWM6_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6ME72_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6RW35_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6RW35_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K6TM77_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A287ATE4_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A1U7UJF2_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A452SHI1_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
Q05KI8_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
Q2TAP5_BCL2L1-01        VAFFSFGRALC-------------------VE---SANKE-MT----D--
Q91828_BCL2L1-01        VAFFSFGRALC-------------------VE---SANKE-MT----D--
I7GKS6_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5EBP4_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5Q6R6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6UWY8_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q5XGJ4_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-MS----P--
F7G6M3_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K5CWY6_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K5CWY6_BCL2L2-      VAFFVFGAALC-------------------AE---SVNKE-ME----P--
G3TMU7_BCL2L2-01        VAFFVFGAALC-------------------AE---SVNKE-ME----P--
A0A2K5M8B1_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5H963_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5VPG2_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5YR37_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2R8Z9D7_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A096NV05_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6QFA2_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A1U7T4L4_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6G3C5_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A3Q1LRT3_BCL2L1-      VAFFSFSGTLC-------------------MK---SIDKE-IH----V--
H9GHK7_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----G--
Q07816_BCL2L1-04        RL-----GALCGSVWEQRC---------CRAE---EGPGD-LQ----Q--
A0A493TIA6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MR----V--
Q07816_BCL2L1-02        VAFFSFGGALC-------------------VE---SVDKE-MR----V--
Q07816_BCL2L1-03        VAFFSFGGALC-------------------VE---SVDKE-MR----V--
Q07816_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MR----V--
G1N5N5_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MR----V--
A0A452ILL8_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A452ILL8_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
K7F655_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A452E1B1_BCL2L1-      VAFFSFGGALC-------------------MK---SIVKE-MQ----V--
W5PSA5_BCL2L1-01        VAFFSFGGALC-------------------MK---SIVKE-MQ----V--
P53563_BCL2L1-03        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
P53563_BCL2L1-02        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A287CZ07_BCL2L1-      VAFLSFGGALC-------------------ME---SVDKE-MQ----V--
F6WA14_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-ME----V--
G3WKX6_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-ME----V--
M3XA94_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
M3XA94_BCL2L1-02        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A3Q2H0F6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
H0X6V2_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
G3SPN0_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q2PFS6_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
O35843_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
M3XA94_BCL2L1-03        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
G1RER8_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A1S2ZQT6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q64373_BCL2L1-09        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q64373_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
P53563_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
O77737_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q9MYW4_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-ME----V--
A0A3Q2H0F6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
L8J061_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q05KJ0_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q05KJ0_BCL2L1-02        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
E2IV76_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6G3C5_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
B2Z3Z4_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
G3HEA7_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
G3HEA7_BCL2L1-02        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A1U7T4L4_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
M3Z2H9_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----A--
A0A1U7QU73_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A0D9RJZ8_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A286Y5D6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A250YD48_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A1L5BWY3_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
I3MUP5_BCL2L1-02        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
I3MUP5_BCL2L1-03        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
I3MUP5_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
G1P9D2_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5EBP4_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
E2IV75_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
F7IT34_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q76LT7_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5Q6R6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5Q6R6_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5M8B1_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5H963_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q8SQ42_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5VPG2_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K5YR37_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2R8Z9D7_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A096NV05_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2J8VIH3_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6QFA2_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6QFA2_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A2K6UWY8_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
E2IV77_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A452SDS4_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A384D3U1_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A452FWV3_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
Q9MZS7_BCL2L1-01        VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A3B3E2W4_BCL2L1-      VGLFVFGGVLC-------------------VE---CVERN-MS----E--
A0A3B3I2Q5_BCL2L1-      VGLFVFGGALC-------------------VE---CVERN-MG----E--
A0A3P9I2N4_BCL2L1-      VGLFVFGGALC-------------------VE---CVERN-MG----E--
A0A3P9MKK4_BCL2L1-      VGLFVFGGALC-------------------VE---CVERN-MG----E--
A0A3B5B4X7_BCL2L1-      VGLFCFGGVLC-------------------VE---CVDKN-MN----E--
A0A3B4BFZ8_BCL2L1-      VGLFVFGGVLS-------------------VE---CVEKD-MS----I--
A0A3Q3FUB6_BCL2L1-      VGLFAFGGVLC-------------------VE---CVQKD-MG----E--
A0A3B5MGS2_BCL2L1-      VAMFTFGGILC-------------------VD---CVQKN-MS----E--
M4A558_BCL2L1-01        VAMFTFGGILC-------------------VD---CVQKN-MS----E--
A0A3P9QFB3_BCL2L1-      VAMFTFGGILC-------------------VD---CVQKN-MS----E--
A0A087YBW4_BCL2L1-      VAMFTFGGILC-------------------VD---CVQKN-MS----E--
A0A3B3VWI7_BCL2L1-      VAMFTFGGILC-------------------VD---CVQKN-MS----E--
A0A3B3XN57_BCL2L1-      VAMFTFGGILC-------------------VD---CVQKN-MS----E--
A0A3Q2C6K4_BCL2L1-      VGLFAFGGVLC-------------------VH---CVQKN-MS----E--
A0A3Q2NRP4_BCL2L1-      VGLFAFGGVLC-------------------VD---CVQKN-MS----E--
A0A0B4KJI5_BCL2L1-      VGLFAFGGVLC-------------------VE---CVEKD-TS----E--
A0A3Q1JZ46_BCL2L1-      VGLFAFGGVLC-------------------VE---CVEKN-MS----E--
A0A3Q1JZ46_BCL2L1-      VGLFAFGGVLC-------------------VE---CVEKN-MS----E--
A0A3Q3NFM4_BCL2L1-      VGLFAFGGVLC-------------------VE---CIEKN-MS----A--
A0A3Q3NFM4_BCL2L1-      VGLFAFGGVLC-------------------VE---CIEKN-MS----A--
A0A3B4V9K8_BCL2L1-      VGLFAFGGVLC-------------------VE---CIQKN-MS----E--
A0A3B4XS24_BCL2L1-      VGLFAFGGVLC-------------------VE---CIQKN-MS----E--
A0A2U9BY16_BCL2L1-      IGLFAFGGALS-------------------VE---CVEKE-MS----S--
C1BLI0_BCL2L1-01        VGLFAFGGALC-------------------AE---CVEKD-MS----H--
C0HAD8_BCL2L1-01        VGLFAFGGALC-------------------VE---CVEKD-MS----P--
A0A3B3ZMX9_BCL2L1-      VGLFAFGGALA-------------------VE---CVDKE-MS----T--
A0A3B3TFR4_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
H3CH49_BCL2L1-01        VGLFAFGGALC-------------------VE---CVEKE-MN----P--
A0A3Q2FR43_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P8XYL5_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
Q90Z98_BCL2L1-02        VGLFAFGGALC-------------------VE---CVEKE-MS----P--
Q90Z98_BCL2L1-01        VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A059PJI5_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3B4DTL9_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
B5XAY3_BCL2L1-01        VGLFSFGGALC-------------------VE---CVDKE-MN----P--
W5MG74_BCL2L1-01        VGLFAFGGALC-------------------VE---CVEKE-MS----N--
A0A3Q3B3X5_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A3B3IB64_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P9JYH1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3B3DHA1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q0RTF8_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
I3IZK7_BCL2L1-01        VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A2U9BY16_BCL2L1-      IGLFAFGGALS-------------------VE---CVEKE-MS----S--
A0A2U9BY16_BCL2L1-      IGLFAFGGALS-------------------VE---CVEKE-MS----S--
A0A2U9BY16_BCL2L1-      IGLFAFGGALS-------------------VE---CVEKE-MS----S--
A0A0D6DR75_BCL2L1-      IGLFAFGGALC-------------------VE---CVEKE-MS----Q--
A0A3Q3WIW8_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A219P0Y3_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q3MX20_BCL2L1-      IGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q3G2E1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q3G2E1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q3G2E1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q1GZ93_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----Q--
A0A3Q1GZ93_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----Q--
A0A3Q1GZ93_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----Q--
A0A3B4V3T1_BCL2L1-      IGLFVFGGALC-------------------VE---CVEKE-MS----P--
A0A3B4XU17_BCL2L1-      IGLFVFGGALC-------------------VE---CVEKE-MS----P--
H3ANS8_BCL2L1-01        VAFFAFGGALC-------------------VE---SMDKE-MS----S--
A0A452FHY1_BCL2L1-      VAFFSFRGALC-------------------ME---SVDKE-MQ----V--
A0A452FHY1_BCL2L1-      VAFFSFRGALC-------------------ME---SVDKE-MQ----V--
A0A1S3EPX7_BCL2L1-      VAFFSFGGALC-------------------VE---SVDKE-MQ----V--
A0A218USB3_BCL2L1-      VAFFSFGGALC-------------------VE---SVVKE-MR----V--
A0A218USB3_BCL2L1-      VAFFSFGGALC-------------------VE---SVVKE-MR----V--
U3JSL7_BCL2L1-01        VAFFSFGGALC-------------------VE---SVVKE-MR----V--
A0A218USB3_BCL2L1-      VAFFSFGGALC-------------------VE---SVVKE-MR----V--
A0A218USB3_BCL2L1-      VAFFSFGGALC-------------------VE---SVVKE-MR----V--
H0Z8G3_BCL2L1-01        VAFFSFGGALC-------------------VE---SVVKE-MR----V--
Q4U2V6_BCL2L1-01        VAFFSFGGALC-------------------VE---SVVKE-MR----V--
R4JQR8_BCL2L1-01        VALFGFGGSLS-------------------VK---CVQRG-MP----Q--
A0A346RRN1_BCL2L1-      VALFGFGGALS-------------------VE---CVQNG-MP----Q--
Q568V1_MCL1-01          ASLVAFGAVVC-------------------SR---LKELQ-QD----Q--
Q1L8X3_MCL1-01          ASLVAFGAVVC-------------------SR---LKELQ-QD----Q--
Q9I9N3_MCL1-01          ASLVAFGAVVC-------------------SR---LKELQ-QD----Q--
A0A286XUI2_BCL2A1-      VTIFAFGGVIL-------------------KK---LPREP-IA----P--
A0A452U285_BCL2A1-      VTIFAFEGILT-------------------KK---LLQER-IS----P--
A0A452U285_BCL2A1-      VTIFAFEGILT-------------------KK---LLQER-IS----P--
A0A3B3R4U0_MCL1-01      ASLIAFGGVVC-------------------KY---LKDHG-QT----N--
F7CP56_BCL2A1-03        DLILMPG--LG-------------------FD---KHGNR----------
A0A3P8V8T6_MCL1-01      VSLVAFGAVLC-------------------QH---LKEKG-WE----N--
A0A3P8YNB4_BCL2-01      IAFFEFGGTIC-------------------VE---CVNKE-MT----S--
A0A3P8WUE9_BCL2-01      IAFFEFGGVVC-------------------VE---CAAKEDLT----P--
A0A3B4A3G8_BCL2-01      IAFFEFGGTVC-------------------VE---CASKEDMS----S--
A0A3Q3G1D7_BCL2-01      IAFFEFGGTVC-------------------VE---CMSKQEMT----S--
A0A3Q2XQX2_BCL2-02      IAFFEFGGTVC-------------------VE---CATKEDMT----S--
A0A3Q2XQX2_BCL2-01      IAFFEFGGTVC-------------------VE---CATKEDMT----S--
A0A3Q3B0R2_BCL2-01      IAFFEFGGTVC-------------------VE---CASREEMT----P--
A0A3Q2PN77_BCL2-01      IAFFEFGGTVC-------------------VE---CASKEGMS----S--
A0A3P9J8Y9_BCL2-01      IAFFEFGGTVC-------------------VE---CASNEEMS----T--
A0A3Q0S5Z7_BCL2-01      IAFFEFGGTVC-------------------VE---CASNEGMT----S--
A0A3P8QVM8_BCL2-01      IAFFEFGGTVC-------------------VE---CASNEGMS----S--
A0A3P9DIG5_BCL2-01      IAFFEFGGTVC-------------------VE---CASNEGMS----S--
A0A3Q2UYW8_BCL2-01      IAFFEFGGTVC-------------------VE---CASNEGMS----S--
A0A3B4G3K4_BCL2-01      IAFFEFGGTVC-------------------VE---CASNEGMS----S--
A0A2U9BJ09_BCL2-01      IAFFEFGGTVC-------------------VE---CADTEEMT----S--
A0A3Q1I5N1_BCL2-01      IAFFEFGGTVC-------------------VE---CASKEEMT----P--
A0A3Q3K1K1_BCL2-01      IAFFEFGGTMC-------------------VE---CAAKEEMT----P--
A0A3Q3MEY1_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
A0A1X9JZA1_BCL2-01      IAFFEFGGTVC-------------------VE---CVAKEEMA----A--
A0A4D6FTA2_BCL2-01      IAFFEFGGTVC-------------------VE---CVAKEEMT----P--
A0A3Q1FLK7_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
A0A3Q1B8C3_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
A0A3P8S9L3_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
A0A3B5BBQ0_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
A0A3B4TX71_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
A0A3B4YAG2_BCL2-01      IAFFEFGGTVC-------------------VE---CAAKEEMT----S--
G1TW27_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
E2RS00_BCL2A1-02        VTVFAFEGILT-------------------KK---LLEQR-IS----S--
A0A3B3TCS4_BCL2-01      VAFLEFGGTMC-------------------VE---SVNRE-MT----S--
A0A0U3DHY6_BCL2-01      VAFFEFGGTMC-------------------VE---SVNRE-MT----S--
A0A3P9AAB2_BCL2-01      VAFLEFGGTMC-------------------VE---SVNRE-MT----P--
X4ZGI8_BCL2-01          VAFFEFGGTMC-------------------VE---SFNRE-MA----S--
A0A3P9MKK4_BCL2L1-      VGLFVFGGALC-------------------VE---CVERN-MG----E--
A0A3B3I2Q5_BCL2L1-      VGLFVFGGALC-------------------VE---CVERN-MG----E--
A0A3P9I2N4_BCL2L1-      VGLFVFGGALC-------------------VE---CVERN-MG----E--
A0A3B4AFB7_MCL1-01      ASLIAFGAVVC-------------------QY---LKTKG-RE----S--
G3TVG9_MCL1-01          VTI-SFGAFVV---------------------------KH-FG----S--
B9ZYL7_BCL2-01          VAFFEFGGVMC-------------------VE---IVNRE-MS----P--
A0A3L7HT14_BCL2A1-      VTVFAFGGVLL-------------------KK---LAQEQ-IG----L--
F6YNL8_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A218UQA0_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MF----P--
Q00709_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A493T1X3_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
U3KEW4_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G3WZW9_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
M3YYK3_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
M3X1R9_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K6R2I5_BCL2-02      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2R9APW6_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G3SLZ1_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
Q75SV7_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
M3X1R9_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
Q8I008_BCL2-01          VAFFEFGGVMC-------------------VE---GVNRE-MS----P--
A0A076FU27_BCL2-01      VAFFEFGGVIC-------------------VE---SVNRE-MS----P--
A0A4P8GLJ2_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
F6R2C4_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
O02718_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A076FZV9_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A452EV13_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A250YD83_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A9QXG9_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K5NZS5_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A0D9S017_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K6CIX3_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K5XRD4_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K6KHG1_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K6R2I5_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K5HK49_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G3QES9_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
H2QEM8_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2I3GZF9_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K6UEL3_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
E2QWA1_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G1LIC9_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A452R110_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A452R110_BCL2-02      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G3WZW9_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G3SLZ1_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A452T603_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
M3Y8D1_BCL2L10-01       VALVTFAGTLL-------------------ER---PPSGA-CS----N--
A0A3Q2Y539_MCL1-01      ASLLAFCAVLS-------------------QA---LKENQ-QE----R--
A0A3Q3BEB7_BCL2L1-      VGLFAFGGVLC-------------------VQ---CVERD-MS----E--
A0A3P8VMA1_BCL2L1-      VGLFTFGGVLC-------------------VE---CVQRN-MS----E--
A0A345BSW9_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A286MU87_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKD-MS----P--
A0A3P8XFS0_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKD-MS----L--
A0A3P8XFS0_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKD-MS----L--
A0A0F7L1T6_BCL2L1-      VGLFAFGGVLC-------------------VE---CVERD-AS----Q--
H2U5I3_BCL2L1-01        VGLFAFGGVLC-------------------VE---CVEKD-AS----Q--
A0A3Q3J5K3_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKN-MS----E--
A0A3Q1EVP6_BCL2L1-      VGLFCFGGVLC-------------------VE---CVEKN-MS----E--
A0A3Q1BQA0_BCL2L1-      VGLFCFGGVLC-------------------VE---CVEKN-MS----E--
A0A3P8U812_BCL2L1-      VGLFCFGGVLC-------------------VE---CVDKN-MS----E--
E6ZFR0_BCL2L1-01        VGLFAFGGVLC-------------------VE---CVEKD-MS----E--
G3P7B4_BCL2L1-01        VGLFAFGGVLC-------------------VE---CVEKD-MT----E--
A0A3Q3X5M5_BCL2L1-      VGLFAFGGVLC-------------------VE---CAEKD-TG----E--
A0A2U9BIG9_BCL2L1-      VGLFAFGGVLC-------------------VE---CVEKN-RG----E--
D2ITA2_BCL2L1-02        VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A3B3ZMX9_BCL2L1-      VGLFAFGGALA-------------------VE---CVDKE-MS----T--
G3NJY1_BCL2L1-01        VGLFAFGGALC-------------------VE---CVDKE-MS----P--
A0A2U9BY16_BCL2L1-      IGLFAFGGALS-------------------VE---CVEKE-MS----S--
A0A3Q3DUT7_BCL2L1-      VGLFAFGGALC-------------------VE---CMEKE-MI----P--
A0A3Q3DUT7_BCL2L1-      VGLFAFGGALC-------------------VE---CMEKE-MI----P--
A0A3Q3DUT7_BCL2L1-      VGLFAFGGALC-------------------VE---CMEKE-MI----P--
A0A3B1JJ42_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P8UWG7_BCL2L1-      IGLFAFGGALS-------------------VE---CVEKE-MS----Q--
A0A3Q3IVF5_BCL2L1-      IGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q1DHJ3_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q1DHJ3_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q1DHJ3_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P8TL99_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P8TL99_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q1FR00_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3B4Z3X2_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3B4Z3X2_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
C3VIT1_BCL2L1-01        VGLFAFGGALC-------------------VE---CVERE-MS----P--
A0A3P8P0F1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q2X557_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P9D632_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3P9D632_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q4N4B5_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3B4FNX1_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3Q2QPL9_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----P--
A0A3B5PQJ0_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A087X9B7_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A3B3TUS7_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A3B3WI27_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A3P9N9Y4_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MS----H--
A0A3B3QRZ2_BCL2L1-      VGLFAFGGALC-------------------VE---CVEKE-MG----H--
Q564A4_BCL2-01          IAFFEFGGTMC-------------------VE---SVNRE-MA----S--
H9GPE7_BCL2-01          VAFFEFGGMLC-------------------VE---SVSRE-MS----P--
A0A452I9V7_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
W5N4F7_BCL2-01          VAFFEFGGTMC-------------------VE---SVNRE-MT----S--
K7F5Y3_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A3Q2HRY3_BCL2-02      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
K7F5Y3_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
F1LNV0_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
P49950_BCL2-01          VAFFEFGGVMC-------------------VG---SVNRE-MS----P--
G1TW27_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K5EB04_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2R8MY14_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
H2NWH5_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A096MPU7_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K5PP81_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
H0WKI0_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K5UDI5_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
P10417_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
Q7TSN8_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A3Q2HRY3_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
E2QWA1_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
A0A2K6G3I7_BCL2-01      VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
Q6R755_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
Q9JJV8_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
Q923R6_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
H0W1T3_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
G1LIC9_BCL2-02          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
I3MVK9_BCL2-01          VAFFEFGGVMC-------------------VE---SVNRE-MS----P--
                                                                          

P70345_BCL2L2-02        ------------------------------VQDWMVAYLET-RLADWIHS
G1MZW1_BCL2-01          -L--------------------VDN-----IATWMTEYLNR-HLHNWIQD
A2BF68_MCL1-02          -L----------------------------VGEEISSYLLT-EQRDWILR
A0A3L7HT14_BCL2A1-      ------------------------------EERLRQSHLLT-QK------
F7CP56_BCL2A1-02        ------------------------------ISYFVAEFITK-NTGEWIRQ
F7CP56_BCL2A1-01        ------------------------------ISYFVAEFITK-NTGEWIRQ
H0ZCL9_BCL2A1-01        ------------------------------ISYFITEYIIN-NKAEWIDA
U3JTB2_BCL2A1-01        ------------------------------ISYFITEYIIN-NKSEWIDA
A0A218V8Z6_BCL2A1-      ------------------------------ISYFITEYIIN-NKAEWIDA
Q9W6F2_BCL2A1-01        ------------------------------ISYFITEYIIN-NKAAWIDA
A0A493SSZ7_BCL2A1-      ------------------------------ISYFITEYIIN-NKAEWIDA
G1N8C5_BCL2A1-01        ------------------------------ISYFITEYIIN-NKAAWIDA
A0A452J3N6_BCL2A1-      ------------------------------ISYFITEYIIN-TKAEWIEA
K7G130_BCL2A1-01        ------------------------------ISYFITEYIIN-TKAEWIDA
A0A2K5PYQ3_BCL2A1-      ------------------------------ISYFVAEYIMN-NTGEWIRQ
A0A2K5PYQ3_BCL2A1-      ------------------------------ISYFVAEYIMN-NTGEWIRQ
F6SFL4_BCL2A1-01        ------------------------------ISHFIAEFIMN-NIAEWIRQ
G3WSP8_BCL2A1-01        ------------------------------ISHFIAEFIMN-NIAEWIRQ
F6S8G3_BCL2A1-01        ------------------------------ISCFIAEFTTH-HAGEWIRQ
O55178_BCL2A1-01        ------------------------------SFQF------------WGRI
Q0P538_BCL2A1-01        ------------------------------SFQF------------WGRI
G3V977_BCL2A1-01        ------------------------------VSSFVAEFIMN-NTGEWIQQ
Q925A9_BCL2A1-01        ------------------------------VSSFVAEFIMN-NTGEWIQQ
Q07440_BCL2A1-01        ------------------------------VSSFVAEFIMN-NTGEWIRQ
O55179_BCL2A1-01        ------------------------------VSSFVAEFIMN-NTGEWIRR
O55177_BCL2A1-02        ------------------------------VSSFVAEFIIN-NTGEWIRR
Q497M6_BCL2A1-01        ------------------------------VSSFVAEFIIN-NTGEWIRR
Q8K164_BCL2A1-01        ------------------------------VSSFVAEFIIN-NTGEWIRR
Q4FK02_BCL2A1-01        ------------------------------VSSFVAEFIIN-NTGEWIRR
A0A452SIR9_BCL2A1-      ------------------------------ISYFVAEFITT-NMREWIRQ
M3YVH4_BCL2A1-01        ------------------------------VSYFVAEFITT-NMREWIRQ
U6CQS8_BCL2A1-01        ------------------------------VSYFVAEFITT-NMREWIRQ
I3MCZ7_BCL2A1-01        ------------------------------ISYFVAEFIMN-NAGEWIRQ
G3T8E6_BCL2A1-01        ------------------------------ISSFVAEFIVD-NTAEWIRQ
H0WZ23_BCL2A1-01        ------------------------------ISYFVAEFIMN-YTGEWIRQ
A0A2K6TLJ5_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRR
A0A2K5D2I1_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWISQ
B4E1X9_BCL2A1-01        ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2I2YML2_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2R8ZJX9_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2I3HBP6_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6PHF2_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6LV19_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K5TMD1_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K5KAA3_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6DS18_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A096NMX5_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6AD27_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
F7HXW0_BCL2A1-01        ------------------------------ISHFVAEFIMN-NTGEWIRQ
A0A2K6TLJ5_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRR
A0A2I3HBP6_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6EKG1_BCL2A1-      ------------------------------ISYFIAEFITN-NAGEWIRQ
A0A452EK63_BCL2A1-      ------------------------------ISYFVAEFITE-NTGEWIRQ
W5Q0N6_BCL2A1-01        ------------------------------ISYFVAEFITK-NTGEWIRQ
L8IZT5_BCL2A1-01        ------------------------------ISYFVAEFITE-NTGEWIKQ
Q3C2I0_BCL2A1-01        ------------------------------ISFFVAEFITE-NTGEWIKQ
F7CP56_BCL2A1-04        ------------------------------ISYFVAEFITK-NTGEWIRQ
C7F841_BCL2A1-01        ------------------------------ISYFVAEFITK-NTGQWIRQ
A0A2K5D2I1_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWISQ
H2NNZ9_BCL2A1-01        ------------------------------ISYFVAEFVMN-NTGGWIKQ
A0A2I2YML2_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6LV19_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6PHF2_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K5KHH8_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K5KHH8_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K5KAA3_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K5TMD1_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
F7E8V5_BCL2A1-01        ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6DS18_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2K6AD27_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A096NMX5_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A0D9RRC3_BCL2A1-      ------------------------------ISYFVAEFITN-NTGEWIRQ
Q16548_BCL2A1-01        ------------------------------ISYFVAEFIMN-NTGEWIRQ
A0A2R8ZJX9_BCL2A1-      ------------------------------ISYFVAEFIMN-NTGEWIRQ
G1QEX2_BCL2L10-01       ------------------------------LVTFLCSWLTE-THRTWMEA
A0A3Q1FR00_BCL2L1-      -R----------------------------IVEWMTVYLDN-HIQDWIQG
F6VJQ0_BCL2L10-01       RR----------------------------LTEKLCNYLVE-RKGAWLHE
H3AR18_MCL1-01          -Q----------------------------LAVSITDFLVQ-NKGDWILK
J7H260_MCL1-01          -I----------------------------LADSFTDYLMT-QKKEWIVE
G1PZ39_MCL1-01          -P----------------------------PDSLGTALRSK-AGKVWETS
Q95KR3_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5EPX0_MCL1-02      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5EPX0_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
Q9Z1P3_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A5PJR2_MCL1-01          -P----------------------------LAESITDVLVR-SKRDWIVK
A0A452GA25_MCL1-01      -P----------------------------LAESITDVLVR-SKRDWIVK
G1L3L7_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
G1T2Q0_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
F7AVA6_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A337S3J9_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A337S3J9_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
Q7YRZ9_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
F1PAP1_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
Q8HYS5_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
M3XZZ5_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A452RHX5_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
H0XFB7_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
F7GTF7_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5CFH3_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K6V5Y3_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K6KRW9_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5XSB2_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A0D9RZP5_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
I7G687_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5LXU8_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2I3GJZ3_MCL1-02      -P----------------------------LAESITDVLVR-TKRDWLVK
H2N5Y9_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2R9BPJ5_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2I3RTV4_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2I2YQH7_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5C7L5_MCL1-01      -G----------------------------FCRCCWS-------RSWF--
A0A2K5I9I0_MCL1-02      -G----------------------------FCRCCWS-------RSWF--
A0A2K6GI15_MCL1-01      -G----------------------------FCRCCWS-------RSWF--
A0A2I3GJZ3_MCL1-01      -G----------------------------FCRCCWS-------RSWF--
A0A2K5CFH3_MCL1-03      -G----------------------------FCRCCWS-------RSWF--
A0A2K5R5E2_MCL1-03      -G----------------------------FCRCCWS-------RSWF--
A0A2K5W0W9_MCL1-01      -G----------------------------FCRCCWS-------RSWF--
A0A2K6ECR0_MCL1-02      -G----------------------------FCRCCWS-------RSWF--
A0A2I3LFM0_MCL1-01      -G----------------------------FCRCCWS-------RSWF--
A0A2K6KRW9_MCL1-02      -G----------------------------FCRCCWS-------RSWF--
A0A2K6PPI3_MCL1-02      -G----------------------------FCRCCWS-------RSWF--
G3WBC5_MCL1-01          -P----------------------------LAESITDVLVK-SKRDWLMK
W5QI41_MCL1-01          -P----------------------------LAESITDVLVR-SKRDWIVK
F1MQX4_MCL1-01          -P----------------------------LAESITDVLVR-SKRDWIVK
B4DLY8_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
B4DG83_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
B4E3L8_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5DMS4_MCL1-01      -P----------------------------LAESI--------------R
U3KKY6_MCL1-01          -S----------------------------LAGIITDALVS-SKRQWLES
G1MPY7_MCL1-01          -S----------------------------LAGIITDALVS-SKREWLMS
K7FPN7_MCL1-01          -T----------------------------LAGIITDVLVS-DKRDWLVN
H3AR18_MCL1-02          -Q----------------------------LAVSITDFLVQ-NKGDWILK
E2RS00_BCL2A1-01        -K----------------------------VSYFVAEFITR-NMRDWIRQ
B6V6J0_MCL1-01          -V----------------------------LAEHFTQFLMM-SKKDWIIQ
A0A3L7HT14_BCL2A1-      KQ----------------------------VSNFVAEFIMN-NTAEWIRQ
H0XHA5_MCL1-01          -P----------------------------LEENIADVLVR-TKPDWLVK
A0A2I2YPX6_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6TM77_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K5RUN8_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6GWM6_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
W5QDH4_BCL2L2-01        -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6ME72_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6RW35_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A287ATE4_BCL2L2-      -Q----------------------------VQEWMVTYLET-RLADWIHS
A0A2R8M4C0_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K5MZX9_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K5HEJ9_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K5V0Q3_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
F7G4L5_BCL2L2-02        -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6EA59_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6AI25_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A1U7RC37_BCL2L2-      -Q----------------------------VQDWMVTYLET-RLADWIHS
A0A2I3GEA7_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2R9A2Q3_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
H2Q805_BCL2L2-02        -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A096NX09_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A287ATE4_BCL2L2-      -Q----------------------------VQEWMVTYLET-RLADWIHS
A0A4D6NWN1_BCL2L2-      -Q----------------------------VQEWMVTYLES-RLADWIHS
A0A1U7UJF2_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A452UF16_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A452UF16_BCL2L2-      -Q----------------------------VQEWMVAYLET-RLADWIHS
A0A2K6F6N9_MCL1-01      -P----------------------------LAESITDILVR-TKRDWL--
G1QAV8_MCL1-01          -P----------------------------LAEDITDVLVG-TERGWLVK
H9GEA6_MCL1-01          -T----------------------------LIEIITDVLVT-DKREWLLK
H9GEA6_MCL1-02          -T----------------------------LIEIITDVLVT-DKREWLLK
A0A493U0E8_MCL1-01      -S----------------------------LARIITDALVS-SKREWLVS
A0A1L1RNM6_MCL1-01      -S----------------------------LAGIITDALVS-SKREWLMS
A0A1L1RNM6_MCL1-02      -S----------------------------LAGIITDALVS-SKREWLMS
G2HFR3_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
F6ZMX1_MCL1-01          -P----------------------------LAESITDVLVK-TKRDWLIK
F6ZMX1_MCL1-02          -P----------------------------LAESITDVLVK-TKRDWLIK
F6ZMX1_MCL1-03          -P----------------------------LAESITDVLVK-TKRDWLIK
G1T2Q0_MCL1-02          -P----------------------------LAESITDVLVR-TKRDWLVK
F1PAP1_MCL1-02          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A337S3J9_MCL1-04      -P----------------------------LAESITDVLVR-TKRDWLVK
F7AVA6_MCL1-02          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K6GI15_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
C8YZ26_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
F7GTF7_MCL1-02          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5R5E2_MCL1-04      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K6V5Y3_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5LXU8_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5I9I0_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2I2YQH7_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
Q07820_MCL1-04          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5W0W9_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K6ECR0_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K5XSB2_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2R9BPJ5_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2I3RTV4_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2I3LFM0_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A2K6PPI3_MCL1-03      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A286Y1M5_MCL1-01      -P----------------------------LAESITDALVH-SKRDWLVK
P97287_MCL1-01          -P----------------------------LAETITDVLVR-TKRDWLVK
A0A452GA25_MCL1-02      -P----------------------------LAESITDVLVR-SKRDWIVK
G3T756_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A1S3F3I1_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
G1L3L7_MCL1-02          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A287BK44_MCL1-02      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A287BK44_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
B4DU51_MCL1-01          -P----------------------------LAESITDVLVR-TKRDWLVK
A0A287DCH9_MCL1-02      -P----------------------------LAESITDVLVR-TKRDWLVK
A0A287DCH9_MCL1-01      -P----------------------------LAESITDVLVR-TKRDWLVK
W5MMB7_MCL1-01          -A----------------------------VGQAISNYLLQ-DQREWLLN
A0A3B3SG34_MCL1-01      -A----------------------------VGKQISSYLLS-EQRQWLLK
Q4SW32_MCL1-01          -Q----------------------------VAQEISTYLLT-DQRDWLIK
Q0KFR9_MCL1-01          -L----------------------------VGQEIAKYLLS-DQSDWLIK
A0A3P8Y1W8_MCL1-02      -L----------------------------VGQEISTYLLT-DQRAWLVK
A0A3P8Y1W8_MCL1-01      -L----------------------------VGQEISTYLLT-DQRAWLVK
D2ITA0_MCL1-03          -L----------------------------VAEEISSYLLS-DQREWLVK
D2ITA0_MCL1-04          -L----------------------------VAEEISSYLLS-DQREWLVK
A0A3P9ILF6_MCL1-02      -L----------------------------VSQEICTYLLS-EQRNWLVN
A0A3P9ILF6_MCL1-01      -L----------------------------VSQEICTYLLS-EQRNWLVN
A0A3Q2XZL8_MCL1-01      -P----------------------------VADEISSYLLS-HQRNWLVK
A0A3B4AFB7_MCL1-02      -R----------------------------VGQEISSYLLL-DQRDWLVR
A0A3B3VM25_MCL1-01      -L----------------------------VIQEISTYLLE-NQRDWLAK
I3KXG5_MCL1-01          -L----------------------------VSQEISAYLLS-EQRDWIIK
A0A3Q0R633_MCL1-01      -L----------------------------VSQEISTYLLS-DQRDWLVK
A0A3Q0R633_MCL1-03      -L----------------------------VSQEISTYLLS-DQRDWLVK
A0A3B4T8L9_MCL1-02      -S----------------------------VGQEISKYLLS-DQRDWLVK
A0A3B4T8L9_MCL1-01      -S----------------------------VGQEISKYLLS-DQRDWLVK
A0A3Q1EQB9_MCL1-02      -L----------------------------VSQEISTYLLS-EQRDWLVK
A0A3B4ZKP6_MCL1-01      -L----------------------------VSEEISTYLLC-DQRDWLVK
A0A3Q1BKL8_MCL1-02      -L----------------------------VSQEISTYLLS-EQRDWLVK
A0A3Q1EQB9_MCL1-01      -L----------------------------VSQEISTYLLS-EQRDWLVK
A0A3Q1BKL8_MCL1-01      -L----------------------------VSQEISTYLLS-EQRDWLVK
A0A3P8RQX7_MCL1-02      -L----------------------------VSQEISTYLLS-EQRDWLVK
A0A3P8RQX7_MCL1-01      -L----------------------------VSQEISTYLLS-EQRDWLVK
G3PJT0_MCL1-01          -L----------------------------VGQEISAYLLS-DQRDWLIK
A0A3B3IJ04_MCL1-01      -L----------------------------VSQEICTYLLS-EQRNWLVN
A0A3P9L1F3_MCL1-01      -L----------------------------VSQEICTYLLS-EQRNWLVN
A0A3B3IJ04_MCL1-02      -L----------------------------VSQEICTYLLS-EQRNWLVN
A0A3P9L1F3_MCL1-02      -L----------------------------VSQEICTYLLS-EQRNWLVN
A0A3B3CEX1_MCL1-01      -L----------------------------VSQEICTYLLR-EQRDWLIN
A0A3B3CEX1_MCL1-02      -L----------------------------VSQEICTYLLR-EQRDWLIN
A0A3Q3VP02_MCL1-01      -L----------------------------VAHEISTYLLT-DQRDWMCV
A0A3Q3B4P5_MCL1-01      -L----------------------------VGQEISTYLLS-EQKDWLLK
A0A3Q3B4P5_MCL1-02      -L----------------------------VGQEISTYLLS-EQKDWLLK
A0A3Q2EDX8_MCL1-01      -L----------------------------VSQEISTYLLQ-NQRDWLVK
A0A3Q2P7X9_MCL1-01      -L----------------------------VSREISTYLLT-NQRDWLAK
A0A3Q2P7X9_MCL1-02      -L----------------------------VSREISTYLLT-NQRDWLAK
A0A3B5PQ55_MCL1-01      -L----------------------------VSRKISTYLLA-NQRDWLAK
A0A3B5PQ55_MCL1-02      -L----------------------------VSRKISTYLLA-NQRDWLAK
A0A3P9Q4I8_MCL1-01      -L----------------------------VSQEISTYLLA-KQRDWLAK
A0A3P9Q4I8_MCL1-02      -L----------------------------VSQEISTYLLA-KQRDWLAK
A0A087X830_MCL1-01      -L----------------------------VSKEISTYLLE-NQRDWLAK
A0A3B3YCD0_MCL1-01      -L----------------------------VSKEISTYLLE-NQRDWLAK
I3JHR5_MCL1-02          -L----------------------------VSQEVSAYLLS-EQRDWIVK
I3JHR5_MCL1-03          -L----------------------------VSQEVSAYLLS-EQRDWIVK
I3JHR5_MCL1-01          -L----------------------------VSQEVSAYLLS-EQRDWIVK
A0A3Q4HLQ8_MCL1-01      -L----------------------------VSQEISAYLLS-EQRDWIVK
A0A3P8NP63_MCL1-02      -L----------------------------VSQEISAYLLS-EQRDWIVK
A0A3Q2VNL8_MCL1-01      -L----------------------------VSQEISAYLLS-EQRDWIVK
A0A3P8NP63_MCL1-01      -L----------------------------VSQEISAYLLS-EQRDWIVK
A0A3P9BVM3_MCL1-01      -L----------------------------VSQEISAYLLS-EQRDWIVK
A0A3B4G4Z6_MCL1-01      -L----------------------------VSQEISAYLLS-EQRDWIVK
A0A2U9CJ81_MCL1-01      -L----------------------------VGQEISTYLLT-DQRDWLVK
A0A3P8VKM5_MCL1-03      -L----------------------------VGREISSYLLS-YQRDWLLK
A0A3P8VKM5_MCL1-04      -L----------------------------VGREISSYLLS-YQRDWLLK
A0A3P8VKM5_MCL1-05      -L----------------------------VGREISSYLLS-YQRDWLLK
A0A3Q3IZW0_MCL1-01      -L----------------------------VGQEISTYLLS-HQRDWLVK
A0A3Q1GX28_MCL1-02      -L----------------------------VAQEISSYLLS-AQRDWLVR
A0A3Q1GX28_MCL1-01      -L----------------------------VAQEISSYLLS-AQRDWLVR
A0A3B4XKA5_MCL1-01      -S----------------------------VGQEISKYLLS-DQRDWLVK
A0A3Q3GP42_MCL1-01      -L----------------------------VGQEISTYLLS-DHRDWLVK
A0A3Q3M6G2_MCL1-01      -L----------------------------VGQEISTYLLS-DQRDWLVK
A0A3Q3M6G2_MCL1-02      -L----------------------------VGQEISTYLLS-DQRDWLVK
A0A3B1IEV7_MCL1-01      -N----------------------------VAQHISTYLNT-HQHQWLIN
A0A3B4CGU9_MCL1-03      -N----------------------------VIQHISTYLST-DQRQWLIN
A0A3B4CGU9_MCL1-02      -N----------------------------VIQHISMYLST-DQRQWLIN
Q8UWD6_MCL1-01          -L----------------------------VGEEISSYLLT-EQRDWILR
A2BF68_MCL1-01          -L----------------------------VGEEISSYLLT-EQRDWILR
Q568W5_MCL1-01          -L----------------------------VGEEISSYLLT-EQRDWILR
A0A3B1K5R1_MCL1-01      -L----------------------------VGEELSSYLLS-DERDWLLK
A0A3B4C6H5_MCL1-03      -L----------------------------VGQEISSYLLS-DQKDWLLK
A0A3B4C6H5_MCL1-01      -L----------------------------VGQEISSYLLS-DQKDWLLK
Q9Z0F3_BCL2L10-01       ----------------------CCL-----IVNFLYNLLMGRRHRARLEA
E1B9B3_BCL2L10-01       ----------------------CRL-----LVALLCAQFCE-RHRAWLMT
A0A1U7QVA0_BCL2L10      ----------------------CQL-----IVALLCNRLLR-RHRSWLEA
F1RZB9_BCL2L10-01       ----------------------CRL-----LVALLCAQLSG-QHRTWLLA
F1MV39_BCL2L10-01       ----------------------CRL-----LVALLCAQFCE-RHRAWLMA
W5QIG4_BCL2L10-01       ----------------------CRL-----LVALLCAQFCE-RHRAWLMA
Q99M66_BCL2L10-01       ----------------------CYL-----IVSLLYNRLTG-RHRSWLEA
F6ZPD4_BCL2L10-01       ----------------------WPR-----LVDFLCAWLKG-RHRAWLEA
A0A2K6F2Q2_BCL2L10      ----------------------RQR-----LVALLCARLAG-QHRAWLQA
H0WZ06_BCL2L10-01       ----------------------CQR-----LVALLSSRLVG-QHRVWLEA
A0A1U7UZD8_BCL2L10      ----------------------CQR-----LVALLSARLAG-RHRAWLQA
G1T264_BCL2L10-01       ----------------------CQR-----LVALLCARLAG-QHRAWLQA
A0A0D9RG38_BCL2L10      ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
A0A2K5RIU7_BCL2L10      ----------------------RQR-----LVGLLSSRLVG-QHRAWLEA
A0A2K5F974_BCL2L10      ----------------------CQR-----LVALLSSRLVG-QHRAWLEA
A0A2K6TIT7_BCL2L10      ----------------------CQR-----LVGLLSSRLVG-QHRAWLEA
F7CT87_BCL2L10-01       ----------------------CQR-----LVALLSSRLVG-QHRAWLEA
A0A096NM44_BCL2L10      ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
A0A2K6R5T5_BCL2L10      ----------------------CQR-----LVALLSSRLTG-QHRAWLQA
Q9HD36_BCL2L10-02       ----------------------CQR-----LVALLSSRLMG-QHRAWLQA
G1R3W6_BCL2L10-01       ----------------------CQR-----LVALLSSRLVG-QHRAWLQA
A0A2K5K3B0_BCL2L10      ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
A0A2K6M5H5_BCL2L10      ----------------------CQR-----LVALLSSRLTG-QHRAWLQA
A0A2K5TKG9_BCL2L10      ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
F7H6U5_BCL2L10-01       ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
A0A2K6B2D9_BCL2L10      ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
A0A2K5MMZ4_BCL2L10      ----------------------CQR-----LVALLSSRLAG-QHRAWLQA
H2NN92_BCL2L10-01       ----------------------CQR-----LVALLSSRLVG-QHRAWLQA
A0A2R9BCD9_BCL2L10      ----------------------CQR-----LVALLSSRLVG-QHRAWLQA
H2Q9G4_BCL2L10-01       ----------------------CQR-----LVALLSSRLVG-QHRAWLQA
G3QLU6_BCL2L10-01       ----------------------CQR-----LVALLSSRLMG-QHRAWLQA
A0A337RYG8_BCL2L10      ----------------------CQH-----LVALLCNRLTG-RHRAWLEA
G1LKR4_BCL2L10-01       ----------------------CRH-----LVDFLCNRLTG-QHRAWLEA
A0A452QJG0_BCL2L10      ----------------------CRH-----LVDFLCNRLTG-QHRAWLEA
A0A3Q4MN81_BCL2L10      -S--------------------CRR-----LAETIADYLGE-EKKDWLLD
A0A3B4ETX9_BCL2L10      -S--------------------CRR-----LAETIADYLGE-EKKDWLLD
A0A3Q2PJS5_BCL2L10      -S--------------------CRE-----LAETIADYLEK-HKKDWLQE
A0A3Q2GL87_BCL2L10      -S--------------------CRA-----LAETIADYLET-HKKDWLQE
A0A3B5MJ12_BCL2L10      -S--------------------CRA-----LAETIADYLEK-HKKDWLQE
M4AUW7_BCL2L10-01       -S--------------------CRA-----LAETIADYLEK-HKKDWLQE
A0A096ME02_BCL2L10      -S--------------------CRA-----LAETIADYLEK-HKKDWLQE
A0A3B3TYN4_BCL2L10      -S--------------------CRA-----LAETIADYLEK-HKKDWLQE
A0A3B3YT99_BCL2L10      -S--------------------CRA-----LAETIADYLEK-HKKDWLQE
A0A3P9NE65_BCL2L10      -S--------------------CRA-----LAETIADYLEK-HKKDWLQE
A0A3P9IIZ2_BCL2L10      -S--------------------CQA-----LAETVADFLGG-DKKEWMLE
A0A3P9LM07_BCL2L10      -S--------------------CQA-----LAETVADFLGG-DKKEWMLE
H2MBQ3_BCL2L10-01       -S--------------------CQA-----LAETVADFLGG-DKKEWMLE
A0A3B4AAV4_BCL2L10      -D--------------------CRR-----LAQTIADYLGE-EKRDWLLE
A0A3Q3EZT5_BCL2L10      -H--------------------CRG-----LAETIADYLGE-EKKEWLLE
A0A3Q3EZT5_BCL2L10      -H--------------------CRG-----LAETIADYLGE-EKKEWLLE
A0A3Q3JQ78_BCL2L10      -N--------------------CRE-----LAETIADYLGE-EKKDWLLE
A0A3B4TIY6_BCL2L10      -N--------------------CRG-----LAETIADYLGE-EKKDWLLE
A0A3B4WGF4_BCL2L10      -N--------------------CRG-----LAETIADYLGE-EKKDWLLE
A0A3Q3KZW1_BCL2L10      -S--------------------CRG-----LAETIADYLGE-EKKDWLQE
A0A3B5KD08_BCL2L10      -N--------------------CRG-----LAETIADYLGE-EKKDWLLE
A0A3Q3VI28_BCL2L10      -N--------------------CSE-----LAETIADYLGE-EKKAWLLE
A0A3Q1GM98_BCL2L10      -N--------------------CRG-----LAETIADYLGE-EKKDWLLE
A0A3Q1D2L0_BCL2L10      -N--------------------CRE-----LAETIADYLGE-EKKDWLLE
A0A3P8RL82_BCL2L10      -N--------------------CRE-----LAETIADYLGE-EKKDWLLE
A0A3B4ZFS0_BCL2L10      -N--------------------CRG-----LAETIADYLGE-EKKDWLLE
A0A3Q2UUN9_BCL2L10      -S--------------------CRR-----LAETIADYLGE-EKKDWLLD
A0A3P8PVZ8_BCL2L10      -S--------------------CRR-----LAETIADYLGE-EKKDWLLD
A0A3Q2UUN9_BCL2L10      -S--------------------CRR-----LAETIADYLGE-EKKDWLLD
A0A3P9BLI0_BCL2L10      -S--------------------CRR-----LAETIADYLGE-EKKDWLLD
A0A3Q0S9R1_BCL2L10      -S--------------------CRE-----LAETIADYLGE-EKKDWLLD
D2IT42_BCL2L10-02       -S--------------------CRG-----LAETIADYLGE-EKRDWLLE
A0A3B3C5I4_BCL2L10      -S--------------------CQA-----LAETVADFLGG-DKKEWMLE
A0A3Q1IAB0_BCL2L10      -Q--------------------CRG-----LAETIADYLGE-EKKDWLLE
A0A3P8W7K5_BCL2L10      -T--------------------CRE-----LAETIADYLGE-EKKAWLLE
H3AAS7_BCL2L2-02        -L--------------------VGR-----IIDWTVTYVES-SLQDWINH
H3AAS7_BCL2L2-01        -L--------------------VGR-----IIDWTVTYVES-SLQDWINH
G1Q051_BCL2L2-01        -L--------------------VGQ-----VQEWTVAYLEM-RLADWIHS
G3WPT1_BCL2L2-01        -L--------------------VGQ-----EKRYGVHLKQG-ILARYLPS
A0A287D9B3_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A482LX62_BCL2L2-      -L--------------------VGQ-----VQEWMVTYLET-RLADWIHS
W5QDH4_BCL2L2-02        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
Q7TS60_BCL2L2-01        -L--------------------VGQ-----VQDWMVTYLET-RLADWIHS
G1LMC3_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
M3Y5X5_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
G1P3J2_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
G3WPT1_BCL2L2-02        -L--------------------VGQ-----VQDWMVTYLET-QLADWIHS
G1TV33_BCL2L2-01        -L--------------------VGQ-----VQEWMVTYLET-QLAGWIHS
P70345_BCL2L2-01        -L--------------------VGQ-----VQDWMVAYLET-RLADWIHS
O88996_BCL2L2-01        -L--------------------VGQ-----VQDWMVTYLET-RLADWIHS
A0A3Q9B4M8_BCL2L2-      -L--------------------VGQ-----VPEWMVTYLET-RLADWIHS
H0XR82_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A250YBR2_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A250YBR2_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
L8HP19_BCL2L2-02        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
L8HP19_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
Q1RMX3_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A452ECF0_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A286XQQ9_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K5RUN8_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K5MZX9_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A0D9RU30_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K5HEJ9_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A1S3FYD8_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2I2UAE3_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2I2YPX6_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A287D9B3_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K5V0Q3_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
F7G4L5_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6EA59_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6AI25_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A1U7RC37_BCL2L2-      -L--------------------VGQ-----VQDWMVTYLET-RLADWIHS
A0A2I3GEA7_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2R9A2Q3_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
H2Q805_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A096NX09_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6GWM6_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6ME72_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6RW35_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6RW35_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K6TM77_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A287ATE4_BCL2L2-      -L--------------------VGQ-----VQEWMVTYLET-RLADWIHS
A0A1U7UJF2_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A452SHI1_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
Q05KI8_BCL2L2-01        -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
Q2TAP5_BCL2L1-01        -L--------------------LPR-----IVQWMVNYLEH-TLQPWMQE
Q91828_BCL2L1-01        -L--------------------LPR-----IVQWMVNYLEH-TLQPWMQE
I7GKS6_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5EBP4_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5Q6R6_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K6UWY8_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
Q5XGJ4_BCL2L2-01        -L--------------------LPR-----IQDWMVTYLET-NLRDWIQS
F7G6M3_BCL2L2-01        -L--------------------VGQ-----VQDWMVAYLDT-QLADWIRS
A0A2K5CWY6_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
A0A2K5CWY6_BCL2L2-      -L--------------------VGQ-----VQEWMVAYLET-RLADWIHS
G3TMU7_BCL2L2-01        -L--------------------VGQ-----VQEWMVVYLET-RLADWIHS
A0A2K5M8B1_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5H963_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A2K5VPG2_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5YR37_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2R8Z9D7_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A096NV05_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K6QFA2_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A1U7T4L4_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQD
A0A2K6G3C5_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A3Q1LRT3_BCL2L1-      -L--------------------VSQ-----VTTSTATYLNN-HLKPWIQE
H9GHK7_BCL2L1-01        -L--------------------VVR-----IASWMTTYLTE-HLDPWIQE
Q07816_BCL2L1-04        -M--------------------APHRGDRGRSASAGIPAEP-QVTPWLCP
A0A493TIA6_BCL2L1-      -L--------------------VGR-----IVAWMTTYLSD-HLDPWIQE
Q07816_BCL2L1-02        -L--------------------VGR-----IVSWMTTYLTD-HLDPWIQE
Q07816_BCL2L1-03        -L--------------------VGR-----IVSWMTTYLTD-HLDPWIQE
Q07816_BCL2L1-01        -L--------------------VGR-----IVSWMTTYLTD-HLDPWIQE
G1N5N5_BCL2L1-01        -L--------------------VGR-----IVSWMTTYLTD-HLDPWIQE
A0A452ILL8_BCL2L1-      -L--------------------VGR-----IVSWMTTYLTD-HLDPWIQE
A0A452ILL8_BCL2L1-      -L--------------------VGR-----IVSWMTTYLTD-HLDPWIQE
K7F655_BCL2L1-01        -L--------------------VGR-----IASWMTTYLTD-HLDPWIQE
A0A452E1B1_BCL2L1-      -L--------------------VSQ-----VTTWMATYLNN-HLEPWIQE
W5PSA5_BCL2L1-01        -L--------------------VSQ-----VTTWMATYLND-HLEPWIQE
P53563_BCL2L1-03        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
P53563_BCL2L1-02        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
A0A287CZ07_BCL2L1-      -L--------------------VSR-----IASWM----------PWIQE
F6WA14_BCL2L1-01        -L--------------------VGR-----ITSWMATYLDD-HLDPWIQE
G3WKX6_BCL2L1-01        -L--------------------VAR-----ITSWMATYLDE-HLDPWIQE
M3XA94_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
M3XA94_BCL2L1-02        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A3Q2H0F6_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
H0X6V2_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
G3SPN0_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q2PFS6_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
O35843_BCL2L1-01        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
M3XA94_BCL2L1-03        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
G1RER8_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A1S2ZQT6_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q64373_BCL2L1-09        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
Q64373_BCL2L1-01        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
P53563_BCL2L1-01        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
O77737_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q9MYW4_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A3Q2H0F6_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
L8J061_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q05KJ0_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q05KJ0_BCL2L1-02        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
E2IV76_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A2K6G3C5_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
B2Z3Z4_BCL2L1-01        -L--------------------VSR-----IASWMATYLND-HLEPWIQD
G3HEA7_BCL2L1-01        -L--------------------VSR-----IASWMATYLND-HLEPWIQD
G3HEA7_BCL2L1-02        -L--------------------VSR-----IASWMATYLND-HLEPWIQD
A0A1U7T4L4_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQD
M3Z2H9_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A1U7QU73_BCL2L1-      -L--------------------VSR-----IASWMATYLND-HLEPWIQD
A0A0D9RJZ8_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A286Y5D6_BCL2L1-      -L--------------------VRR-----IASWMATYLND-HLEPWIQD
A0A250YD48_BCL2L1-      -L--------------------VSR-----IASWMATYLND-HLEPWIQE
A0A1L5BWY3_BCL2L1-      -L--------------------VSR-----IASWMATYLND-HLEPWIQE
I3MUP5_BCL2L1-02        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
I3MUP5_BCL2L1-03        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
I3MUP5_BCL2L1-01        -L--------------------VSR-----IASWMATYLND-HLEPWIQE
G1P9D2_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A2K5EBP4_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
E2IV75_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
F7IT34_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
Q76LT7_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5Q6R6_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5Q6R6_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5M8B1_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5H963_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q8SQ42_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5VPG2_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K5YR37_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2R8Z9D7_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A096NV05_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2J8VIH3_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K6QFA2_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K6QFA2_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A2K6UWY8_BCL2L1-      -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
E2IV77_BCL2L1-01        -L--------------------VSR-----IAAWMATYLND-HLEPWIQE
A0A452SDS4_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A384D3U1_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A452FWV3_BCL2L1-      -L--------------------VSR-----IATWMATYLND-HLEPWIQE
Q9MZS7_BCL2L1-01        -L--------------------VSR-----IATWMATYLND-HLEPWIQE
A0A3B3E2W4_BCL2L1-      -L--------------------VSR-----IAEWMTMYLDE-QISPWIHS
A0A3B3I2Q5_BCL2L1-      -L--------------------VSR-----IAEWMTQYLDE-QISPWIHS
A0A3P9I2N4_BCL2L1-      -L--------------------VSR-----IAEWMTQYLDE-QISPWIHS
A0A3P9MKK4_BCL2L1-      -L--------------------VSR-----IAEWMTQYLDE-QISPWIHS
A0A3B5B4X7_BCL2L1-      -L--------------------VPR-----IADWMTMYLDE-HISLWIQS
A0A3B4BFZ8_BCL2L1-      -L--------------------VPR-----IANWMTIYLDE-NIATWIQN
A0A3Q3FUB6_BCL2L1-      -L--------------------VSR-----IAGWMTTYLDE-HISAWIES
A0A3B5MGS2_BCL2L1-      -L--------------------VSR-----IAEWMTTYLDE-QLSPWIQS
M4A558_BCL2L1-01        -L--------------------VSR-----IAEWMTTYLDE-QLSPWIQS
A0A3P9QFB3_BCL2L1-      -L--------------------VSR-----IAEWMTTYLDE-QLNPWIQS
A0A087YBW4_BCL2L1-      -L--------------------VSR-----IAEWMTTYLDE-QLNPWIQS
A0A3B3VWI7_BCL2L1-      -L--------------------VSR-----IAEWMTTYLDE-QLNPWIQS
A0A3B3XN57_BCL2L1-      -L--------------------VSR-----IAEWMTTYLDE-QLNPWIQS
A0A3Q2C6K4_BCL2L1-      -L--------------------VSR-----IADWMTIYLDE-QLNPWIHS
A0A3Q2NRP4_BCL2L1-      -L--------------------VPR-----IADWMTIYLDE-QLDPWVRS
A0A0B4KJI5_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HINPWIES
A0A3Q1JZ46_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HISPWIQS
A0A3Q1JZ46_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HISPWIQS
A0A3Q3NFM4_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HISPWIES
A0A3Q3NFM4_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HISPWIES
A0A3B4V9K8_BCL2L1-      -L--------------------VSR-----ITDWMTMYLDE-HISPWIQS
A0A3B4XS24_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HISPWIQS
A0A2U9BY16_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-NIQPWIQS
C1BLI0_BCL2L1-01        -L--------------------VAR-----IADWMTTYLDN-HIQPWIQR
C0HAD8_BCL2L1-01        -L--------------------VAR-----IADWMTTYLDN-HIQPWIQS
A0A3B3ZMX9_BCL2L1-      -L--------------------VAR-----IVTWMTVYLDE-HIQDWIDS
A0A3B3TFR4_BCL2L1-      -L--------------------VGH-----IVDWMTVYLDN-HIQPWIQT
H3CH49_BCL2L1-01        -L--------------------VGR-----IIEWMTVYLDN-HIQPWIQS
A0A3Q2FR43_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDE-QIDPWIQS
A0A3P8XYL5_BCL2L1-      -L--------------------VGR-----IADWMTVYLDN-HIQPWIES
Q90Z98_BCL2L1-02        -L--------------------VGR-----IAEWMTVYLDN-HIQPWIQS
Q90Z98_BCL2L1-01        -L--------------------VGR-----IAEWMTVYLDN-HIQPWIQS
A0A059PJI5_BCL2L1-      -L--------------------VAR-----IAEWMTVYLDN-HIQPWIEE
A0A3B4DTL9_BCL2L1-      -L--------------------VGR-----IAEWMTVYLDN-HIQPWIQE
B5XAY3_BCL2L1-01        -L--------------------VGR-----ITDWMTVYLDN-HIQPWIQS
W5MG74_BCL2L1-01        -L--------------------VSR-----IAEWMTVYLDN-NIQPWIQS
A0A3Q3B3X5_BCL2L1-      -L--------------------VAR-----IVEWMTVYLDN-HIQPWIQS
A0A3B3IB64_BCL2L1-      -L--------------------VDR-----IVEWMTVYLDN-HIQPWIQS
A0A3P9JYH1_BCL2L1-      -L--------------------VDR-----IVEWMTVYLDN-HIQPWIQS
A0A3B3DHA1_BCL2L1-      -L--------------------VDR-----IVEWMTVYLDN-HIQPWIQS
A0A3Q0RTF8_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
I3IZK7_BCL2L1-01        -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A2U9BY16_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-NIQPWIQS
A0A2U9BY16_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-NIQPWIQS
A0A2U9BY16_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-NIQPWIQS
A0A0D6DR75_BCL2L1-      -L--------------------VVR-----IVEWMTVYLDD-HIQPWIQS
A0A3Q3WIW8_BCL2L1-      -L--------------------VGR-----IIEWMTVYLDN-QIQPWIES
A0A219P0Y3_BCL2L1-      -L--------------------VGR-----IIEWKTRYLDN-HIQPWIQS
A0A3Q3MX20_BCL2L1-      -L--------------------VGR-----IVEWMTLYLDN-HIEPWIQS
A0A3Q3G2E1_BCL2L1-      -L--------------------VGR-----IIEWMTVYLDN-RIQPWIES
A0A3Q3G2E1_BCL2L1-      -L--------------------VGR-----IIEWMTVYLDN-RIQPWIES
A0A3Q3G2E1_BCL2L1-      -L--------------------VGR-----IIEWMTVYLDN-RIQPWIES
A0A3Q1GZ93_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3Q1GZ93_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3Q1GZ93_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3B4V3T1_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-RIQPWIQS
A0A3B4XU17_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-RIQPWIQS
H3ANS8_BCL2L1-01        -L--------------------VER-----IAEWMTTYLDD-NLNPWIQE
A0A452FHY1_BCL2L1-      -L--------------------VSQ-----VMTWMASQLND-HLEPWIQE
A0A452FHY1_BCL2L1-      -L--------------------VSQ-----VMTWMASQLND-HLEPWIQE
A0A1S3EPX7_BCL2L1-      -L--------------------VSR-----IASWMATYLND-HLEPWIQE
A0A218USB3_BCL2L1-      -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
A0A218USB3_BCL2L1-      -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
U3JSL7_BCL2L1-01        -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
A0A218USB3_BCL2L1-      -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
A0A218USB3_BCL2L1-      -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
H0Z8G3_BCL2L1-01        -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
Q4U2V6_BCL2L1-01        -L--------------------VKR-----IVSWMTTYLTD-HLDPWIQE
R4JQR8_BCL2L1-01        -L--------------------VDS-----IVDWVSTYLCN-SLEQWITD
A0A346RRN1_BCL2L1-      -L--------------------VDS-----IVDWVSVYLCD-NLEPWITS
Q568V1_MCL1-01          -C--------------------VER-----VAEQISSYLTS-EQQDWILK
Q1L8X3_MCL1-01          -C--------------------VER-----VAEQISSYLTS-EQQDWILK
Q9I9N3_MCL1-01          -C--------------------VER-----VAEQISSYLTS-EQQDWILK
A0A286XUI2_BCL2A1-      -D--------------------VDT--YKEISYFVAEFIMS-RMGGWIRQ
A0A452U285_BCL2A1-      -D--------------------VDA--SR-ISYFVAEFITT-NMREWIRQ
A0A452U285_BCL2A1-      -D--------------------VDA--SR-ISYFVAEFITT-NMREWIRQ
A0A3B3R4U0_MCL1-01      -C--------------------VDD-----VASRISCYLLE-HQRDWLNR
F7CP56_BCL2A1-03        ----------------------LGR-----GKGYYDTYLKR-CLQH--QE
A0A3P8V8T6_MCL1-01      -T--------------------VDQ-----VGQEIASYLLS-YQKDWLLK
A0A3P8YNB4_BCL2-01      -Q--------------------VDH-----IAGWMTEYLNG-PLHSWIQE
A0A3P8WUE9_BCL2-01      -Q--------------------VEQ-----VVDWMTEYLNG-PLNIWIKE
A0A3B4A3G8_BCL2-01      -Q--------------------VDN-----IADWMTEYLNG-TLSSWIQD
A0A3Q3G1D7_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3Q2XQX2_BCL2-02      -Q--------------------VDN-----IAEWMTEYLNG-PLGSWIQD
A0A3Q2XQX2_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLGSWIQD
A0A3Q3B0R2_BCL2-01      -Q--------------------VDH-----IAEWMTEYLNG-PLNSWIED
A0A3Q2PN77_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLGSWIQD
A0A3P9J8Y9_BCL2-01      -Q--------------------VAS-----IAEWMTEYLNG-PLNSWIEE
A0A3Q0S5Z7_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3P8QVM8_BCL2-01      -Q--------------------VDN-----IADWMTEYLNG-PLNSWIQD
A0A3P9DIG5_BCL2-01      -Q--------------------VDN-----IADWMTEYLNG-PLNSWIQD
A0A3Q2UYW8_BCL2-01      -Q--------------------VDN-----IADWMTEYLNG-PLNSWIQD
A0A3B4G3K4_BCL2-01      -Q--------------------VDN-----IADWMTEYLNG-PLNSWIQD
A0A2U9BJ09_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIMD
A0A3Q1I5N1_BCL2-01      -Q--------------------VNN-----IAEWMTEYLNG-PLHSWIQD
A0A3Q3K1K1_BCL2-01      -Q--------------------VDK-----IAEWMTEYLNG-PLNSWIQE
A0A3Q3MEY1_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A1X9JZA1_BCL2-01      -Q--------------------VNN-----IAEWMTEYLNG-PLNSWIQD
A0A4D6FTA2_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3Q1FLK7_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3Q1B8C3_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3P8S9L3_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3B5BBQ0_BCL2-01      -Q--------------------VDN-----IAEWMTEYLNG-PLNSWIQD
A0A3B4TX71_BCL2-01      -Q--------------------VDN-----IVEWMTEYLNG-PLNSWIKD
A0A3B4YAG2_BCL2-01      -Q--------------------VDN-----IVEWMTEYLNG-PLNSWIKD
G1TW27_BCL2-02          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
E2RS00_BCL2A1-02        -D------------------VDAEK-----VSYFVAEFITR-NMRDWIRQ
A0A3B3TCS4_BCL2-01      -Q--------------------VDN-----IAHWMTEYLNG-PLHNWIQE
A0A0U3DHY6_BCL2-01      -Q--------------------VDN-----IALWMTEYLNG-PLQNWIQE
A0A3P9AAB2_BCL2-01      -Q--------------------VNN-----IVHWMTEYLNG-PLQNWIQE
X4ZGI8_BCL2-01          -Q--------------------VDN-----IAHWMTDYLNG-PLENWIEE
A0A3P9MKK4_BCL2L1-      -L--------------------VSR-----IAEWMTQYLDE-QISPWIHS
A0A3B3I2Q5_BCL2L1-      -L--------------------VSR-----IAEWMTQYLDE-QISPWIHS
A0A3P9I2N4_BCL2L1-      -L--------------------VSR-----IAEWMTQYLDE-QISPWIHS
A0A3B4AFB7_MCL1-01      -C--------------------VER-----VGQEISSYLLL-DQRDWLVR
G3TVG9_MCL1-01          -I-------------------NQEA-----AAECITDVLLR-KRYCLDKR
B9ZYL7_BCL2-01          -L--------------------VDS-----IVGWMTEYLNR-HLQNWIQE
A0A3L7HT14_BCL2A1-      -D-----------------VGAYKQ-----VSNFVAEFIMN-NTAEWIRQ
F6YNL8_BCL2-01          -L--------------------VDS-----IALWMTEYLNR-HLHTWIQD
A0A218UQA0_BCL2-01      -L--------------------VDN-----IATWMTEYLNR-HLHNWIQD
Q00709_BCL2-01          -L--------------------VDN-----IATWMTEYLNR-HLHNWIQD
A0A493T1X3_BCL2-01      -L--------------------VDS-----IAAWMTEYLNR-HLHNWIQD
U3KEW4_BCL2-01          -L--------------------VDS-----IAAWMTEYLNR-HLHNWIQD
G3WZW9_BCL2-01          -L--------------------VDS-----IALWMTEYLNR-HLHNWIQD
M3YYK3_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
M3X1R9_BCL2-02          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K6R2I5_BCL2-02      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2R9APW6_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
G3SLZ1_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
Q75SV7_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
M3X1R9_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
Q8I008_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A076FU27_BCL2-01      -L--------------------VDS-----IALWMTEYLNR-HLHAWIQD
A0A4P8GLJ2_BCL2-01      -L--------------------VDS-----IALWMTEYLNR-HLHTWIQD
F6R2C4_BCL2-01          -L--------------------VDS-----IALWMTEYLNR-HLHTWIQD
O02718_BCL2-01          -L--------------------VDS-----IALWMTEYLNR-HLHTWIQD
A0A076FZV9_BCL2-01      -L--------------------VDS-----IALWMTEYLNR-HLHAWIQD
A0A452EV13_BCL2-01      -L--------------------VDS-----IALWMTEYLNR-HLHAWIQD
A0A250YD83_BCL2-01      -L--------------------VDN-----IALWMIEYLNR-HLHTWIQD
A9QXG9_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K5NZS5_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A0D9S017_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K6CIX3_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K5XRD4_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K6KHG1_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K6R2I5_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K5HK49_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
G3QES9_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
H2QEM8_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2I3GZF9_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K6UEL3_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
E2QWA1_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
G1LIC9_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A452R110_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A452R110_BCL2-02      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
G3WZW9_BCL2-02          -L--------------------VDS-----IALWMTEYLNR-HLHNWIQD
G3SLZ1_BCL2-02          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A452T603_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
M3Y8D1_BCL2L10-01       -LGPDPELELELGEWEASVRQDCRR-----LVDFLCGRLTG-QHRAWLEA
A0A3Q2Y539_MCL1-01      -C--------------------VEL-----VAQEVSTYLLS-HQRTWLVQ
A0A3Q3BEB7_BCL2L1-      -L--------------------VSR-----IADWMTVYLDE-QIGPWIDS
A0A3P8VMA1_BCL2L1-      -L--------------------VPR-----IADWMTMYLDE-YIDPWIQS
A0A345BSW9_BCL2L1-      -L--------------------VGR-----IAEWMTVYLDN-HIQPWIQS
A0A286MU87_BCL2L1-      -L--------------------VAR-----IADWMTTYLDN-HIQPWIQS
A0A3P8XFS0_BCL2L1-      -L--------------------VAR-----IADWMTTYLDE-HIQPWIQI
A0A3P8XFS0_BCL2L1-      -L--------------------VAR-----IADWMTTYLDE-HIQPWIQI
A0A0F7L1T6_BCL2L1-      -L--------------------VCR-----IADWMTIYLDE-HINPWIQS
H2U5I3_BCL2L1-01        -L--------------------VCR-----IADWMTIYLDE-HINPWIQS
A0A3Q3J5K3_BCL2L1-      -L--------------------VSR-----IADWMTMYLDE-HISPWIQN
A0A3Q1EVP6_BCL2L1-      -L--------------------VPR-----IADWMTMYLDE-HISPWIQS
A0A3Q1BQA0_BCL2L1-      -L--------------------VPR-----IADWMTMYLDE-HISPWIQS
A0A3P8U812_BCL2L1-      -L--------------------VPR-----IADWMTMYLDE-HISPWIQS
E6ZFR0_BCL2L1-01        -L--------------------VSR-----IADWMTMYLDE-HISPWIQS
G3P7B4_BCL2L1-01        -L--------------------VSR-----IADWMTTYLDE-HISAWIQS
A0A3Q3X5M5_BCL2L1-      -L--------------------VCR-----IADWMTTYLDE-HINPWIQS
A0A2U9BIG9_BCL2L1-      -L--------------------VAR-----IADWMTMYLDE-HISPWIQS
D2ITA2_BCL2L1-02        -M--------------------VPR-----VAEWMTRYLDD-HIDHWIQS
A0A3B3ZMX9_BCL2L1-      -L--------------------VAR-----IVTWMTVYLDE-HIQDWIDS
G3NJY1_BCL2L1-01        -L--------------------VGR-----IVEWMTLYLDN-HIQPWIQN
A0A2U9BY16_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-NIQPWIQS
A0A3Q3DUT7_BCL2L1-      -L--------------------VDR-----IIEWMTVYLDN-HLQPWIES
A0A3Q3DUT7_BCL2L1-      -L--------------------VDR-----IIEWMTVYLDN-HLQPWIES
A0A3Q3DUT7_BCL2L1-      -L--------------------VDR-----IIEWMTVYLDN-HLQPWIES
A0A3B1JJ42_BCL2L1-      -L--------------------VGR-----IAEWMTVYLDN-HIQPWIQE
A0A3P8UWG7_BCL2L1-      -L--------------------VAR-----IADWMTVYLDN-HIQPWIET
A0A3Q3IVF5_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQG
A0A3Q1DHJ3_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
A0A3Q1DHJ3_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
A0A3Q1DHJ3_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
A0A3P8TL99_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
A0A3P8TL99_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
A0A3Q1FR00_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQG
A0A3B4Z3X2_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
A0A3B4Z3X2_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQDWIQS
C3VIT1_BCL2L1-01        -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3P8P0F1_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3Q2X557_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3P9D632_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3P9D632_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3Q4N4B5_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3B4FNX1_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDN-HIQPWIQS
A0A3Q2QPL9_BCL2L1-      -L--------------------VGR-----IVEWMTVYLDE-QIDPWIQS
A0A3B5PQJ0_BCL2L1-      -L--------------------VAR-----IVEWMTVYLDE-QIEPWVES
A0A087X9B7_BCL2L1-      -L--------------------VAR-----IVEWMTVYLDE-RIEPWVES
A0A3B3TUS7_BCL2L1-      -L--------------------VAR-----IVEWMTVYLDE-RIEPWVES
A0A3B3WI27_BCL2L1-      -L--------------------VAR-----IVEWMTVYLDE-RIEPWVES
A0A3P9N9Y4_BCL2L1-      -L--------------------VAR-----IVEWMTVYLDE-RIEPWVES
A0A3B3QRZ2_BCL2L1-      -L--------------------VDR-----IADWMTVYLDS-NIQPWIQR
Q564A4_BCL2-01          -Q--------------------VDN-----IAHWMTDYLNG-PLENWIEE
H9GPE7_BCL2-01          -L--------------------VDN-----IATWMTEYLNQ-YLRNWIQE
A0A452I9V7_BCL2-01      -L--------------------VDS-----IAVWMTEYLNR-HLHNWIQD
W5N4F7_BCL2-01          -Q--------------------VDN-----IANWMTEYLNG-PLQNWIQE
K7F5Y3_BCL2-02          -L--------------------VDS-----IAVWMTEYLNR-HLHNWIQD
A0A3Q2HRY3_BCL2-02      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
K7F5Y3_BCL2-01          -L--------------------VDS-----IAVWMTEYLNR-HLHNWIQD
F1LNV0_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
P49950_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
G1TW27_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K5EB04_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2R8MY14_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
H2NWH5_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A096MPU7_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K5PP81_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
H0WKI0_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K5UDI5_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
P10417_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
Q7TSN8_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A3Q2HRY3_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
E2QWA1_BCL2-02          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
A0A2K6G3I7_BCL2-01      -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
Q6R755_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
Q9JJV8_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
Q923R6_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
H0W1T3_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
G1LIC9_BCL2-02          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
I3MVK9_BCL2-01          -L--------------------VDN-----IALWMTEYLNR-HLHTWIQD
                                                                          

P70345_BCL2L2-02        -SGGW---------------------------------------------
G1MZW1_BCL2-01          -NGGW---D-----------------------------------------
A2BF68_MCL1-02          -NKAW---D-----------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
F7CP56_BCL2A1-02        -NGGW---------------------------------------------
F7CP56_BCL2A1-01        -NGGW---------------------------------------------
H0ZCL9_BCL2A1-01        -NGGW---------------------------------------------
U3JTB2_BCL2A1-01        -NGGW---------------------------------------------
A0A218V8Z6_BCL2A1-      -NGGW---------------------------------------------
Q9W6F2_BCL2A1-01        -NGGW---------------------------------------------
A0A493SSZ7_BCL2A1-      -NGGW---------------------------------------------
G1N8C5_BCL2A1-01        -NGGW---------------------------------------------
A0A452J3N6_BCL2A1-      -NGGW---------------------------------------------
K7G130_BCL2A1-01        -NGGW---------------------------------------------
A0A2K5PYQ3_BCL2A1-      -NGGW---------------------------------------------
A0A2K5PYQ3_BCL2A1-      -NGGW---------------------------------------------
F6SFL4_BCL2A1-01        -NGGW---------------------------------------------
G3WSP8_BCL2A1-01        -NGGW---------------------------------------------
F6S8G3_BCL2A1-01        -NGGW---------------------------------------------
O55178_BCL2A1-01        -HNE----------------------------------------------
Q0P538_BCL2A1-01        -HHE----------------------------------------------
G3V977_BCL2A1-01        -NGGW---------------------------------------------
Q925A9_BCL2A1-01        -NGGW---------------------------------------------
Q07440_BCL2A1-01        -NGGW---------------------------------------------
O55179_BCL2A1-01        -NGGW---------------------------------------------
O55177_BCL2A1-02        -NGGW---------------------------------------------
Q497M6_BCL2A1-01        -NGGW---------------------------------------------
Q8K164_BCL2A1-01        -NGGW---------------------------------------------
Q4FK02_BCL2A1-01        -NGGW---------------------------------------------
A0A452SIR9_BCL2A1-      -NGGW---------------------------------------------
M3YVH4_BCL2A1-01        -NGGW---------------------------------------------
U6CQS8_BCL2A1-01        -NGGW---------------------------------------------
I3MCZ7_BCL2A1-01        -NGGW---------------------------------------------
G3T8E6_BCL2A1-01        -NGGW---------------------------------------------
H0WZ23_BCL2A1-01        -NGGW---------------------------------------------
A0A2K6TLJ5_BCL2A1-      -NGGW---------------------------------------------
A0A2K5D2I1_BCL2A1-      -NGGW---------------------------------------------
B4E1X9_BCL2A1-01        -NGGW---------------------------------------------
A0A2I2YML2_BCL2A1-      -NGGW---------------------------------------------
A0A2R8ZJX9_BCL2A1-      -NGGW---------------------------------------------
A0A2I3HBP6_BCL2A1-      -NGGW---------------------------------------------
A0A2K6PHF2_BCL2A1-      -NGGW---------------------------------------------
A0A2K6LV19_BCL2A1-      -NGGW---------------------------------------------
A0A2K5TMD1_BCL2A1-      -NGGW---------------------------------------------
A0A2K5KAA3_BCL2A1-      -NGGW---------------------------------------------
A0A2K6DS18_BCL2A1-      -NGGW---------------------------------------------
A0A096NMX5_BCL2A1-      -NGGW---------------------------------------------
A0A2K6AD27_BCL2A1-      -NGGW---------------------------------------------
F7HXW0_BCL2A1-01        -NGGW---------------------------------------------
A0A2K6TLJ5_BCL2A1-      -NGGW---------------------------------------------
A0A2I3HBP6_BCL2A1-      -NGGW---------------------------------------------
A0A2K6EKG1_BCL2A1-      -NGGW---------------------------------------------
A0A452EK63_BCL2A1-      -NGGW---------------------------------------------
W5Q0N6_BCL2A1-01        -NGGW---------------------------------------------
L8IZT5_BCL2A1-01        -NGGW---------------------------------------------
Q3C2I0_BCL2A1-01        -NGGW---------------------------------------------
F7CP56_BCL2A1-04        -NGGW---------------------------------------------
C7F841_BCL2A1-01        -NGGW---------------------------------------------
A0A2K5D2I1_BCL2A1-      -NGGW---------------------------------------------
H2NNZ9_BCL2A1-01        -NGGW---------------------------------------------
A0A2I2YML2_BCL2A1-      -NGGW---------------------------------------------
A0A2K6LV19_BCL2A1-      -NGGW---------------------------------------------
A0A2K6PHF2_BCL2A1-      -NGGW---------------------------------------------
A0A2K5KHH8_BCL2A1-      -NGGW---------------------------------------------
A0A2K5KHH8_BCL2A1-      -NGGW---------------------------------------------
A0A2K5KAA3_BCL2A1-      -NGGW---------------------------------------------
A0A2K5TMD1_BCL2A1-      -NGGW---------------------------------------------
F7E8V5_BCL2A1-01        -NGGW---------------------------------------------
A0A2K6DS18_BCL2A1-      -NGGW---------------------------------------------
A0A2K6AD27_BCL2A1-      -NGGW---------------------------------------------
A0A096NMX5_BCL2A1-      -NGGW---------------------------------------------
A0A0D9RRC3_BCL2A1-      -NGGW---------------------------------------------
Q16548_BCL2A1-01        -NGGW---------------------------------------------
A0A2R8ZJX9_BCL2A1-      -NGGW---------------------------------------------
G1QEX2_BCL2L10-01       -QGGW---D-----------------------------------------
A0A3Q1FR00_BCL2L1-      -QGGW---E-----------------------------------------
F6VJQ0_BCL2L10-01       -NGGW---T-----------------------------------------
H3AR18_MCL1-01          -NQGW---K-----------------------------------------
J7H260_MCL1-01          -HNGW---D-----------------------------------------
G1PZ39_MCL1-01          -NTCHGFKD-----------------------------------------
Q95KR3_MCL1-01          -QRGW---D-----------------------------------------
A0A2K5EPX0_MCL1-02      -QRGW---D-----------------------------------------
A0A2K5EPX0_MCL1-01      -QRGW---D-----------------------------------------
Q9Z1P3_MCL1-01          -QRGW---D-----------------------------------------
A5PJR2_MCL1-01          -QRGW---D-----------------------------------------
A0A452GA25_MCL1-01      -QRGW---D-----------------------------------------
G1L3L7_MCL1-01          -QRGW---D-----------------------------------------
G1T2Q0_MCL1-01          -QRGW---D-----------------------------------------
F7AVA6_MCL1-01          -QRGW---D-----------------------------------------
A0A337S3J9_MCL1-01      -QRGW---D-----------------------------------------
A0A337S3J9_MCL1-03      -QRGW---D-----------------------------------------
Q7YRZ9_MCL1-01          -QRGW---D-----------------------------------------
F1PAP1_MCL1-01          -QRGW---D-----------------------------------------
Q8HYS5_MCL1-01          -QRGW---D-----------------------------------------
M3XZZ5_MCL1-01          -QRGW---D-----------------------------------------
A0A452RHX5_MCL1-01      -QRGW---D-----------------------------------------
H0XFB7_MCL1-01          -QRGW---D-----------------------------------------
F7GTF7_MCL1-01          -QRGW---D-----------------------------------------
A0A2K5CFH3_MCL1-01      -QRGW---D-----------------------------------------
A0A2K6V5Y3_MCL1-01      -QRGW---D-----------------------------------------
A0A2K6KRW9_MCL1-01      -QRGW---D-----------------------------------------
A0A2K5XSB2_MCL1-01      -QRGW---D-----------------------------------------
A0A0D9RZP5_MCL1-01      -QRGW---D-----------------------------------------
I7G687_MCL1-01          -QRGW---D-----------------------------------------
A0A2K5LXU8_MCL1-01      -QRGW---D-----------------------------------------
A0A2I3GJZ3_MCL1-02      -QRGW---D-----------------------------------------
H2N5Y9_MCL1-01          -QRGW---D-----------------------------------------
A0A2R9BPJ5_MCL1-01      -QRGW---D-----------------------------------------
A0A2I3RTV4_MCL1-01      -QRGW---D-----------------------------------------
A0A2I2YQH7_MCL1-01      -QRGW---D-----------------------------------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K6GI15_MCL1-01      --------------------------------------------------
A0A2I3GJZ3_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5W0W9_MCL1-01      --------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
G3WBC5_MCL1-01          -QKGW---E-----------------------------------------
W5QI41_MCL1-01          -QRGW---D-----------------------------------------
F1MQX4_MCL1-01          -ERGW---D-----------------------------------------
B4DLY8_MCL1-01          -QRGW---D-----------------------------------------
B4DG83_MCL1-01          -QRGW---D-----------------------------------------
B4E3L8_MCL1-01          -QRGW---D-----------------------------------------
A0A2K5DMS4_MCL1-01      -YSRW---D-----------------------------------------
U3KKY6_MCL1-01          -QGGW---------------------------------------------
G1MPY7_MCL1-01          -QGGW---E-----------------------------------------
K7FPN7_MCL1-01          -QRGW---E-----------------------------------------
H3AR18_MCL1-02          -NQGW---K-----------------------------------------
E2RS00_BCL2A1-01        -NGGW---ENGFVKKFEPKS------------------------------
B6V6J0_MCL1-01          -EKGW---D-----------------------------------------
A0A3L7HT14_BCL2A1-      -NGGW---V-----------------------------------------
H0XHA5_MCL1-01          -QRGW---D-----------------------------------------
A0A2I2YPX6_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6TM77_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K5RUN8_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6GWM6_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
W5QDH4_BCL2L2-01        -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6ME72_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6RW35_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A287ATE4_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2R8M4C0_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K5MZX9_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K5HEJ9_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K5V0Q3_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
F7G4L5_BCL2L2-02        -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6EA59_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6AI25_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A1U7RC37_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2I3GEA7_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2R9A2Q3_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
H2Q805_BCL2L2-02        -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A096NX09_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A287ATE4_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A4D6NWN1_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A1U7UJF2_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A452UF16_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A452UF16_BCL2L2-      -SGGW---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
A0A2K6F6N9_MCL1-01      --------------------------------------------------
G1QAV8_MCL1-01          -QRGW---D-----------------------------------------
H9GEA6_MCL1-01          -HNAW---H-----------------------------------------
H9GEA6_MCL1-02          -HNAW---E-----------------------------------------
A0A493U0E8_MCL1-01      -QGGW---E-----------------------------------------
A0A1L1RNM6_MCL1-01      -QGGW---E-----------------------------------------
A0A1L1RNM6_MCL1-02      -QGGW---E-----------------------------------------
G2HFR3_MCL1-01          -QRGW---D-----------------------------------------
F6ZMX1_MCL1-01          -QKGW---K-----------------------------------------
F6ZMX1_MCL1-02          -QKGW---S-----------------------------------------
F6ZMX1_MCL1-03          -QKGW---E-----------------------------------------
G1T2Q0_MCL1-02          -QRGW---D-----------------------------------------
F1PAP1_MCL1-02          -QRGW---D-----------------------------------------
A0A337S3J9_MCL1-04      -QRGW---D-----------------------------------------
F7AVA6_MCL1-02          -QRGW---D-----------------------------------------
A0A2K6GI15_MCL1-03      -QRGW---D-----------------------------------------
C8YZ26_MCL1-01          -QRGW---D-----------------------------------------
F7GTF7_MCL1-02          -QRGW---D-----------------------------------------
A0A2K5R5E2_MCL1-04      -QRGW---D-----------------------------------------
A0A2K6V5Y3_MCL1-03      -QRGW---D-----------------------------------------
A0A2K5LXU8_MCL1-03      -QRGW---D-----------------------------------------
A0A2K5I9I0_MCL1-03      -QRGW---D-----------------------------------------
A0A2I2YQH7_MCL1-03      -QRGW---D-----------------------------------------
Q07820_MCL1-04          -QRGW---D-----------------------------------------
A0A2K5W0W9_MCL1-03      -QRGW---D-----------------------------------------
A0A2K6ECR0_MCL1-03      -QRGW---D-----------------------------------------
A0A2K5XSB2_MCL1-03      -QRGW---D-----------------------------------------
A0A2R9BPJ5_MCL1-03      -QRGW---D-----------------------------------------
A0A2I3RTV4_MCL1-03      -QRGW---D-----------------------------------------
A0A2I3LFM0_MCL1-03      -QRGW---D-----------------------------------------
A0A2K6PPI3_MCL1-03      -QRGW---D-----------------------------------------
A0A286Y1M5_MCL1-01      -QRGW---D-----------------------------------------
P97287_MCL1-01          -QRGW---D-----------------------------------------
A0A452GA25_MCL1-02      -QRGW---D-----------------------------------------
G3T756_MCL1-01          -QRGW---D-----------------------------------------
A0A1S3F3I1_MCL1-01      -QRGW---D-----------------------------------------
G1L3L7_MCL1-02          -QRGW---D-----------------------------------------
A0A287BK44_MCL1-02      -QRGW---D-----------------------------------------
A0A287BK44_MCL1-01      -QRGW---D-----------------------------------------
B4DU51_MCL1-01          -QRGW---D-----------------------------------------
A0A287DCH9_MCL1-02      -QRGW---D-----------------------------------------
A0A287DCH9_MCL1-01      -QRGW---D-----------------------------------------
W5MMB7_MCL1-01          -NRGW---D-----------------------------------------
A0A3B3SG34_MCL1-01      -NKAW---D-----------------------------------------
Q4SW32_MCL1-01          -NNAW---D-----------------------------------------
Q0KFR9_MCL1-01          -NNAW---N-----------------------------------------
A0A3P8Y1W8_MCL1-02      -NNAW---D-----------------------------------------
A0A3P8Y1W8_MCL1-01      -NNAW---D-----------------------------------------
D2ITA0_MCL1-03          -NNSW---E-----------------------------------------
D2ITA0_MCL1-04          -NNSW---E-----------------------------------------
A0A3P9ILF6_MCL1-02      -NNSW---D-----------------------------------------
A0A3P9ILF6_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q2XZL8_MCL1-01      -NNSW---D-----------------------------------------
A0A3B4AFB7_MCL1-02      -NNAW---D-----------------------------------------
A0A3B3VM25_MCL1-01      -NNSW---E-----------------------------------------
I3KXG5_MCL1-01          -NNAW---D-----------------------------------------
A0A3Q0R633_MCL1-01      -NNAW---D-----------------------------------------
A0A3Q0R633_MCL1-03      -NNAW---D-----------------------------------------
A0A3B4T8L9_MCL1-02      -NNSW---D-----------------------------------------
A0A3B4T8L9_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q1EQB9_MCL1-02      -NNSW---D-----------------------------------------
A0A3B4ZKP6_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q1BKL8_MCL1-02      -NNSW---D-----------------------------------------
A0A3Q1EQB9_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q1BKL8_MCL1-01      -NNSW---D-----------------------------------------
A0A3P8RQX7_MCL1-02      -NNSW---D-----------------------------------------
A0A3P8RQX7_MCL1-01      -NNSW---D-----------------------------------------
G3PJT0_MCL1-01          -NNAW---V-----------------------------------------
A0A3B3IJ04_MCL1-01      -NNSW---D-----------------------------------------
A0A3P9L1F3_MCL1-01      -NNSW---D-----------------------------------------
A0A3B3IJ04_MCL1-02      -NNSW---D-----------------------------------------
A0A3P9L1F3_MCL1-02      -NNSW---D-----------------------------------------
A0A3B3CEX1_MCL1-01      -NNSW---D-----------------------------------------
A0A3B3CEX1_MCL1-02      -NNSW---D-----------------------------------------
A0A3Q3VP02_MCL1-01      -GG-----D-----------------------------------------
A0A3Q3B4P5_MCL1-01      -NNSW---S-----------------------------------------
A0A3Q3B4P5_MCL1-02      -NNSW---S-----------------------------------------
A0A3Q2EDX8_MCL1-01      -NNSW---N-----------------------------------------
A0A3Q2P7X9_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q2P7X9_MCL1-02      -NNSW---D-----------------------------------------
A0A3B5PQ55_MCL1-01      -NNSW---E-----------------------------------------
A0A3B5PQ55_MCL1-02      -NNSW---E-----------------------------------------
A0A3P9Q4I8_MCL1-01      -NNSW---E-----------------------------------------
A0A3P9Q4I8_MCL1-02      -NNSW---E-----------------------------------------
A0A087X830_MCL1-01      -NNSW---E-----------------------------------------
A0A3B3YCD0_MCL1-01      -NNSW---E-----------------------------------------
I3JHR5_MCL1-02          -NNAW---D-----------------------------------------
I3JHR5_MCL1-03          -NNAW---D-----------------------------------------
I3JHR5_MCL1-01          -NNAW---D-----------------------------------------
A0A3Q4HLQ8_MCL1-01      -NNAW---D-----------------------------------------
A0A3P8NP63_MCL1-02      -NNAW---D-----------------------------------------
A0A3Q2VNL8_MCL1-01      -NNAW---D-----------------------------------------
A0A3P8NP63_MCL1-01      -NNAW---D-----------------------------------------
A0A3P9BVM3_MCL1-01      -NNAW---D-----------------------------------------
A0A3B4G4Z6_MCL1-01      -NNAW---D-----------------------------------------
A0A2U9CJ81_MCL1-01      -NNSW---E-----------------------------------------
A0A3P8VKM5_MCL1-03      -NNSW---D-----------------------------------------
A0A3P8VKM5_MCL1-04      -NNSW---D-----------------------------------------
A0A3P8VKM5_MCL1-05      -NNSW---D-----------------------------------------
A0A3Q3IZW0_MCL1-01      -NNAW---D-----------------------------------------
A0A3Q1GX28_MCL1-02      -NNSW---D-----------------------------------------
A0A3Q1GX28_MCL1-01      -NNSW---D-----------------------------------------
A0A3B4XKA5_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q3GP42_MCL1-01      -NNAW---D-----------------------------------------
A0A3Q3M6G2_MCL1-01      -NNSW---D-----------------------------------------
A0A3Q3M6G2_MCL1-02      -NNSW---D-----------------------------------------
A0A3B1IEV7_MCL1-01      -NNAW---D-----------------------------------------
A0A3B4CGU9_MCL1-03      -NKAW---G-----------------------------------------
A0A3B4CGU9_MCL1-02      -NKAW---G-----------------------------------------
Q8UWD6_MCL1-01          -NKAW---D-----------------------------------------
A2BF68_MCL1-01          -NKAW---D-----------------------------------------
Q568W5_MCL1-01          -NKAW---D-----------------------------------------
A0A3B1K5R1_MCL1-01      -NKAW---D-----------------------------------------
A0A3B4C6H5_MCL1-03      -NKAW---D-----------------------------------------
A0A3B4C6H5_MCL1-01      -NKAW---D-----------------------------------------
Q9Z0F3_BCL2L10-01       -LGGW---------------------------------------------
E1B9B3_BCL2L10-01       -NGGW---------------------------------------------
A0A1U7QVA0_BCL2L10      -QGGW---------------------------------------------
F1RZB9_BCL2L10-01       -NGGW---------------------------------------------
F1MV39_BCL2L10-01       -NGGW---------------------------------------------
W5QIG4_BCL2L10-01       -NGGW---------------------------------------------
Q99M66_BCL2L10-01       -HGGW---------------------------------------------
F6ZPD4_BCL2L10-01       -HYGW---------------------------------------------
A0A2K6F2Q2_BCL2L10      -QGGW---------------------------------------------
H0WZ06_BCL2L10-01       -QGGW---------------------------------------------
A0A1U7UZD8_BCL2L10      -QGGW---------------------------------------------
G1T264_BCL2L10-01       -QGGW---------------------------------------------
A0A0D9RG38_BCL2L10      -QGGW---------------------------------------------
A0A2K5RIU7_BCL2L10      -QGGW---------------------------------------------
A0A2K5F974_BCL2L10      -QGGW---------------------------------------------
A0A2K6TIT7_BCL2L10      -QGGW---------------------------------------------
F7CT87_BCL2L10-01       -QGGW---------------------------------------------
A0A096NM44_BCL2L10      -QGGW---------------------------------------------
A0A2K6R5T5_BCL2L10      -QGGW---------------------------------------------
Q9HD36_BCL2L10-02       -QGGW---------------------------------------------
G1R3W6_BCL2L10-01       -QGGW---------------------------------------------
A0A2K5K3B0_BCL2L10      -QGGW---------------------------------------------
A0A2K6M5H5_BCL2L10      -QGGW---------------------------------------------
A0A2K5TKG9_BCL2L10      -QGGW---------------------------------------------
F7H6U5_BCL2L10-01       -QGGW---------------------------------------------
A0A2K6B2D9_BCL2L10      -QGGW---------------------------------------------
A0A2K5MMZ4_BCL2L10      -QGGW---------------------------------------------
H2NN92_BCL2L10-01       -QGGW---------------------------------------------
A0A2R9BCD9_BCL2L10      -QGGW---------------------------------------------
H2Q9G4_BCL2L10-01       -QGGW---------------------------------------------
G3QLU6_BCL2L10-01       -QGGW---------------------------------------------
A0A337RYG8_BCL2L10      -HDGW---------------------------------------------
G1LKR4_BCL2L10-01       -HDGW---------------------------------------------
A0A452QJG0_BCL2L10      -HDGW---------------------------------------------
A0A3Q4MN81_BCL2L10      -NDGW---E-----------------------------------------
A0A3B4ETX9_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q2PJS5_BCL2L10      -NDGW---D-----------------------------------------
A0A3Q2GL87_BCL2L10      -NNGW---D-----------------------------------------
A0A3B5MJ12_BCL2L10      -NNGW---E-----------------------------------------
M4AUW7_BCL2L10-01       -NNGW---E-----------------------------------------
A0A096ME02_BCL2L10      -NNGW---D-----------------------------------------
A0A3B3TYN4_BCL2L10      -NNGW---D-----------------------------------------
A0A3B3YT99_BCL2L10      -NNGW---D-----------------------------------------
A0A3P9NE65_BCL2L10      -NNGW---D-----------------------------------------
A0A3P9IIZ2_BCL2L10      -NDGW---E-----------------------------------------
A0A3P9LM07_BCL2L10      -NDGW---E-----------------------------------------
H2MBQ3_BCL2L10-01       -NDGW---E-----------------------------------------
A0A3B4AAV4_BCL2L10      -NGGW---V-----------------------------------------
A0A3Q3EZT5_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q3EZT5_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q3JQ78_BCL2L10      -NDGW---E-----------------------------------------
A0A3B4TIY6_BCL2L10      -NGGW---E-----------------------------------------
A0A3B4WGF4_BCL2L10      -NGGW---E-----------------------------------------
A0A3Q3KZW1_BCL2L10      -NDGW---E-----------------------------------------
A0A3B5KD08_BCL2L10      -NGGW---E-----------------------------------------
A0A3Q3VI28_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q1GM98_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q1D2L0_BCL2L10      -NDGW---E-----------------------------------------
A0A3P8RL82_BCL2L10      -NDGW---E-----------------------------------------
A0A3B4ZFS0_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q2UUN9_BCL2L10      -NDGW---E-----------------------------------------
A0A3P8PVZ8_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q2UUN9_BCL2L10      -NDGW---E-----------------------------------------
A0A3P9BLI0_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q0S9R1_BCL2L10      -NDGW---E-----------------------------------------
D2IT42_BCL2L10-02       -NGGW---E-----------------------------------------
A0A3B3C5I4_BCL2L10      -NDGW---E-----------------------------------------
A0A3Q1IAB0_BCL2L10      -NDGW---E-----------------------------------------
A0A3P8W7K5_BCL2L10      -NGGW---E-----------------------------------------
H3AAS7_BCL2L2-02        -SGGW---S-----------------------------------------
H3AAS7_BCL2L2-01        -SGGW---S-----------------------------------------
G1Q051_BCL2L2-01        -IGGW---A-----------------------------------------
G3WPT1_BCL2L2-01        -KAGA---A-----------------------------------------
A0A287D9B3_BCL2L2-      -SGGW---------------------------------------------
A0A482LX62_BCL2L2-      -SASP---R-----------------------------------------
W5QDH4_BCL2L2-02        -SGGW---A-----------------------------------------
Q7TS60_BCL2L2-01        -SGGW---A-----------------------------------------
G1LMC3_BCL2L2-01        -SGGW---A-----------------------------------------
M3Y5X5_BCL2L2-01        -SGGW---A-----------------------------------------
G1P3J2_BCL2L2-01        -SGGW---A-----------------------------------------
G3WPT1_BCL2L2-02        -SGGW---A-----------------------------------------
G1TV33_BCL2L2-01        -TGGW---A-----------------------------------------
P70345_BCL2L2-01        -SGGW---A-----------------------------------------
O88996_BCL2L2-01        -SGGW---A-----------------------------------------
A0A3Q9B4M8_BCL2L2-      -SGGW---A-----------------------------------------
H0XR82_BCL2L2-01        -SGGW---A-----------------------------------------
A0A250YBR2_BCL2L2-      -SGGW---A-----------------------------------------
A0A250YBR2_BCL2L2-      -SGGW---A-----------------------------------------
L8HP19_BCL2L2-02        -SGGW---A-----------------------------------------
L8HP19_BCL2L2-01        -SGGW---A-----------------------------------------
Q1RMX3_BCL2L2-01        -SGGW---A-----------------------------------------
A0A452ECF0_BCL2L2-      -SGGW---A-----------------------------------------
A0A286XQQ9_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K5RUN8_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K5MZX9_BCL2L2-      -SGGW---A-----------------------------------------
A0A0D9RU30_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K5HEJ9_BCL2L2-      -SGGW---A-----------------------------------------
A0A1S3FYD8_BCL2L2-      -SGGW---A-----------------------------------------
A0A2I2UAE3_BCL2L2-      -SGGW---A-----------------------------------------
A0A2I2YPX6_BCL2L2-      -SGGW---A-----------------------------------------
A0A287D9B3_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K5V0Q3_BCL2L2-      -SGGW---A-----------------------------------------
F7G4L5_BCL2L2-01        -SGGW---A-----------------------------------------
A0A2K6EA59_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K6AI25_BCL2L2-      -SGGW---A-----------------------------------------
A0A1U7RC37_BCL2L2-      -SGGW---A-----------------------------------------
A0A2I3GEA7_BCL2L2-      -SGGW---A-----------------------------------------
A0A2R9A2Q3_BCL2L2-      -SGGW---A-----------------------------------------
H2Q805_BCL2L2-01        -SGGW---A-----------------------------------------
A0A096NX09_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K6GWM6_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K6ME72_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K6RW35_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K6RW35_BCL2L2-      -SGGW---A-----------------------------------------
A0A2K6TM77_BCL2L2-      -SGGW---A-----------------------------------------
A0A287ATE4_BCL2L2-      -SGGW---A-----------------------------------------
A0A1U7UJF2_BCL2L2-      -SGGW---A-----------------------------------------
A0A452SHI1_BCL2L2-      -SGGW---A-----------------------------------------
Q05KI8_BCL2L2-01        -SGGW---A-----------------------------------------
Q2TAP5_BCL2L1-01        -NGGW---E-----------------------------------------
Q91828_BCL2L1-01        -NGGW---E-----------------------------------------
I7GKS6_BCL2L1-01        -NGGW---D-----------------------------------------
A0A2K5EBP4_BCL2L1-      -NGGW---D-----------------------------------------
A0A2K5Q6R6_BCL2L1-      -NGGW---D-----------------------------------------
A0A2K6UWY8_BCL2L1-      -NGGW---D-----------------------------------------
Q5XGJ4_BCL2L2-01        -NGGW---N-----------------------------------------
F7G6M3_BCL2L2-01&n