Dataset for protein BCL-2-like of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                    mmfglkrnaviglnlyc      s ggga            r sglgagmsggasppggr
                     fg fq                                      psav satpqtaidtm
                         r                                            creplssaa 
                                                                      gss ddlte 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------snrelv-dylsy------------------------klsqrgy----------------------------
llmtdamsydt--i-v-fi--viggsag         asppaalt-------rpgplgaevpdvtawsqvsdapeptnrt
mmaagreas--ya-aek--glg                   st acdrrknvvesewdygg    sgdslgevgpiarga
aahspklgqyilrvgafevhh                        pcaspvapgplin d     htgafngfeavples
ktspegtfparhnalqglaqf                        iapkndtgdadmh a     llpfgllsfnagmad
tvinccsmervatttmyvnka                        rftet hlt sts       pieercaptqnsdp 
 iqemmargqkevskghmmcc                        ltlpc ft  qvr       vevpaesrar  it 
    spnwkesks  la grt                        mm n  l   vsa       tmrtpdvedg  vs 
    tirntmlpy  tn  yi                        si c  c     e       csa srrdvs  sc 
    nektmt vl  i   e                          s    g     q           eaqlsd  pl 
    lspyac  g  c   t                                     k            tptll  t  
    at qn          n                                                  ptg    e  
     y lh          a                                                            
     q  d                                                                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------pg--pp
eapegtesepgdasaspgeeldgyeperpgnlevtstng pswhsglad   arpavlpltvngatphslslppa-pa-s
srtdemappaetpiminen    c kkplkd g sask  yaapniahe   dng     ledvslgsvsqssq-pspa-
apdsragaamaifasqrds          t    n     tptkaltv    ksd     aflnteactpeiqddrelid
tllnansnggpeelvrsar          q          qglarfpe    sds     plergssgnrtphsesqvst
ggnassivvssatglpach                     nrst srp    tgh     vdgseavpagcvgtlttgtv
diaghgdddrdplqtgdpt                     evhe  vq    rar     savdrv vhnardgsersda
 tsvldrtsvrgvrrag a                     atvs  ss    p e     rga d  tr geerghltgr
 detpekgtl vk nl  q                     g gr  ql    h a     ipq    a  pt avlaevk
 sg dvvind ms pt  g                     l pl  gt    v t     d s    n  lm ln d el
 vf  lqll   g gv  d                     r rd   g    g       m          f ef g rh
 k   q        fd                          i                 e          g ct   n 
     r                                                                 d        
     h                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tpappeeaaqaagpelyrqsleiisrylgde vlendtrelissflrdregatgakdt                      
 mpsalrlqaqeedatspvppdfsgykasn  a dre kqiltr fknftqlyvcgaa                      
 asasaarvstplssptslda lvacps      ne  tlf rq  g alkp  t  g                      
 srrrqgs eertag rgmv   l sse               n  q yqsg                            
 ht  hp  drds    nie      n                     tiei                            
 ri  rq    qp      t                            gv                              
 le  p      q                                    s                              
 e                                                                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------avhqalrragd--eferryr-----r---afsdll-----sql-hi
              kpmgrsg    aasrrwreskaketmkdvan  dvqlkhe     t   dlqgmsgy pgakv dl
                lpge     stpdqrkqnpllrv-qesvf  glstnfq     k   tykect   r rrf sv
                         ppd  hndtvtaa-a-at-a  silklva     y   nwnpya     nnt e-
                         vqa   g  eeslmw ql e  rmree-t     q   rvas-i     dsm nt
                          kq   s  ri-s   k- q  q-iqqls     p   f tawh     qti f 
                          lc      -sr-   s  s  -p-d-nh     a   s rqp-     gg  y 
                          m       d-qk   n  -    vag k     s   - hnfv     vd  a 
                          r       qp t   -  l     s  -     i   v d- r     l   - 
                                  gy v      g     -  n     l     pt       t     
                                     h            v        e      h       c     
                                                           -              p     
                                                                          -     
                                                                          k     

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--tpgtayqsfeqvm--delfrdG--vNWGRivalfaFggalc----------ves--veke-mepl-------------
vqsndddrkrlsrsv aehv-sgrv tt --vatfis-eavva          khl  knrngqsscvtarwkkwgfqpr
ahkieseqgivatas  nkevq-ei ps   lisive a-fml          akc  ldigerqvd   w   r     
k dgagldtl-ts-i  ks-perht ir   --g-lv t i-i          q--  -sqrdiang             
r vdfm-vrv nntp  v-m g  h l     t- -t - t s          -qi  a--q hghq             
e carepcmg veel  -ti k  n f     m   -   - -          rym  qtek vtet             
t esq-ves- kk -  t   a  p r               t           r   rrnd kdly             
  -vtvh-vn rd a  i   -                                d   pqh- tnqs             
  hepn lht ig q  a   c                                    iamt -rk              
   -sp kaa -a                                              v    k-              
   qla n-   -                                                   -d              
   k-   l                                                       p               
    k   i                                                                       
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------vd-------r------------------iaewmteylnr-hlrdWiqs-nggW--------------------
lkeqegdig       p  gqqqelgqep vdckevsafiatvidn rkap lve qns-                    
       le       q   kg     g   syrrlvqsvsdf-vt niee fhk sra                     
       as       n              nkqqfqlelvar ed tqqt mrd hd-                     
        a       l                eg gytccv- le etha  lq -k                      
        p       t                 a idl ws  mg qhgs  ea  -                      
        r       s                 l csc  m  ts d-kn  -r                         
        k       a                   tti  n  gk pmn   in                         
                g                    r      -- s s   d-                         
                                     g      i  - d   a                          
                                     h      a        m                          
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------d--------------------------------------------------------------
                e-g dleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvg
                gea e                                                           
                 ar                                                             
                 nt                                                             
                 ke                                                             
                 vc                                                             
                 qh                                                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------fve-----------------lfg----------------ea
nvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfg-a-                 fy-nksg   w    ltfldv
                                      ay-k                 --hprrs        mnhmnd
                                        ta                 isev           hsl --
                                        cd                 kddq               gs
                                        in                 vvsd               rm
                                        lt                   rr               qr
                                         s                    k               si
                                         p                    t               fg
                                         r                    e               ht
                                                              h               pl
                                                              g               ke
                                                                              y 
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
aaesr---e-------f---------------------------------------w--------llg------------
le-g-rsq-slmafag-rplfpf    afr vipkrtnrpgisttdrgfpraryra-ltnynsnvsv-            
--g-skgrntskkyrliktpldl    g k                          rf     sr--a            
tdpalelldrkfqtyqlas   a      n                          la       gtk            
rskedtvdsgfvrclfvn           s                           p       aar            
vgafeamval lfgvams                                       t       kif            
eplicvffhh wtkc  q                                       r       rrl            
srtrvct fa r lm                                          s       tms            
dtvlasa  n   vh                                          m       v t            
pnsvwp   q                                               e       f              
h qm i                                                                          
q    h                                                                          
                                                                                
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------lg-l---------------
             mtlalalvga    gg                        valgalvt--a-               
             tvvt val      av                              alvasf               
             vlfv          ta                              lvilly               
             aa s          vc                              iagstv               
             ls l          ms                              ffavvi               
              i g          iq                              ggp cw               
                            p                               i  m                
                                                               f                
                                                               q                
                                                               y                
                                                                                
                                                                                
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--fa-k--------------------------------------------------------------------------
  lsg-rgvgaglayliraratswyspyq                                                   
  i-rvalrprwrvlrgs k   p l a                                                    
  -rqrnsyslltriir                                                               
  ygsffil fsit mm                                                               
  vthalhi nkds                                                                  
  slksi                                                                         
  mvvlh                                                                         
   nt s                                                                         
    c q                                                                         
    n                                                                           
    i                                                                           
                                                                                
                                                                                

       970       980       990      1000    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
                                            
                                            
                                            
                                            
                                            
                                            
                                            
                                            
                                            
                                            
                                            
                                            
                                            
© 1998-2020Legal notice