Dataset for protein BCL-2-like of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                             r spsav mcreqsdiagr
                                                                          lpltmm
                                                                          d   ea
                                                                              a 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------mg-dnrelvvdylsy------------------------klsqrgy----------------------------
mamtdm-syst-niaekfig-                        c---k--gsgpgaglg         agsggatp p
kmhagaf-sykyaa-aflvll                        vcripnvveagwdag            g   ss s
ntapprlfql-l--lig-nhh                        -aqe-qplcseshye                a   
t tscgemp-ihrvt--m-qf                        ifpsndtet alghd                    
a imacsaeqvesskmavm-c                        lttkqafpp lmpfr                    
r qnsstrgrsav fqy sk                         rmlvs hsd vtnp                     
   eepawkerkt  lh  c                         mian  l g qirs                     
    mirpnmqty  tn  r                          s c  c   d et                     
    teknmccvl  gs  y                               s   t q                      
    nypthf pp  r   e                               g   s k                      
    ltnldt  q      t                               a                            
       yaa  g      n                                                            
       q p         a                                                            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ggrllatekeasarreigggeagaviggsag         asppaaltpdarrvarpppigaevpdvtatgarllffapw
aadp  ag   t    v      t                    st a         s     g      pp     ssl
      s                                                  a            es     pdt
                                                                      i       gv
                                                                      d       ea
                                                                      r       vd
                                                                      m       ng
                                                                              ap
                                                                               n
                                                                               s
                                                                               e
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------g-------
sqaspveenrteaaegtpseeeepsginpeplg pkrpknlevtstng yaaksikrpavlglpswhgpagn-svngaps
rafpdpdaseadgpapiegpmstldaye      k   td g nask   vtrnlred   pnlelvrlcdspplpstse
gspeeeagmngpstdaamtifgsqpeat          q  a s         afqqs   rddaaa eepadtgetdgp
nrltlampgslsrsnsnvalvrrerseq                         r  a    ssgths vsarsassep d
derrnlvdpgiadlvepkdgaalcadss                                 taepv  avspnvtgns a
qliqsdtsatkgivgrggpdldnaqnha                                 atals  thedhrface t
lhsavnlttav vrrwddvar mdgrpp                                  hsv   qptgrlpdrg r
cvmgisg  ps tehlslesk ggnvd                                   vr    rdretiavp   
 gedat    d ehsdesrns fsvtl                                   gv     tvtag  a   
 c vg        gp va vg   eqr                                   rq     mhq        
 t           f  l         v                                          i          
                          g                                                     
                          t                                                     
                          c                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lpstpppap  eeeeedelyrqsleiisrylreqatgakdtplghstslldareviamd                  kpm
phpgsetpe   d d          l      sscpagdeaatdpdsaqqilpflapaa                    l
ssrdrsrds                        gsgesnq qsplrarerlssstrdgt                     
vqlptllsv                        a sse   vaereqksievh ftsfp                     
faaeetala                          n     lpanghtrfrtn iggle                     
mdtcg get                                eqrahrq  qhq yqnvs                     
drgs  srl                                srtq vp   rd sprtv                     
agcl  vk                                 r ns       a  vty                      
 e                                         qe          k s                      
                                            v            i                      
                                            d                                   
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------avhqa-----------lrragd--eferryrrafsdll-----sql-hi--tpg-tayqsfeq
grsg alsavsr     klketrwkeskals tmkdvan  dvqlkhetdlqgmsgy pgrkv dlvaksaddvrs-lsr
 g   gtepapp     -asrvqrrqn y k  -qesvf  glstnfqktykeca   r nrf svq dnegsdqgrvtt
     tpr tmd     g--l-khndt   q  w-at-a  silklvaynwnpyt     anm e-h egfs--krf-as
      md  lq     vtl-p  tr       a ql e  rmree-tqr-aswi     dti nt  vdieal-tiin-
      i          piras  g          k- q  ---qqnsaf taph     qs  lk  cmrpeqm-l -n
                 r akm  s          s  s  qpid-l-ps rqfv     gg  yr  aed npchn ke
                 d  s              -  -    v-g hs- hn r     vd  a   --v vnvi  ra
                 q  h              n  l     a  kiv dt       l   -   lqt ghha  gk
                                            s  nl  ph       c       rks       vg
                                            v   -           p       h q         
                                            g   e           -       s p         
                                                                      -         
                                                                      k         
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
Vm--delfrd--G-vNWGRivalfaFggalc-------------------ve---svnke-ms----e---l--------
-v  ehvvsgsprvtt --vatfis-eavvarrlpeqtarwpgldpqkkhlkqricidrdscv    p   -        
ia  nkelqr  hips   lisive a-fmleqgllvkgwnkkwgf pqlareegekeqgtyi    v   p        
 s  ksmpe   etir   --g-lv t i-i  er   dkk  r    reqqhqvalgvnn-q    -   q        
 -  vai g   dhl     t-v-t - t s            p    aqsv   tpamqpp-    s   s        
 i  t-  k    nf     m   -   - t                 gyk-   naqhshle    g   n        
 l  -t  a    pr               -                 ek-d   drsn esk    d   g        
    i   c                                        rg    --t  kkt    q            
    q                                             m    lm-  g a    a            
    a                                             p    q v  d r    h            
                                                       g    a g    t            
                                                       k                        
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------v-------iaewmteylnr-hlrdWiqs-nggW-----------------------------------
            -gr     vsafiatvidn rkap lve qns-   dleaidarvremeeeaeklkelqnevekqmnm
            cdn     lvqsvsdf-vt niee fhk sra    e    k                          
             sq     fqlelvar ed tqqt mrd hd-    a    e                          
             rs      gytccv- le etha  lq -k                                     
             qa      idl ws  mg qhgs  ea  -                                     
             ag      csc  m  ts d-kn  -r                                        
             pl      tti  n  gk pmn   in                                        
             e        r      -- s s   d-                                        
             k        g      i  - d   a                                         
                      h      a        m                                         
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgf              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------g-------fve-----------------lfgv-------------
           dg       engfvkkfepk   saw    lt-aa                 fyhn           ea
                    gk  i    er   rr     msycd                 itrq           dd
                     d  l          t     hnltk                 --dk           ns
                                   -       hl-                 vs-r           gr
                                   e        -q                 mlsp           ag
                                   c        il                   ad           qt
                                   s        mh                   q-           s 
                                   h        ss                   eh           p 
                                             p                   kt             
                                             r                    s             
                                             n                    l             
                                                                  e             
                                                                  g             
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------r-----------------------------------------w--------------lag---
aegglaldeslfrgres-rgqesmrplfdfnvrpkrsnrpgisttdrgfpraryrartt-lsvnt      lla---   
lats           qakksrqrfk    lk k   ks                     sfvlkv      vmsftl   
pss            sisels glq     r n   t                      nalrra      sfgava   
vr             vf  v  t         i   c                      ptmkgr      tvvysr   
dg             ng  f  d             r                      lsnitm      arfvws   
e              dv  a  n             n                      appss       iglilt   
t              gl     a                                    ty ah         t  e   
                                                            i                   
                                                            m                   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------vg----------------ay
                     avalagvtla          vl                 la        gvgagl  sl
                      mgvgaafag          lt                 i-        srprkr  --
                      ltgitlltc          iv                 -r         isnsi  vf
                      flavqggfs          ff                 fn         l      em
                      kqilp  ml          ci                 rc                ts
                      a       v          m                  as                la
                      r                  a                  sv                mi
                      i                                     mw                gv
                                                            tt                c 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       970       980       990      1000      1010      1020      1030      1040
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
l-------------------------------------------------------------------------------
firlkqtyllspy  f p arkrlt                                                       
-slarwkswy sf      sqrq                                                         
igyklayrci         gsqh                                                         
rahffldma          thal                                                         
vff  k  i          lk                                                           
mh                 vp                                                           
s                                                                               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

      1050      1060  
....:....|....:....|..
                      
----------------------
                      
                      
                      
                      
                      
                      
                      
                      
                      
                      
                      
                      
                      
                      
© 1998-2020Legal notice