Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

72 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P8PVZ8_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P9BLI0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------MFQLSWGLFLLEAESADK
A0A3P8W7K5_BCL2L10      --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
                                                                          

G1QEX2_BCL2L10-01       ----------------------------------DELKLRTRRLLTEFLE
A0A3Q4MN81_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3B4ETX9_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2PJS5_BCL2L10      -------------------MCREPSHIAGRK-MSCGLWKETVAVAEDYMR
A0A3Q2GL87_BCL2L10      -------------------MCREPLHITGRK-MSCGLWKETVAVAEDYMR
A0A3B5MJ12_BCL2L10      --------------------------------MSCGLWKETVVVAEDYIR
M4AUW7_BCL2L10-01       --------------------------------MSCGLWKETVVVAEDYIR
A0A096ME02_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIH
A0A3B3TYN4_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIR
A0A3B3YT99_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIH
A0A3P9NE65_BCL2L10      ---------MRRGSPSAVWMCREPSHIAGRK-MSCGLWKETVAVAEDYIH
A0A3P9IIZ2_BCL2L10      --------------------------------MSCGLRKETLAVALDYLS
A0A3P9LM07_BCL2L10      --------------------------------MSCGLRKETLAVALDYLS
H2MBQ3_BCL2L10-01       --------------------------------MSCGLRKETLAVALDYLS
A0A3B4AAV4_BCL2L10      --------------------------------MSCGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRK-MSCGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRK-MSCGLWKETLALAEDYLS
A0A3Q3JQ78_BCL2L10      -------------------MCREHLDIAGRK-MSCGLWKDTLALAEDYLS
A0A3B4TIY6_BCL2L10      --------------------------------MSCGLWKETRAVAEDYLY
A0A3B4WGF4_BCL2L10      --------------------------------MSCGLWKETRAVAEDYLF
A0A3Q3KZW1_BCL2L10      --------------------------------MSCGLWKETLALAEDYLS
A0A3B5KD08_BCL2L10      --------------------------------MSCGLWKETLALAEDYLS
A0A3Q3VI28_BCL2L10      --------------------------------MSCGLWKETLALAQDYLS
A0A3Q1GM98_BCL2L10      --------------------------------MSCGLWKETVVLAEDYLS
A0A3Q1D2L0_BCL2L10      --------------------------------MSCGLWKETLVLAEDYLS
A0A3P8RL82_BCL2L10      --------------------------------MSCGLWKETLVLAEDYLS
A0A3B4ZFS0_BCL2L10      --------------------------------MSCGLWKETLVVAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P8PVZ8_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P9BLI0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q0S9R1_BCL2L10      --------------------------------MVPGLWKETLGLAEDYLS
D2IT42_BCL2L10-02       --------------------------------MSCRLWKETLALSEDYLL
A0A3B3C5I4_BCL2L10      -----------------------MDGFSAQK-MSCGLRKETLAVALDYLS
A0A3Q1IAB0_BCL2L10      CADAEGKLRVHRGSPSAVRMCREQTDIAGRK-MSCGLWKDTLALAEDYLS
A0A3P8W7K5_BCL2L10      --------MCNSASPSAVSTSSEQSDIAGRK-MSCGLWKETLAVAEDYLS
F6VJQ0_BCL2L10-01       ------------------------------MDYKCALREETARLVTDYLE
Q9Z0F3_BCL2L10-01       -----------------------------MADSQDPLHERTRRLLSDYIF
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLE
E1B9B3_BCL2L10-01       --------------------------MTEGGAMVDPFRERTARLLMDYLE
A0A1U7QVA0_BCL2L10      --------------------------------MADPLRVRTRLLLTDYLT
F1RZB9_BCL2L10-01       --------------------------------MADAFRERTARLLTDYLE
F1MV39_BCL2L10-01       -----------------------------VADGQESLVERTARLLMDYLE
W5QIG4_BCL2L10-01       -----------------------GRPPGRGGAMVDPFRERTARLLMDWLE
Q99M66_BCL2L10-01       --------------------------------MGDPLQDRTRRLLTDYIL
F6ZPD4_BCL2L10-01       -------------------------------AVAEALRERTALLLIDYLQ
A0A2K6F2Q2_BCL2L10      --------------------------------MGDRFRERTERLLADYLE
H0WZ06_BCL2L10-01       --------------------------------MADPLRERTERLLTDYLE
A0A1U7UZD8_BCL2L10      --------------------------------MADPLEERTARLLADYLE
G1T264_BCL2L10-01       --------------------------------MADALEERTARLLTDYLE
A0A0D9RG38_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5RIU7_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K5F974_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K6TIT7_BCL2L10      --------------------------------MADPLQQRTEQLVADYLE
F7CT87_BCL2L10-01       --------------------------------MADPLRQRTEQLVTDYLE
A0A096NM44_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K6R5T5_BCL2L10      --------------------------------MADPLRERTERLLADYLG
Q9HD36_BCL2L10-02       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
G1R3W6_BCL2L10-01       --------------------------------MVDQLRERTERLLADYLG
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K6M5H5_BCL2L10      ----------------------MADPLRERTTVADPLRERTERLLADYLG
A0A2K5TKG9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
F7H6U5_BCL2L10-01       --------------------------------MADPLRERTERLLADYLG
A0A2K6B2D9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5MMZ4_BCL2L10      --------------------------------MADPLRERTERLLADYLG
H2NN92_BCL2L10-01       ----------------------MVDQLRERTITADLLRERTERLLADYLG
A0A2R9BCD9_BCL2L10      ----------------------MVDQWRERTTMADPLRERTERLLADYLG
H2Q9G4_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
G3QLU6_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
A0A337RYG8_BCL2L10      --------------------------------MADALRERTAQLLTDYLE
G1LKR4_BCL2L10-01       --------------------------------MADALRG-TARLLTDYLE
A0A452QJG0_BCL2L10      --------------------------------MADALRERTARLLTDYLE
                                                            :   *  :  ::: 

G1QEX2_BCL2L10-01       HRTRRRGTAPQQPSTPEATVMRSLAAHSWLGTPHSWSR--------RQRN
A0A3Q4MN81_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3B4ETX9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2PJS5_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVESQHQARFHALAQSFLRHSQTD
A0A3Q2GL87_BCL2L10      LRCSSP-LPAPPPPSEPAAAMRRLAQDMETQHQARFHTLAQSFLRHSGTD
A0A3B5MJ12_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSD
M4AUW7_BCL2L10-01       LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSD
A0A096ME02_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3B3TYN4_BCL2L10      LCCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3B3YT99_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3P9NE65_BCL2L10      LRCSNP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3P9IIZ2_BCL2L10      LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGQD
A0A3P9LM07_BCL2L10      LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPD
H2MBQ3_BCL2L10-01       LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPD
A0A3B4AAV4_BCL2L10      LCCSGP-QAAPPPPSGSASAMRRLGQDMEAQHKARFHSLSQTFLKQCGPD
A0A3Q3EZT5_BCL2L10      LCCTSP-RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPD
A0A3Q3EZT5_BCL2L10      LCCTSP-RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPD
A0A3Q3JQ78_BCL2L10      LCCTSS-RPAPPPPSESAAAMRCLAQDMETQHQARFHSLAQTFLKQCGPD
A0A3B4TIY6_BCL2L10      LCCTSP-QPAPPPPSESAAAMRSMAQDMETQHQARFHTLAQTFVTQCGLD
A0A3B4WGF4_BCL2L10      LCCTSP-QPAPPPPSESAAAMRGMAQDMETQHQARFHTLAQTFVTQCGLD
A0A3Q3KZW1_BCL2L10      LCCTSP-QSVPPPPSESAAAMRCLAQKMERQHQARFHSLTQTFLKQCGPD
A0A3B5KD08_BCL2L10      LCSTSQ-CPAPPPPSESATAMRHLGQDMEKQHQARFNSLAQTFLRQCGPD
A0A3Q3VI28_BCL2L10      LCCTSQ-RPAPPPPSESAAAMRDLAQDMEKQHQARFHSLAQTFLRQCGTD
A0A3Q1GM98_BCL2L10      LCCAGP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQAFLRQCGPD
A0A3Q1D2L0_BCL2L10      LCCASP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPD
A0A3P8RL82_BCL2L10      LCCASP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPD
A0A3B4ZFS0_BCL2L10      LCCTSP-HSAPPPPSESAAAMRCLAQDMEKQHQARFHSLTQTFLRQPGPD
A0A3Q2UUN9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3P8PVZ8_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2UUN9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3P9BLI0_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q0S9R1_BCL2L10      LCCTSP-HQVPPPPSESAAAMRRLGQDIERQHQARFDNLAQTFLRHCGPD
D2IT42_BCL2L10-02       SCTAST-GTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEAD
A0A3B3C5I4_BCL2L10      LSCRSPVLQAPPPPSESASAMRRLAQDMETQYQPRFSTLAQDFRKHCGPD
A0A3Q1IAB0_BCL2L10      LCCTSP-WPAPPPPSESAAAMRRLAQDMEKQHQVRFHSLAQTFLKQCGPD
A0A3P8W7K5_BCL2L10      LCCSSP-RPAPPPPSESAAAMRHLAQDMEKQHQARFQTLSQSFLRQCGSE
F6VJQ0_BCL2L10-01       YCCRREGVQELPAPTPAAATLRLVSSELRQIYQDFFEC----ALNQ-LLD
Q9Z0F3_BCL2L10-01       FCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSS----FCES-RGN
M3Y8D1_BCL2L10-01       YCARGPGTPARSPSTREAAVLRSVAAVVRQRHERFLSD----YRGY-GGN
E1B9B3_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRRC-RRH
A0A1U7QVA0_BCL2L10      FCAREPGDPEPPPTSAEAALLRSVAEQIQQQHHFFFSS----FVGY-QGN
F1RZB9_BCL2L10-01       YCAREPGTAARQPSSPEAAVLRCVAAQIREYNVRTLSV----YRGF-RWN
F1MV39_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRRC-RRH
W5QIG4_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL----YRRY-RRH
Q99M66_BCL2L10-01       FCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNS----FRDY-QGN
F6ZPD4_BCL2L10-01       RRAREPATP-------EVAVLRCVAAQIQPRNQRVLSR----YRGF-RGD
A0A2K6F2Q2_BCL2L10      YCTREPGAPGLPPSSLEAAAMRFAATKIRRKHASFFSA----YVGY-PGN
H0WZ06_BCL2L10-01       YCARDPTAPEPTPSSPEAALLRSVTAYIQQRHWSFFSA----YIGY-PGN
A0A1U7UZD8_BCL2L10      YCARPPGSPEPRPSSPEAAVLRSTAARLRQRHASFFSA----FVDY-PGS
G1T264_BCL2L10-01       CCAREPGTPEPQPSTPEAAVLRCAATQLQRVHWPFFSV----YRGY-PGN
A0A0D9RG38_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K5RIU7_BCL2L10      YCSREPGTPESPPATAEAAVLRATAAGVRKVYRSFFSA----YLGY-PGN
A0A2K5F974_BCL2L10      YCSQEPGTPESPPSTAEAAVLRAMAAGVRKLYRSFFSA----YLGY-PGN
A0A2K6TIT7_BCL2L10      YCSREPGTPESPPATAEAAVLRATAAVVRKLYPSFFSA----YRGY-PRN
F7CT87_BCL2L10-01       YCSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSA----YLGY-PGN
A0A096NM44_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K6R5T5_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
Q9HD36_BCL2L10-02       YCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
G1R3W6_BCL2L10-01       CCAREPGTPEPTPSTPEAAMLRSAAARLRQLHPSFFSA----YLGY-PGN
A0A2K5K3B0_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K6M5H5_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K5TKG9_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
F7H6U5_BCL2L10-01       CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K6B2D9_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K5MMZ4_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-RGN
H2NN92_BCL2L10-01       CCAREPGTPEPTPPTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2R9BCD9_BCL2L10      YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
H2Q9G4_BCL2L10-01       YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
G3QLU6_BCL2L10-01       YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
A0A337RYG8_BCL2L10      YCAREPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSA----YRGY-RGN
G1LKR4_BCL2L10-01       YCAREPGTPARAPSTPEAAVLRSVAAQVQQRHERFLSD----YRGYAGGN
A0A452QJG0_BCL2L10      YCAREPGTPARAPSTPEAAVLRSVAAQVQQRHEHFLSD----YRGY-GGN
                                         .: :*                            

G1QEX2_BCL2L10-01       RLEQMVDQIESLVPDGTDPNWLSVVALVSFAGALLERPP----------P
A0A3Q4MN81_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQK---P
A0A3B4ETX9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQK---P
A0A3Q2PJS5_BCL2L10      LCTSLWKVMDEMVGDGH-FNWGRVVSLFTFAGVLARQ----LQEQQGRSP
A0A3Q2GL87_BCL2L10      LCSSLRKVMDEMVGDGL-FNWGRVVSLFTFAGVLARQ----LQEQTGKNP
A0A3B5MJ12_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
M4AUW7_BCL2L10-01       LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A096ME02_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3B3TYN4_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3B3YT99_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3P9NE65_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3P9IIZ2_BCL2L10      LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
A0A3P9LM07_BCL2L10      LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
H2MBQ3_BCL2L10-01       LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
A0A3B4AAV4_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSLFTFAGVLARH----IKEQKSSRP
A0A3Q3EZT5_BCL2L10      PCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQEDVKL
A0A3Q3EZT5_BCL2L10      PCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQEDVKL
A0A3Q3JQ78_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARQ----LTEQNGMKP
A0A3B4TIY6_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQNRVNP
A0A3B4WGF4_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQNRVNP
A0A3Q3KZW1_BCL2L10      PCSSLRKVIEELVADGH-LNWGRVVSLFTFTGVLSRQ----LMEQKGMKP
A0A3B5KD08_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARL----MQEQKSTKP
A0A3Q3VI28_BCL2L10      PCSSLRNVMEELVGDGH-LNWGRVVSIFTFTGVLARQ----LLEQKSTKP
A0A3Q1GM98_BCL2L10      FCSSLRMVMEELVEDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKP
A0A3Q1D2L0_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKL
A0A3P8RL82_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKP
A0A3B4ZFS0_BCL2L10      LCSSLRRVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQRDTKP
A0A3Q2UUN9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3P8PVZ8_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2UUN9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3P9BLI0_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q0S9R1_BCL2L10      HCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARK----RLEQKP---
D2IT42_BCL2L10-02       ACAGLRKVMEELVGDGQ-LNWGRVVSLFTFTGVLARQ----LQEKKGVQL
A0A3B3C5I4_BCL2L10      LCSSLRKVMEELVGDEH-LNWGRVVSLFAFVGVLARQ----LREQTDTNP
A0A3Q1IAB0_BCL2L10      PCSSLRKVMEELVGDGH-MNWGRVVSLFTFTGVLARQ----MLEQKDKKP
A0A3P8W7K5_BCL2L10      PCVCLRKVMEELVGDGH-LNWGRVVSIFTFTGVLAKQ----LLVQKGLKP
F6VJQ0_BCL2L10-01       REPEQVIVNVAELMDRGEFNWGRVAVLVVFAGALLEMEE-----------
Q9Z0F3_BCL2L10-01       RLELVKQMADKLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVK------
M3Y8D1_BCL2L10-01       RVELVAQLEREILAHPQALSWGRVVALVTFAGTLLERPPSGACSNLGPDP
E1B9B3_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT------
A0A1U7QVA0_BCL2L10      RVELMTQMVDAVLPDGQDLNWGRLVLLLAFAGTIVSQE------------
F1RZB9_BCL2L10-01       RVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLERHP--REACGRKK-
F1MV39_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT------
W5QIG4_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQP--QTT------
Q99M66_BCL2L10-01       RLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDR--TVK---RRR
F6ZPD4_BCL2L10-01       HVGLAARMAQAIFGDRHVPSWGRVAALVTLAGTLLERAP--RGTYRKPKR
A0A2K6F2Q2_BCL2L10      RVYLLERMAEAVLCDS--LSWGRVVMLVTFAGTLLERGP--PVTAWWKKW
H0WZ06_BCL2L10-01       RVQVVERMVKAMLSDNQRLNWGRVVTLVTFAGTLLQRPP--VEARREKQD
A0A1U7UZD8_BCL2L10      RVDLTARMADAVLSGSRDLSWGRVVTLVTFAGTLLERGP--LLPAGGQQR
G1T264_BCL2L10-01       RIELAARVAEAVLSDGHDLSWGRVVTLVTFAGTLLDRGP--PVTTQ----
A0A0D9RG38_BCL2L10      RVELVALMADAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LMTAWWKKQ
A0A2K5RIU7_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A2K5F974_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A2K6TIT7_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
F7CT87_BCL2L10-01       RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A096NM44_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6R5T5_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
Q9HD36_BCL2L10-02       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
G1R3W6_BCL2L10-01       RVELVVLMADSVLSDSPGPTWGRVVTLVAFAGTLLERGP--LVTARWKKW
A0A2K5K3B0_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6M5H5_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K5TKG9_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
F7H6U5_BCL2L10-01       RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6B2D9_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K5MMZ4_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
H2NN92_BCL2L10-01       RVELVALMADSVLSDSPSPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
A0A2R9BCD9_BCL2L10      RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTTRWKKW
H2Q9G4_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTTRWKKW
G3QLU6_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
A0A337RYG8_BCL2L10      RVELVARLEQDLLSNPQTLSWGHVVALLTFAGTLLERPP--PGTYLNLTP
G1LKR4_BCL2L10-01       RVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTYSNLGP
A0A452QJG0_BCL2L10      RVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTYSNLGP
                                    .      .*  :. :. :.* :                

G1QEX2_BCL2L10-01       GHSQ--ARREWDATVD-QD-CQRLVTFLCSWLTE-THRTWMEAQGGW-DG
A0A3Q4MN81_BCL2L10      GLDP--GQQQELGQEP-MS-CRRLAETIADYLGE-EKKDWLLDNDGW-EG
A0A3B4ETX9_BCL2L10      GLDP--GQQQELGQEP-MS-CRRLAETIADYLGE-EKKDWLLDNDGW-EG
A0A3Q2PJS5_BCL2L10      GPDP--GRQQ----EP-VS-CRELAETIADYLEK-HKKDWLQENDGW-DG
A0A3Q2GL87_BCL2L10      GLDP--GRQQELQTEP-VS-CRALAETIADYLET-HKKDWLQENNGW-DG
A0A3B5MJ12_BCL2L10      VPDS--GKQQELQQEP-VS-CRALAETIADYLEK-HKKDWLQENNGW-EG
M4AUW7_BCL2L10-01       VPDS--GKQQELQQEP-VS-CRALAETIADYLEK-HKKDWLQENNGW-EG
A0A096ME02_BCL2L10      GPDS--GKQQELQQEP-VS-CRALAETIADYLEK-HKKDWLQENNGW-DG
A0A3B3TYN4_BCL2L10      GPDS--GKQQELQQEP-VS-CRALAETIADYLEK-HKKDWLQENNGW-DG
A0A3B3YT99_BCL2L10      GPDS--GKQQELQQEP-VS-CRALAETIADYLEK-HKKDWLQENNGW-DG
A0A3P9NE65_BCL2L10      GPDS--GKQQELQQET-VS-CRALAETIADYLEK-HKKDWLQENNGW-DG
A0A3P9IIZ2_BCL2L10      GLDP----GREVAAGP-VS-CQALAETVADFLGG-DKKEWMLENDGW-EG
A0A3P9LM07_BCL2L10      GLDP----GREVAPGP-VS-CQALAETVADFLGG-DKKEWMLENDGW-EG
H2MBQ3_BCL2L10-01       GLDP----GREVAPGP-VS-CQALAETVADFLGG-DKKEWMLENDGW-EG
A0A3B4AAV4_BCL2L10      GLDP--GQVQGLGQVP-SD-CRRLAQTIADYLGE-EKRDWLLENGGW-VG
A0A3Q3EZT5_BCL2L10      GLDP--VQGQKLGQGP-GH-CRGLAETIADYLGE-EKKEWLLENDGW-EG
A0A3Q3EZT5_BCL2L10      GLDP--VQGQKLGQGP-GH-CRGLAETIADYLGE-EKKEWLLENDGW-EG
A0A3Q3JQ78_BCL2L10      GLDP--GQGQELGQGP-GN-CRELAETIADYLGE-EKKDWLLENDGW-EG
A0A3B4TIY6_BCL2L10      GLDP--GQGQGLG-----N-CRGLAETIADYLGE-EKKDWLLENGGW-EG
A0A3B4WGF4_BCL2L10      GLDP--GQGQGLR-----N-CRGLAETIADYLGE-EKKDWLLENGGW-EG
A0A3Q3KZW1_BCL2L10      GLDS--GKGQELGQGP-ES-CRGLAETIADYLGE-EKKDWLQENDGW-EG
A0A3B5KD08_BCL2L10      GLDP--GQEQQLGQVP-EN-CRGLAETIADYLGE-EKKDWLLENGGW-EG
A0A3Q3VI28_BCL2L10      GLEPRQDQDQELGQVP-GN-CSELAETIADYLGE-EKKAWLLENDGW-EG
A0A3Q1GM98_BCL2L10      GLDP--GKRQELGQRP-VN-CRGLAETIADYLGE-EKKDWLLENDGW-EG
A0A3Q1D2L0_BCL2L10      GLDP--GKQQELGQGP-VN-CRELAETIADYLGE-EKKDWLLENDGW-EG
A0A3P8RL82_BCL2L10      GLDP--GKQQELGQGP-VN-CRELAETIADYLGE-EKKDWLLENDGW-EG
A0A3B4ZFS0_BCL2L10      GLEP--GKRQELGQGP-VN-CRGLAETIADYLGE-EKKDWLLENDGW-EG
A0A3Q2UUN9_BCL2L10      GLDP--RQQQELGQEP-MS-CRRLAETIADYLGE-EKKDWLLDNDGW-EG
A0A3P8PVZ8_BCL2L10      GLDP--RQQQELGQEP-MS-CRRLAETIADYLGE-EKKDWLLDNDGW-EG
A0A3Q2UUN9_BCL2L10      GLDP--RQQQELGQEP-MS-CRRLAETIADYLGE-EKKDWLLDNDGW-EG
A0A3P9BLI0_BCL2L10      GLDP--RQQQELGQEP-MS-CRRLAETIADYLGE-EKKDWLLDNDGW-EG
A0A3Q0S9R1_BCL2L10      GLDP--GQQQELGQEP-IS-CRELAETIADYLGE-EKKDWLLDNDGW-EG
D2IT42_BCL2L10-02       GQDP--GTGRALGQVPGGS-CRGLAETIADYLGE-EKRDWLLENGGW-EG
A0A3B3C5I4_BCL2L10      GLDL----GREAAPGP-VS-CQALAETVADFLGG-DKKEWMLENDGW-EG
A0A3Q1IAB0_BCL2L10      GLDL--GKGQELGQEP-GQ-CRGLAETIADYLGE-EKKDWLLENDGW-EG
A0A3P8W7K5_BCL2L10      GQEP--EAGQELGPEP-GT-CRELAETIADYLGE-EKKAWLLENGGW-EG
F6VJQ0_BCL2L10-01       ---L--LKEEQVLQLR-RETSRRLTEKLCNYLVE-RKGAWLHENGGW-TG
Q9Z0F3_BCL2L10-01       --QK--RDLGNRVIVT-RD-CCLIVNFLYNLLMGRRHRARLEALGGW-DG
M3Y8D1_BCL2L10-01       ELEL--ELGEWEASVR-QD-CRRLVDFLCGRLTG-QHRAWLEAHGGW-DG
E1B9B3_BCL2L10-01       --RR--QEKRDDDGVS-RD-CRLLVALLCAQFCE-RHRAWLMTNGGWVSA
A0A1U7QVA0_BCL2L10      --QR--NRLKDKMKVL-QD-CQLIVALLCNRLLR-RHRSWLEAQGGW-DG
F1RZB9_BCL2L10-01       ----------KEGNVS-RD-CRLLVALLCAQLSG-QHRTWLLANGGW-DG
F1MV39_BCL2L10-01       ---R--RQKRDDDGVS-RD-CRLLVALLCAQFCE-RHRAWLMANGGW-DG
W5QIG4_BCL2L10-01       ---R--RQKRDDGSVS-RD-CRLLVALLCAQFCE-RHRAWLMANGGW-DG
Q99M66_BCL2L10-01       DQRN--RLL-----LE-RD-CYLIVSLLYNRLTG-RHRSWLEAHGGW-DG
F6ZPD4_BCL2L10-01       GYKL--ELREWKAGVD-RD-WPRLVDFLCAWLKG-RHRAWLEAHYGW-DG
A0A2K6F2Q2_BCL2L10      GLQP--QPKEGDPEVA-RD-RQRLVALLCARLAG-QHRAWLQAQGGW-DG
H0WZ06_BCL2L10-01       --KS--QLKEGEDEVA-RD-CQRLVALLSSRLVG-QHRVWLEAQGGW-DG
A0A1U7UZD8_BCL2L10      GFRP--RRKKEEGDVA-RD-CQRLVALLSARLAG-RHRAWLQAQGGW-DG
G1T264_BCL2L10-01       --------RVRRNEIA-RD-CQRLVALLCARLAG-QHRAWLQAQGGW-DG
A0A0D9RG38_BCL2L10      SFQP--RL-EQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-DG
A0A2K5RIU7_BCL2L10      GFQS--RLKEPEGNVS-RD-RQRLVGLLSSRLVG-QHRAWLEAQGGW-VS
A0A2K5F974_BCL2L10      GFQS--RLKEPEGDVA-RD-CQRLVALLSSRLVG-QHRAWLEAQGGW-VS
A0A2K6TIT7_BCL2L10      GFQS--RLKEPEGDVA-RD-CQRLVGLLSSRLVG-QHRAWLEAQGGW-VS
F7CT87_BCL2L10-01       GFQS--RLKEPEGDVA-RD-CQRLVALLSSRLVG-QHRAWLEAQGGW-DG
A0A096NM44_BCL2L10      SFQP--RLKEQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-VS
A0A2K6R5T5_BCL2L10      SFQP--RLKEQEGEVA-RD-CQRLVALLSSRLTG-QHRAWLQAQGGW-VS
Q9HD36_BCL2L10-02       GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLMG-QHRAWLQAQGGW-VS
G1R3W6_BCL2L10-01       GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLVG-QHRAWLQAQGGW-VS
A0A2K5K3B0_BCL2L10      SFQP--RLKEQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-DG
A0A2K6M5H5_BCL2L10      SFQP--RLKEQEGDVA-RD-CQRLVALLSSRLTG-QHRAWLQAQGGW-DG
A0A2K5TKG9_BCL2L10      GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-DG
F7H6U5_BCL2L10-01       GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-DG
A0A2K6B2D9_BCL2L10      GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-DG
A0A2K5MMZ4_BCL2L10      GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLAG-QHRAWLQAQGGW-DG
H2NN92_BCL2L10-01       GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLVG-QHRAWLQAQGGW-DG
A0A2R9BCD9_BCL2L10      GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLVG-QHRAWLQAQGGW-DG
H2Q9G4_BCL2L10-01       GFQP--RLNEQEGDVA-RD-CQRLVALLSSRLVG-QHRAWLQAQGGW-DG
G3QLU6_BCL2L10-01       GFQP--RLKEQEGDVA-RD-CQRLVALLSSRLMG-QHRAWLQAQGGW-DG
A0A337RYG8_BCL2L10      DQQQ--EL-EWETNVG-QD-CQHLVALLCNRLTG-RHRAWLEAHDGW-DG
G1LKR4_BCL2L10-01       DQEL--ELGEWEAGVR-QD-CRHLVDFLCNRLTG-QHRAWLEAHDGW-DG
A0A452QJG0_BCL2L10      DQEL--ELGEREAGVR-QD-CRHLVDFLCNRLTG-QHRAWLEAHDGWVNG
                                               :.  :   :    :  .:    **  .

G1QEX2_BCL2L10-01       --------------------------FCHNFMPAPPP------GDRLLAP
A0A3Q4MN81_BCL2L10      --------------------------FCKFSRSAREV----SQDSSMKKA
A0A3B4ETX9_BCL2L10      --------------------------FCKFSRSAREV----SQDSSMKKA
A0A3Q2PJS5_BCL2L10      --------------------------FCNYAHGARGA----SQDSSMKTA
A0A3Q2GL87_BCL2L10      --------------------------FCNYARNAREV----SQDSSMKTA
A0A3B5MJ12_BCL2L10      --------------------------FCSYARNAREA----SQDSSMKTA
M4AUW7_BCL2L10-01       --------------------------FCSYARNAREA----SQDSSMKTA
A0A096ME02_BCL2L10      --------------------------FCSYAHNAREV----SQDSSMKTA
A0A3B3TYN4_BCL2L10      --------------------------FCSYAHNAREV----SQDSSMKTA
A0A3B3YT99_BCL2L10      --------------------------FCSYAHNAREV----SQDSSMKTA
A0A3P9NE65_BCL2L10      --------------------------FCSYALNAREV----SQDSSMKTA
A0A3P9IIZ2_BCL2L10      --------------------------FCKFSRTAREV----SQDSSMKTA
A0A3P9LM07_BCL2L10      --------------------------FCKFSRTAREV----SQDSSMKTA
H2MBQ3_BCL2L10-01       --------------------------FCKFSRTAREV----SQDSSMKTA
A0A3B4AAV4_BCL2L10      --------------------------FCEFSCHARKV----DQDSSMKTA
A0A3Q3EZT5_BCL2L10      --------------------------FCEFSRSARET----SQDSSMKTA
A0A3Q3EZT5_BCL2L10      --------------------------FCEFSRSARET----SQDSSMKTA
A0A3Q3JQ78_BCL2L10      --------------------------FCKFSRSAREV----SHDSSVKTA
A0A3B4TIY6_BCL2L10      --------------------------FCKFSHSAREV----SQDLSMKTA
A0A3B4WGF4_BCL2L10      --------------------------FCKFSHSAREV----SQDLSMKTA
A0A3Q3KZW1_BCL2L10      --------------------------FCKFSHSAREV----SHDSSMKTA
A0A3B5KD08_BCL2L10      --------------------------FCKYSLAAREV----NHDSSMKTA
A0A3Q3VI28_BCL2L10      --------------------------FCKFSHSAREA----RLDSSMKTA
A0A3Q1GM98_BCL2L10      --------------------------FCKFSLSARKA----SQDLSMKTA
A0A3Q1D2L0_BCL2L10      --------------------------FCKFSLSAREV----SQDLSMKTA
A0A3P8RL82_BCL2L10      --------------------------FCKFSLSAREV----SQDLSMKTA
A0A3B4ZFS0_BCL2L10      --------------------------FVKFSLSAREV----SQDLSMKTA
A0A3Q2UUN9_BCL2L10      --------------------------FCKFSRSAREV----SQDSSMKKA
A0A3P8PVZ8_BCL2L10      --------------------------FCKFSRSAREV----SQDSSMKKA
A0A3Q2UUN9_BCL2L10      --------------------------FCKFSRSAREV----SQDSSMKKA
A0A3P9BLI0_BCL2L10      --------------------------FCKFSRSAREV----SQDSSMKKA
A0A3Q0S9R1_BCL2L10      --------------------------FCKYSRSAREV----SQDSSMKTA
D2IT42_BCL2L10-02       --------------------------FCKFSRIAREV----NQESSMKTA
A0A3B3C5I4_BCL2L10      --------------------------FCKFSRTAREV----SQDSSMKTA
A0A3Q1IAB0_BCL2L10      --------------------------FCKFSCSAREV----SQDSSMKRA
A0A3P8W7K5_BCL2L10      --------------------------FCEFSHSAREL----SQDSSMKTA
F6VJQ0_BCL2L10-01       --------------------------FHHHFEKRQ------SPPPSDSSN
Q9Z0F3_BCL2L10-01       --------------------------FCRFFKNPLPL----GFWRRLLIQ
M3Y8D1_BCL2L10-01       --------------------------FCLFFTPAL------LSWKRLLVQ
E1B9B3_BCL2L10-01       ---------KDAGLVGSLGRAHAAGWILSLLQPLIP-----AILGKTAGL
A0A1U7QVA0_BCL2L10      --------------------------FCVIFGSPLPL----DFWSTLLIK
F1RZB9_BCL2L10-01       --------------------------FCLFFQGSLQ-----QTWTRHMVW
F1MV39_BCL2L10-01       --------------------------FCLFFSQSFQ-----PSWERQLVW
W5QIG4_BCL2L10-01       --------------------------FCLSFSHSLQ-----PSWERQLVW
Q99M66_BCL2L10-01       --------------------------FCQFFKNPLPP----GFWRRLLIR
F6ZPD4_BCL2L10-01       --------------------------FCDFSLTLP------ASQRILLVR
A0A2K6F2Q2_BCL2L10      --------------------------FCDLFRKPLPL----AVWRRLLVQ
H0WZ06_BCL2L10-01       --------------------------FCQFFRTPLPL----AFWRRLLFE
A0A1U7UZD8_BCL2L10      --------------------------FCVFFSTPLPL----TFWRRLPVQ
G1T264_BCL2L10-01       --------------------------FCVFYRTPLPL----TFWRRLLVR
A0A0D9RG38_BCL2L10      --------------------------FCHFFRSPFPL----AFWRKLLIQ
A0A2K5RIU7_BCL2L10      TRRGTR-----GGMGTREGLTHVPRWLLLLLQDLLLT----GIMEKIAGP
A0A2K5F974_BCL2L10      MRRGTRASRVAGNIG----------WLLLLLQDLLLA----GIMEKTAGP
A0A2K6TIT7_BCL2L10      TRR-----RTWGGMGTWEGPARWGIFLLCLLNDLLLA----G-MEKTAGP
F7CT87_BCL2L10-01       --------------------------FCYFFRTSSLL----ALWRKVLVQ
A0A096NM44_BCL2L10      TRRTPGRG---AGRASGKRPRGRHGWLLSLLQEPLSA----GFLEKTADP
A0A2K6R5T5_BCL2L10      TRRTPGRG---AGRASGKRPRGRHGWLLSLLQDPLSA----GFLEKTADP
Q9HD36_BCL2L10-02       TRRTPGHG---AGRAAGKRPRGWHGWLLSLLQDPLST----GFLEKTAGP
G1R3W6_BCL2L10-01       TRRTPGHG---AGRAAGKRPRGRHGWLLSLLQDPLSA----GFLEKTAGP
A0A2K5K3B0_BCL2L10      --------------------------FCHFFRTPFPL----AFWRKLLIQ
A0A2K6M5H5_BCL2L10      --------------------------FCHFFRTPFPL----AFWRKLLIQ
A0A2K5TKG9_BCL2L10      --------------------------FCHFFRSPFPL----AFWRKLLIQ
F7H6U5_BCL2L10-01       --------------------------FCHFFRSPFPL----AFWRKLLIQ
A0A2K6B2D9_BCL2L10      --------------------------FCHFFRSPFPL----AFWRKLLIQ
A0A2K5MMZ4_BCL2L10      --------------------------FCHFFRSPFPL----AFWRTLLIQ
H2NN92_BCL2L10-01       --------------------------FCHFFRTPLPL----AFWRKQLVQ
A0A2R9BCD9_BCL2L10      --------------------------FCHFFRTPFPL----AFWRKQLVQ
H2Q9G4_BCL2L10-01       --------------------------FCHFFRTPFPL----AFWRKQLVQ
G3QLU6_BCL2L10-01       --------------------------FCHFFRTPFPL----AFWRKQLVQ
A0A337RYG8_BCL2L10      --------------------------FCLFFSPMLP-----SSWRRLLVQ
G1LKR4_BCL2L10-01       --------------------------FCLFFTPMLP-----SSWKRLLAQ
A0A452QJG0_BCL2L10      --------------------------FCLFFTPMLAVRLGKDCWPRLFCP
                                                  :                       

G1QEX2_BCL2L10-01       LLRACLVLIILIC-LWIKIM------------------------------
A0A3Q4MN81_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3B4ETX9_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q2PJS5_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
A0A3Q2GL87_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
A0A3B5MJ12_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
M4AUW7_BCL2L10-01       LVAVAGVGIAGLTFLLVR--------------------------------
A0A096ME02_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
A0A3B3TYN4_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
A0A3B3YT99_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
A0A3P9NE65_BCL2L10      LVAVAGVGIAGLTFLLVR--------------------------------
A0A3P9IIZ2_BCL2L10      LFAAASVGLAGLTFLLVR--------------------------------
A0A3P9LM07_BCL2L10      LFAAASVGLAGLTFLLVR--------------------------------
H2MBQ3_BCL2L10-01       LFAAASVGLAGLTFLLVR--------------------------------
A0A3B4AAV4_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q3EZT5_BCL2L10      LFAAAGVGLAGLTFLLIRVQA-----------------------------
A0A3Q3EZT5_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q3JQ78_BCL2L10      LFAAAGVGLAGLTFLLETSGTCEREQFRKSD-------------------
A0A3B4TIY6_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3B4WGF4_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q3KZW1_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3B5KD08_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q3VI28_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q1GM98_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q1D2L0_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3P8RL82_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3B4ZFS0_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q2UUN9_BCL2L10      LFAAAGVGLAGLTFLL----------------------------------
A0A3P8PVZ8_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q2UUN9_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3P9BLI0_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3Q0S9R1_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
D2IT42_BCL2L10-02       LFAAAGVGIAGLTFLLVR--------------------------------
A0A3B3C5I4_BCL2L10      LFAAASVGLAGLTFLLVR--------------------------------
A0A3Q1IAB0_BCL2L10      LFAAAGVGLAGLTFLLVR--------------------------------
A0A3P8W7K5_BCL2L10      LFAAASVGLAGLTFLLVR--------------------------------
F6VJQ0_BCL2L10-01       NTLCCIMAAAAGFGLVGLALLLVVR-------------------------
Q9Z0F3_BCL2L10-01       AFLSGFFATAIFF-IWKRL-------------------------------
M3Y8D1_BCL2L10-01       ALLSCFTAVILIY-FWKRLPFIG---------------------------
E1B9B3_BCL2L10-01       VFPLILDSNNHNL-LLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPP
A0A1U7QVA0_BCL2L10      TFLSCVIATAILF-VWKRLL------------------------------
F1RZB9_BCL2L10-01       VFVSYCTAVVLLY-LWRKLL------------------------------
F1MV39_BCL2L10-01       FFLAYWTAIIIIY-FWIKLL------------------------------
W5QIG4_BCL2L10-01       FFLSYWTAIIIIY-FWIKLS------------------------------
Q99M66_BCL2L10-01       AILSCFFATAIFY-IWKCL-------------------------------
F6ZPD4_BCL2L10-01       FLLSCFSASVLIY-LWTKLS------------------------------
A0A2K6F2Q2_BCL2L10      VLLSCFLATTVIY-FWTRLL------------------------------
H0WZ06_BCL2L10-01       VLLLCFLATVFIY-FWTRLT------------------------------
A0A1U7UZD8_BCL2L10      AFVSCLLAMAFIYFFWTRLL------------------------------
G1T264_BCL2L10-01       TFLSCFVATALLF-AWTRVYREL---------------------------
A0A0D9RG38_BCL2L10      AFLACLLATAFGY-LWTRLL------------------------------
A0A2K5RIU7_BCL2L10      GFPVMVVNSSIHL-LLDTIIRSFKIFSPLLPAQL----------------
A0A2K5F974_BCL2L10      GFPVMVVNSSIHL-LLDTIIRSF---------------------------
A0A2K6TIT7_BCL2L10      GFPVMVVNSSIHL-LLDTIIRSFKIFSPLLPAQL----------------
F7CT87_BCL2L10-01       VFLSWLLTAVFIY-FWTR--------------------------------
A0A096NM44_BCL2L10      GFPGMLVSNSLRL-SLDTIIMSFNIFNPLLPAQL----------------
A0A2K6R5T5_BCL2L10      GFPGMLVNNSLRL-PLDTIIMSFKIFNPLLPAQL----------------
Q9HD36_BCL2L10-02       GFSVMLVNNSLHL-SLDTIIMSFKTFNPLLPAQL----------------
G1R3W6_BCL2L10-01       GFSVMLVNNSLHL-FLDTIIMSFKTFNPLLPAQL----------------
A0A2K5K3B0_BCL2L10      AFLACLLTTAFGY-LWTRLL------------------------------
A0A2K6M5H5_BCL2L10      AFLACLLTTAFGY-LWTRLL------------------------------
A0A2K5TKG9_BCL2L10      AFLACLLATAFGY-LWTRLL------------------------------
F7H6U5_BCL2L10-01       AFLACLLATAFGY-LWTRLL------------------------------
A0A2K6B2D9_BCL2L10      AFLACLLATAFGY-LWTRLL------------------------------
A0A2K5MMZ4_BCL2L10      AFLACLLATAFGY-LWTRLL------------------------------
H2NN92_BCL2L10-01       AFLSCLLTTAFIY-LWTRLL------------------------------
A0A2R9BCD9_BCL2L10      AFLSCLLTTAFIY-LWTRLL------------------------------
H2Q9G4_BCL2L10-01       AFLSCLLTTAFIY-LWTRLL------------------------------
G3QLU6_BCL2L10-01       AFLSCLLATAFIY-LWTRLL------------------------------
A0A337RYG8_BCL2L10      ALLSCFTVMILIY-FWRRLL------------------------------
G1LKR4_BCL2L10-01       ALLSCFTAVILIY-FWKRLL------------------------------
A0A452QJG0_BCL2L10      A----SQAVILIY-FWKRLCEF----------------------------
                                                                          

G1QEX2_BCL2L10-01       ---------
A0A3Q4MN81_BCL2L10      ---------
A0A3B4ETX9_BCL2L10      ---------
A0A3Q2PJS5_BCL2L10      ---------
A0A3Q2GL87_BCL2L10      ---------
A0A3B5MJ12_BCL2L10      ---------
M4AUW7_BCL2L10-01       ---------
A0A096ME02_BCL2L10      ---------
A0A3B3TYN4_BCL2L10      ---------
A0A3B3YT99_BCL2L10      ---------
A0A3P9NE65_BCL2L10      ---------
A0A3P9IIZ2_BCL2L10      ---------
A0A3P9LM07_BCL2L10      ---------
H2MBQ3_BCL2L10-01       ---------
A0A3B4AAV4_BCL2L10      ---------
A0A3Q3EZT5_BCL2L10      ---------
A0A3Q3EZT5_BCL2L10      ---------
A0A3Q3JQ78_BCL2L10      ---------
A0A3B4TIY6_BCL2L10      ---------
A0A3B4WGF4_BCL2L10      ---------
A0A3Q3KZW1_BCL2L10      ---------
A0A3B5KD08_BCL2L10      ---------
A0A3Q3VI28_BCL2L10      ---------
A0A3Q1GM98_BCL2L10      ---------
A0A3Q1D2L0_BCL2L10      ---------
A0A3P8RL82_BCL2L10      ---------
A0A3B4ZFS0_BCL2L10      ---------
A0A3Q2UUN9_BCL2L10      ---------
A0A3P8PVZ8_BCL2L10      ---------
A0A3Q2UUN9_BCL2L10      ---------
A0A3P9BLI0_BCL2L10      ---------
A0A3Q0S9R1_BCL2L10      ---------
D2IT42_BCL2L10-02       ---------
A0A3B3C5I4_BCL2L10      ---------
A0A3Q1IAB0_BCL2L10      ---------
A0A3P8W7K5_BCL2L10      ---------
F6VJQ0_BCL2L10-01       ---------
Q9Z0F3_BCL2L10-01       ---------
M3Y8D1_BCL2L10-01       ---------
E1B9B3_BCL2L10-01       SETFLSAFM
A0A1U7QVA0_BCL2L10      ---------
F1RZB9_BCL2L10-01       ---------
F1MV39_BCL2L10-01       ---------
W5QIG4_BCL2L10-01       ---------
Q99M66_BCL2L10-01       ---------
F6ZPD4_BCL2L10-01       ---------
A0A2K6F2Q2_BCL2L10      ---------
H0WZ06_BCL2L10-01       ---------
A0A1U7UZD8_BCL2L10      ---------
G1T264_BCL2L10-01       ---------
A0A0D9RG38_BCL2L10      ---------
A0A2K5RIU7_BCL2L10      ---------
A0A2K5F974_BCL2L10      ---------
A0A2K6TIT7_BCL2L10      ---------
F7CT87_BCL2L10-01       ---------
A0A096NM44_BCL2L10      ---------
A0A2K6R5T5_BCL2L10      ---------
Q9HD36_BCL2L10-02       ---------
G1R3W6_BCL2L10-01       ---------
A0A2K5K3B0_BCL2L10      ---------
A0A2K6M5H5_BCL2L10      ---------
A0A2K5TKG9_BCL2L10      ---------
F7H6U5_BCL2L10-01       ---------
A0A2K6B2D9_BCL2L10      ---------
A0A2K5MMZ4_BCL2L10      ---------
H2NN92_BCL2L10-01       ---------
A0A2R9BCD9_BCL2L10      ---------
H2Q9G4_BCL2L10-01       ---------
G3QLU6_BCL2L10-01       ---------
A0A337RYG8_BCL2L10      ---------
G1LKR4_BCL2L10-01       ---------
A0A452QJG0_BCL2L10      ---------
                                 

© 1998-2020Legal notice