Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

83 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1QEX2_BCL2L10-01       --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P8PVZ8_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P9BLI0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A4W5MLY7_BCL2L10      --------------------------------------------------
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
A0A4W6FHH7_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------MFQLSWGLFLLEAESADK
A0A3P8W7K5_BCL2L10      --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A4X2K2M5_BCL2L10      --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
A0A5F4WGS2_BCL2L10      --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
A0A4X1T1Z2_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
                                                                          

G1QEX2_BCL2L10-01       ----------------------------------DELKLRTRRLLTEFLE
A0A3Q4MN81_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3B4ETX9_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P8PVZ8_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P9BLI0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A4W5MLY7_BCL2L10      -------------------------------MS-CGLWKETLAIAEDYLS
A0A3Q2PJS5_BCL2L10      -------------------MCREPSHIAGRKMS-CGLWKETVAVAEDYMR
A0A3Q2GL87_BCL2L10      -------------------MCREPLHITGRKMS-CGLWKETVAVAEDYMR
A0A3B5MJ12_BCL2L10      -------------------------------MS-CGLWKETVVVAEDYIR
M4AUW7_BCL2L10-01       -------------------------------MS-CGLWKETVVVAEDYIR
A0A096ME02_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3B3TYN4_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIR
A0A3B3YT99_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9NE65_BCL2L10      ---------MRRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9IIZ2_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
A0A3P9LM07_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
H2MBQ3_BCL2L10-01       -------------------------------MS-CGLRKETLAVALDYLS
A0A3B4AAV4_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3JQ78_BCL2L10      -------------------MCREHLDIAGRKMS-CGLWKDTLALAEDYLS
A0A3B4TIY6_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLY
A0A3B4WGF4_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLF
A0A3Q3KZW1_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3B5KD08_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3VI28_BCL2L10      -------------------------------MS-CGLWKETLALAQDYLS
A0A3Q1GM98_BCL2L10      -------------------------------MS-CGLWKETVVLAEDYLS
A0A3Q1D2L0_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3P8RL82_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3B4ZFS0_BCL2L10      -------------------------------MS-CGLWKETLVVAEDYLS
D2IT42_BCL2L10-02       -------------------------------MS-CRLWKETLALSEDYLL
A0A3Q0S9R1_BCL2L10      -------------------------------MV-PGLWKETLGLAEDYLS
A0A4W6FHH7_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLC
A0A3B3C5I4_BCL2L10      -----------------------MDGFSAQKMS-CGLRKETLAVALDYLS
A0A3Q1IAB0_BCL2L10      CADAEGKLRVHRGSPSAVRMCREQTDIAGRKMS-CGLWKDTLALAEDYLS
A0A3P8W7K5_BCL2L10      --------MCNSASPSAVSTSSEQSDIAGRKMS-CGLWKETLAVAEDYLS
F6VJQ0_BCL2L10-01       ------------------------------MDYKCALREETARLVTDYLE
A0A4X2K2M5_BCL2L10      ------------------------------MDYKCALREETAQLVADYLD
Q9Z0F3_BCL2L10-01       -----------------------------MADSQDPLHERTRRLLSDYIF
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLE
A0A5F4WGS2_BCL2L10      --------------------------------MADPLR-----VVADYLE
A0A1U7QVA0_BCL2L10      --------------------------------MADPLRVRTRLLLTDYLT
A0A4X1T1Z2_BCL2L10      --------------------------------MADAFRERTARLLTDYLE
F1RZB9_BCL2L10-01       --------------------------------MADAFRERTARLLTDYLE
Q99M66_BCL2L10-01       --------------------------------MGDPLQDRTRRLLTDYIL
W5QIG4_BCL2L10-01       -----------------------GRPPGRGGAMVDPFRERTARLLMDWLE
F1MV39_BCL2L10-01       -------------------------VADGQESLV----ERTARLLMDYLE
A0A4W2C0F3_BCL2L10      -------------------------SADSLHSMVDPFRERTARLLMDYLE
A0A4W2C0F3_BCL2L10      -------------------------SADSLHSMVDPFRERTARLLMDYLE
A0A4W2FG99_BCL2L10      -------------------------SADSLHSMVDPFRERTARLLMDYLE
A0A4W2FG99_BCL2L10      -------------------------SADSLHSMVDPFRERTARLLMDYLE
F6ZPD4_BCL2L10-01       -------------------------------AVAEALRERTALLLIDYLQ
A0A4W2EB77_BCL2L10      --------------------------------MVDPFRERTARLLMDYLE
A0A4W2EB77_BCL2L10      --------------------------------MVDPFRERTARLLMDYLE
E1B9B3_BCL2L10-01       --------------------------MTEGGAMVDPFRERTARLLMDYLE
A0A2K6F2Q2_BCL2L10      --------------------------------MGDRFRERTERLLADYLE
H0WZ06_BCL2L10-01       --------------------------------MADPLRERTERLLTDYLE
A0A1U7UZD8_BCL2L10      --------------------------------MADPLEERTARLLADYLE
G1T264_BCL2L10-01       --------------------------------MADALEERTARLLTDYLE
A0A0D9RG38_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5RIU7_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K5F974_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K6TIT7_BCL2L10      --------------------------------MADPLQQRTEQLVADYLE
F7CT87_BCL2L10-01       --------------------------------MADPLRQRTEQLVTDYLE
A0A096NM44_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K6R5T5_BCL2L10      --------------------------------MADPLRERTERLLADYLG
Q9HD36_BCL2L10-02       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
G1R3W6_BCL2L10-01       --------------------------------MVDQLRERTERLLADYLG
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K6M5H5_BCL2L10      ----------------------MADPLRERTTVADPLRERTERLLADYLG
A0A2K5TKG9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
F7H6U5_BCL2L10-01       --------------------------------MADPLRERTERLLADYLG
A0A2K6B2D9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5MMZ4_BCL2L10      --------------------------------MADPLRERTERLLADYLG
H2NN92_BCL2L10-01       ----------------------MVDQLRERTITADLLRERTERLLADYLG
A0A2R9BCD9_BCL2L10      ----------------------MVDQWRERTTMADPLRERTERLLADYLG
H2Q9G4_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
G3QLU6_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
A0A337RYG8_BCL2L10      --------------------------------MADALRERTAQLLTDYLE
G1LKR4_BCL2L10-01       --------------------------------MADALRG-TARLLTDYLE
A0A452QJG0_BCL2L10      --------------------------------MADALRERTARLLTDYLE
                                                                   :  ::: 

G1QEX2_BCL2L10-01       HRTRRRG-----TAPQQPSTPEATVMRSLAAHSWLGTPHSWSR-------
A0A3Q4MN81_BCL2L10      FCCTSP------HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLV
A0A3B4ETX9_BCL2L10      FCCTSP------HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLV
A0A3Q2UUN9_BCL2L10      FCCTSP------HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLV
A0A3P8PVZ8_BCL2L10      FCCTSP------HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLV
A0A3Q2UUN9_BCL2L10      FCCTSP------HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLV
A0A3P9BLI0_BCL2L10      FCCTSP------HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLV
A0A4W5MLY7_BCL2L10      VCSIIPASGSRKAPPGPPPSDSAAAMRCQARDMEAKHRARFHALAHSFLC
A0A3Q2PJS5_BCL2L10      LRCSSP------HPAPPPPSEPAAAMRRLAQDVESQHQARFHALAQSFLR
A0A3Q2GL87_BCL2L10      LRCSSP------LPAPPPPSEPAAAMRRLAQDMETQHQARFHTLAQSFLR
A0A3B5MJ12_BCL2L10      LRCSSP------HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLK
M4AUW7_BCL2L10-01       LRCSSP------HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLK
A0A096ME02_BCL2L10      LRCSSP------HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLK
A0A3B3TYN4_BCL2L10      LCCSSP------HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLK
A0A3B3YT99_BCL2L10      LRCSSP------HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLK
A0A3P9NE65_BCL2L10      LRCSNP------HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLK
A0A3P9IIZ2_BCL2L10      LSCRSP------LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRK
A0A3P9LM07_BCL2L10      LSCRSP------LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRK
H2MBQ3_BCL2L10-01       LSCRSP------LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRK
A0A3B4AAV4_BCL2L10      LCCSGP------QAAPPPPSGSASAMRRLGQDMEAQHKARFHSLSQTFLK
A0A3Q3EZT5_BCL2L10      LCCTSP------RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLR
A0A3Q3EZT5_BCL2L10      LCCTSP------RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLR
A0A3Q3JQ78_BCL2L10      LCCTSS------RPAPPPPSESAAAMRCLAQDMETQHQARFHSLAQTFLK
A0A3B4TIY6_BCL2L10      LCCTSP------QPAPPPPSESAAAMRSMAQDMETQHQARFHTLAQTFVT
A0A3B4WGF4_BCL2L10      LCCTSP------QPAPPPPSESAAAMRGMAQDMETQHQARFHTLAQTFVT
A0A3Q3KZW1_BCL2L10      LCCTSP------QSVPPPPSESAAAMRCLAQKMERQHQARFHSLTQTFLK
A0A3B5KD08_BCL2L10      LCSTSQ------CPAPPPPSESATAMRHLGQDMEKQHQARFNSLAQTFLR
A0A3Q3VI28_BCL2L10      LCCTSQ------RPAPPPPSESAAAMRDLAQDMEKQHQARFHSLAQTFLR
A0A3Q1GM98_BCL2L10      LCCAGP------HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQAFLR
A0A3Q1D2L0_BCL2L10      LCCASP------HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLR
A0A3P8RL82_BCL2L10      LCCASP------HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLR
A0A3B4ZFS0_BCL2L10      LCCTSP------HSAPPPPSESAAAMRCLAQDMEKQHQARFHSLTQTFLR
D2IT42_BCL2L10-02       SCTAST------GTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLA
A0A3Q0S9R1_BCL2L10      LCCTSP------HQVPPPPSESAAAMRRLGQDIERQHQARFDNLAQTFLR
A0A4W6FHH7_BCL2L10      LCCTSP------GPAPPPPSESAAAMRRIAQDMETQHQARFHSLAQTLLR
A0A3B3C5I4_BCL2L10      LSCRSPV-----LQAPPPPSESASAMRRLAQDMETQYQPRFSTLAQDFRK
A0A3Q1IAB0_BCL2L10      LCCTSP------WPAPPPPSESAAAMRRLAQDMEKQHQVRFHSLAQTFLK
A0A3P8W7K5_BCL2L10      LCCSSP------RPAPPPPSESAAAMRHLAQDMEKQHQARFQTLSQSFLR
F6VJQ0_BCL2L10-01       YCCRREG-----VQELPAPTPAAATLRLVSSELRQIYQDFFEC----ALN
A0A4X2K2M5_BCL2L10      YCCRREG-----FQERPPTTPAAATMRSVAKELRRRYQDFFEC----AQN
Q9Z0F3_BCL2L10-01       FCAREPD-----TPEPPPTSVEAALLRSVTRQIQQEHQEFFSS----FCE
M3Y8D1_BCL2L10-01       YCARGPG-----TPARSPSTREAAVLRSVAAVVRQRHERFLSD----YRG
A0A5F4WGS2_BCL2L10      CCFREPG-----TPESPPSTAEAAVLRAMAAGVRKLYRSFFSA----YLL
A0A1U7QVA0_BCL2L10      FCAREPG-----DPEPPPTSAEAALLRSVAEQIQQQHHFFFSS----FVG
A0A4X1T1Z2_BCL2L10      YCAREPG-----TAARQPSSPEAAVLRCVAAQIREYNVRTLSV----YRG
F1RZB9_BCL2L10-01       YCAREPG-----TAARQPSSPEAAVLRCVAAQIREYNVRTLSV----YRG
Q99M66_BCL2L10-01       FCARAPN-----TPEPLPTSVEAALLRSVTSQIQQEHQDLFNS----FRD
W5QIG4_BCL2L10-01       FCAREPG-----TPAPAPSTPEAAVLRHVAARVLEANRNVLPL----YRR
F1MV39_BCL2L10-01       FCAREPG-----TPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
A0A4W2C0F3_BCL2L10      FCAREPG-----TPVPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
A0A4W2C0F3_BCL2L10      FCAREPG-----TPVPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
A0A4W2FG99_BCL2L10      FCAREPG-----TPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
A0A4W2FG99_BCL2L10      FCAREPG-----TPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
F6ZPD4_BCL2L10-01       RRAREPA-----TP-------EVAVLRCVAAQIQPRNQRVLSR----YRG
A0A4W2EB77_BCL2L10      FCAREPG-----TPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
A0A4W2EB77_BCL2L10      FCAREPG-----TPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
E1B9B3_BCL2L10-01       FCAREPG-----TPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRR
A0A2K6F2Q2_BCL2L10      YCTREPG-----APGLPPSSLEAAAMRFAATKIRRKHASFFSA----YVG
H0WZ06_BCL2L10-01       YCARDPT-----APEPTPSSPEAALLRSVTAYIQQRHWSFFSA----YIG
A0A1U7UZD8_BCL2L10      YCARPPG-----SPEPRPSSPEAAVLRSTAARLRQRHASFFSA----FVD
G1T264_BCL2L10-01       CCAREPG-----TPEPQPSTPEAAVLRCAATQLQRVHWPFFSV----YRG
A0A0D9RG38_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLG
A0A2K5RIU7_BCL2L10      YCSREPG-----TPESPPATAEAAVLRATAAGVRKVYRSFFSA----YLG
A0A2K5F974_BCL2L10      YCSQEPG-----TPESPPSTAEAAVLRAMAAGVRKLYRSFFSA----YLG
A0A2K6TIT7_BCL2L10      YCSREPG-----TPESPPATAEAAVLRATAAVVRKLYPSFFSA----YRG
F7CT87_BCL2L10-01       YCSREPG-----TPESPPSTAEAAVLRAVAASVRKLYRSFFSA----YLG
A0A096NM44_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRG
A0A2K6R5T5_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLG
Q9HD36_BCL2L10-02       YCAREPG-----TPEPAPSTPEAAVLRSAAARLRQIHRSFFSA----YLG
G1R3W6_BCL2L10-01       CCAREPG-----TPEPTPSTPEAAMLRSAAARLRQLHPSFFSA----YLG
A0A2K5K3B0_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLG
A0A2K6M5H5_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLG
A0A2K5TKG9_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRG
F7H6U5_BCL2L10-01       CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRG
A0A2K6B2D9_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRG
A0A2K5MMZ4_BCL2L10      CCAREPG-----TPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRG
H2NN92_BCL2L10-01       CCAREPG-----TPEPTPPTPEAAVLRSAAARLRQLHRSFFSA----YLG
A0A2R9BCD9_BCL2L10      YCAREPG-----TPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLG
H2Q9G4_BCL2L10-01       YCAREPG-----TPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLG
G3QLU6_BCL2L10-01       YCAREPG-----TPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLG
A0A337RYG8_BCL2L10      YCAREPG-----SPARTPSTPEAAVLRYLAAQIRQRHQRFLSA----YRG
G1LKR4_BCL2L10-01       YCAREPG-----TPARAPSTPEAAVLRSVAAQVQQRHERFLSD----YRG
A0A452QJG0_BCL2L10      YCAREPG-----TPARAPSTPEAAVLRSVAAQVQQRHEHFLSD----YRG
                                              .: :*                       

G1QEX2_BCL2L10-01       -RQRNRLEQMVDQIESLVPDGTDPNWLSVVALVSFAGALLERPP------
A0A3Q4MN81_BCL2L10      QCGPDHCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQ
A0A3B4ETX9_BCL2L10      QCGPDHCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQ
A0A3Q2UUN9_BCL2L10      QCGPDHCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQ
A0A3P8PVZ8_BCL2L10      QCGPDHCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQ
A0A3Q2UUN9_BCL2L10      QCGPDHCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQ
A0A3P9BLI0_BCL2L10      QCGPDHCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQ
A0A4W5MLY7_BCL2L10      QCGPNPCASLRRVMEELVGDGQ-MNWGRVVSLFTFTGVLVRE----LQ--
A0A3Q2PJS5_BCL2L10      HSQTDLCTSLWKVMDEMVGDGH-FNWGRVVSLFTFAGVLARQ----LQEQ
A0A3Q2GL87_BCL2L10      HSGTDLCSSLRKVMDEMVGDGL-FNWGRVVSLFTFAGVLARQ----LQEQ
A0A3B5MJ12_BCL2L10      HCGSDLCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQ
M4AUW7_BCL2L10-01       HCGSDLCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQ
A0A096ME02_BCL2L10      HCGTDLCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQ
A0A3B3TYN4_BCL2L10      HCGTDLCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQ
A0A3B3YT99_BCL2L10      HCGTDLCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQ
A0A3P9NE65_BCL2L10      HCGTDLCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQ
A0A3P9IIZ2_BCL2L10      HSGQDLCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQ
A0A3P9LM07_BCL2L10      HSGPDLCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQ
H2MBQ3_BCL2L10-01       HSGPDLCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQ
A0A3B4AAV4_BCL2L10      QCGPDPCSSLRKVMEELVGDGH-LNWGRVVSLFTFAGVLARH----IKEQ
A0A3Q3EZT5_BCL2L10      QCGPDPCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQ
A0A3Q3EZT5_BCL2L10      QCGPDPCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQ
A0A3Q3JQ78_BCL2L10      QCGPDPCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARQ----LTEQ
A0A3B4TIY6_BCL2L10      QCGLDPCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQ
A0A3B4WGF4_BCL2L10      QCGLDPCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQ
A0A3Q3KZW1_BCL2L10      QCGPDPCSSLRKVIEELVADGH-LNWGRVVSLFTFTGVLSRQ----LMEQ
A0A3B5KD08_BCL2L10      QCGPDLCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARL----MQEQ
A0A3Q3VI28_BCL2L10      QCGTDPCSSLRNVMEELVGDGH-LNWGRVVSIFTFTGVLARQ----LLEQ
A0A3Q1GM98_BCL2L10      QCGPDFCSSLRMVMEELVEDGH-LNWGRVVSLFTFTGVLARQ----LLEQ
A0A3Q1D2L0_BCL2L10      QCGPDLCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQ
A0A3P8RL82_BCL2L10      QCGPDLCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQ
A0A3B4ZFS0_BCL2L10      QPGPDLCSSLRRVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQ
D2IT42_BCL2L10-02       QCEADACAGLRKVMEELVGDGQ-LNWGRVVSLFTFTGVLARQ----LQEK
A0A3Q0S9R1_BCL2L10      HCGPDHCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARK----RLEQ
A0A4W6FHH7_BCL2L10      QCGPDPCSSLRKVMEELVGDGR-LNWGRVVSLFTFTGVLARQ----LQEQ
A0A3B3C5I4_BCL2L10      HCGPDLCSSLRKVMEELVGDEH-LNWGRVVSLFAFVGVLARQ----LREQ
A0A3Q1IAB0_BCL2L10      QCGPDPCSSLRKVMEELVGDGH-MNWGRVVSLFTFTGVLARQ----MLEQ
A0A3P8W7K5_BCL2L10      QCGSEPCVCLRKVMEELVGDGH-LNWGRVVSIFTFTGVLAKQ----LLVQ
F6VJQ0_BCL2L10-01       Q-LLDREPEQVIVNVAELMDRGEFNWGRVAVLVVFAGALLEMEE------
A0A4X2K2M5_BCL2L10      Q-LLDQSPEQVIIEVAELMSQGEFNWGRVAVLVVFAGALLEMEE------
Q9Z0F3_BCL2L10-01       S-RGNRLELVKQMADKLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVK-
M3Y8D1_BCL2L10-01       Y-GGNRVELVAQLEREILAHPQALSWGRVVALVTFAGTLLERPPSGACSN
A0A5F4WGS2_BCL2L10      Y-PGNRGELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTA
A0A1U7QVA0_BCL2L10      Y-QGNRVELMTQMVDAVLPDGQDLNWGRLVLLLAFAGTIVSQE-------
A0A4X1T1Z2_BCL2L10      F-RWNRVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLERHP--R---
F1RZB9_BCL2L10-01       F-RWNRVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLERHP--REA-
Q99M66_BCL2L10-01       Y-QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDR--TVK-
W5QIG4_BCL2L10-01       Y-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQP--QTT-
F1MV39_BCL2L10-01       C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
A0A4W2C0F3_BCL2L10      C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
A0A4W2C0F3_BCL2L10      C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
A0A4W2FG99_BCL2L10      C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
A0A4W2FG99_BCL2L10      C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
F6ZPD4_BCL2L10-01       F-RGDHVGLAARMAQAIFGDRHVPSWGRVAALVTLAGTLLERAP--RGTY
A0A4W2EB77_BCL2L10      C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
A0A4W2EB77_BCL2L10      C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
E1B9B3_BCL2L10-01       C-RRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT-
A0A2K6F2Q2_BCL2L10      Y-PGNRVYLLERMAEAVLCDS--LSWGRVVMLVTFAGTLLERGP--PVTA
H0WZ06_BCL2L10-01       Y-PGNRVQVVERMVKAMLSDNQRLNWGRVVTLVTFAGTLLQRPP--VEAR
A0A1U7UZD8_BCL2L10      Y-PGSRVDLTARMADAVLSGSRDLSWGRVVTLVTFAGTLLERGP--LLPA
G1T264_BCL2L10-01       Y-PGNRIELAARVAEAVLSDGHDLSWGRVVTLVTFAGTLLDRGP--PVTT
A0A0D9RG38_BCL2L10      Y-PGNRVELVALMADAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LMTA
A0A2K5RIU7_BCL2L10      Y-PGNRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTA
A0A2K5F974_BCL2L10      Y-PGNRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTA
A0A2K6TIT7_BCL2L10      Y-PRNRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTA
F7CT87_BCL2L10-01       Y-PGNRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTA
A0A096NM44_BCL2L10      Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
A0A2K6R5T5_BCL2L10      Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
Q9HD36_BCL2L10-02       Y-PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTA
G1R3W6_BCL2L10-01       Y-PGNRVELVVLMADSVLSDSPGPTWGRVVTLVAFAGTLLERGP--LVTA
A0A2K5K3B0_BCL2L10      Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
A0A2K6M5H5_BCL2L10      Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
A0A2K5TKG9_BCL2L10      Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
F7H6U5_BCL2L10-01       Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
A0A2K6B2D9_BCL2L10      Y-PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
A0A2K5MMZ4_BCL2L10      Y-RGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTA
H2NN92_BCL2L10-01       Y-PGNRVELVALMADSVLSDSPSPTWGRVVTLVTFAGTLLERGP--LVTA
A0A2R9BCD9_BCL2L10      Y-PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTT
H2Q9G4_BCL2L10-01       Y-PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTT
G3QLU6_BCL2L10-01       Y-PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTA
A0A337RYG8_BCL2L10      Y-RGNRVELVARLEQDLLSNPQTLSWGHVVALLTFAGTLLERPP--PGTY
G1LKR4_BCL2L10-01       YAGGNRVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTY
A0A452QJG0_BCL2L10      Y-GGNRVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTY
                                         .      .*  :. :. :.* :           

G1QEX2_BCL2L10-01       ----PGHSQ--ARREWDATVDQD-CQRLVTFLCSWLTE-THRTWMEAQGG
A0A3Q4MN81_BCL2L10      K---PGLDP--GQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDG
A0A3B4ETX9_BCL2L10      K---PGLDP--GQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDG
A0A3Q2UUN9_BCL2L10      K---PGLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDG
A0A3P8PVZ8_BCL2L10      K---PGLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDG
A0A3Q2UUN9_BCL2L10      K---PGLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDG
A0A3P9BLI0_BCL2L10      K---PGLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDG
A0A4W5MLY7_BCL2L10      -----GEDTDQALGNGMGLGGKESCRALAETIADYLGE-EKSDWMLENKG
A0A3Q2PJS5_BCL2L10      QGRSPGPDP--GRQQ----EP-VSCRELAETIADYLEK-HKKDWLQENDG
A0A3Q2GL87_BCL2L10      TGKNPGLDP--GRQQELQTEP-VSCRALAETIADYLET-HKKDWLQENNG
A0A3B5MJ12_BCL2L10      TGKNPVPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNG
M4AUW7_BCL2L10-01       TGKNPVPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNG
A0A096ME02_BCL2L10      TGKNPGPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNG
A0A3B3TYN4_BCL2L10      TGKNPGPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNG
A0A3B3YT99_BCL2L10      TGKNPGPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNG
A0A3P9NE65_BCL2L10      TGKNPGPDS--GKQQELQQET-VSCRALAETIADYLEK-HKKDWLQENNG
A0A3P9IIZ2_BCL2L10      TDMNPGLDP----GREVAAGP-VSCQALAETVADFLGG-DKKEWMLENDG
A0A3P9LM07_BCL2L10      TDMNPGLDP----GREVAPGP-VSCQALAETVADFLGG-DKKEWMLENDG
H2MBQ3_BCL2L10-01       TDMNPGLDP----GREVAPGP-VSCQALAETVADFLGG-DKKEWMLENDG
A0A3B4AAV4_BCL2L10      KSSRPGLDP--GQVQGLGQVP-SDCRRLAQTIADYLGE-EKRDWLLENGG
A0A3Q3EZT5_BCL2L10      EDVKLGLDP--VQGQKLGQGP-GHCRGLAETIADYLGE-EKKEWLLENDG
A0A3Q3EZT5_BCL2L10      EDVKLGLDP--VQGQKLGQGP-GHCRGLAETIADYLGE-EKKEWLLENDG
A0A3Q3JQ78_BCL2L10      NGMKPGLDP--GQGQELGQGP-GNCRELAETIADYLGE-EKKDWLLENDG
A0A3B4TIY6_BCL2L10      NRVNPGLDP--GQGQGLG-----NCRGLAETIADYLGE-EKKDWLLENGG
A0A3B4WGF4_BCL2L10      NRVNPGLDP--GQGQGLR-----NCRGLAETIADYLGE-EKKDWLLENGG
A0A3Q3KZW1_BCL2L10      KGMKPGLDS--GKGQELGQGP-ESCRGLAETIADYLGE-EKKDWLQENDG
A0A3B5KD08_BCL2L10      KSTKPGLDP--GQEQQLGQVP-ENCRGLAETIADYLGE-EKKDWLLENGG
A0A3Q3VI28_BCL2L10      KSTKPGLEPRQDQDQELGQVP-GNCSELAETIADYLGE-EKKAWLLENDG
A0A3Q1GM98_BCL2L10      KDTKPGLDP--GKRQELGQRP-VNCRGLAETIADYLGE-EKKDWLLENDG
A0A3Q1D2L0_BCL2L10      KDTKLGLDP--GKQQELGQGP-VNCRELAETIADYLGE-EKKDWLLENDG
A0A3P8RL82_BCL2L10      KDTKPGLDP--GKQQELGQGP-VNCRELAETIADYLGE-EKKDWLLENDG
A0A3B4ZFS0_BCL2L10      RDTKPGLEP--GKRQELGQGP-VNCRGLAETIADYLGE-EKKDWLLENDG
D2IT42_BCL2L10-02       KGVQLGQDP--GTGRALGQVPGGSCRGLAETIADYLGE-EKRDWLLENGG
A0A3Q0S9R1_BCL2L10      K---PGLDP--GQQQELGQEP-ISCRELAETIADYLGE-EKKDWLLDNDG
A0A4W6FHH7_BCL2L10      R---LGLDP--RQGQELGQEP-GNCRELAETIADYLGE-EKKDWLLENDG
A0A3B3C5I4_BCL2L10      TDTNPGLDL----GREAAPGP-VSCQALAETVADFLGG-DKKEWMLENDG
A0A3Q1IAB0_BCL2L10      KDKKPGLDL--GKGQELGQEP-GQCRGLAETIADYLGE-EKKDWLLENDG
A0A3P8W7K5_BCL2L10      KGLKPGQEP--EAGQELGPEP-GTCRELAETIADYLGE-EKKAWLLENGG
F6VJQ0_BCL2L10-01       --------L--LKEEQVLQLRRETSRRLTEKLCNYLVE-RKGAWLHENGG
A0A4X2K2M5_BCL2L10      --------P--QKEERVQPLRREMSRRLTEELCNYLVE-KKGAWLQEHGG
Q9Z0F3_BCL2L10-01       -------QK--RDLGNRVIVTRD-CCLIVNFLYNLLMGRRHRARLEALGG
M3Y8D1_BCL2L10-01       LGPDPELEL--ELGEWEASVRQD-CRRLVDFLCGRLTG-QHRAWLEAHGG
A0A5F4WGS2_BCL2L10      RWKKWGFRS--WLKEPEGDVARD-CQRLVALMSPRLVG-QHRAWLEAQGG
A0A1U7QVA0_BCL2L10      -------QR--NRLKDKMKVLQD-CQLIVALLCNRLLR-RHRSWLEAQGG
A0A4X1T1Z2_BCL2L10      --------------------SRD-CRLLVALLCAQLSG-QHRTWLLANGG
F1RZB9_BCL2L10-01       --------C--GRKKKEGNVSRD-CRLLVALLCAQLSG-QHRTWLLANGG
Q99M66_BCL2L10-01       -------RR--RDQRNRLLLERD-CYLIVSLLYNRLTG-RHRSWLEAHGG
W5QIG4_BCL2L10-01       --------R--RQKRDDGSVSRD-CRLLVALLCAQFCE-RHRAWLMANGG
F1MV39_BCL2L10-01       --------R--RQKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMANGG
A0A4W2C0F3_BCL2L10      --------R--RQKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMANGG
A0A4W2C0F3_BCL2L10      --------R--RQKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMANGG
A0A4W2FG99_BCL2L10      --------R--RQKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMANGG
A0A4W2FG99_BCL2L10      --------R--RQKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMANGG
F6ZPD4_BCL2L10-01       RKPKRGYKL--ELREWKAGVDRD-WPRLVDFLCAWLKG-RHRAWLEAHYG
A0A4W2EB77_BCL2L10      -------RR--QEKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMTNGG
A0A4W2EB77_BCL2L10      -------RR--QEKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMTNGG
E1B9B3_BCL2L10-01       -------RR--QEKRDDDGVSRD-CRLLVALLCAQFCE-RHRAWLMTNGG
A0A2K6F2Q2_BCL2L10      WWKKWGLQP--QPKEGDPEVARD-RQRLVALLCARLAG-QHRAWLQAQGG
H0WZ06_BCL2L10-01       REKQD--KS--QLKEGEDEVARD-CQRLVALLSSRLVG-QHRVWLEAQGG
A0A1U7UZD8_BCL2L10      GGQQRGFRP--RRKKEEGDVARD-CQRLVALLSARLAG-RHRAWLQAQGG
G1T264_BCL2L10-01       Q------------RVRRNEIARD-CQRLVALLCARLAG-QHRAWLQAQGG
A0A0D9RG38_BCL2L10      WWKKQSFQP--RL-EQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
A0A2K5RIU7_BCL2L10      RWKKWGFQS--RLKEPEGNVSRD-RQRLVGLLSSRLVG-QHRAWLEAQGG
A0A2K5F974_BCL2L10      RWKKWGFQS--RLKEPEGDVARD-CQRLVALLSSRLVG-QHRAWLEAQGG
A0A2K6TIT7_BCL2L10      RWKKWGFQS--RLKEPEGDVARD-CQRLVGLLSSRLVG-QHRAWLEAQGG
F7CT87_BCL2L10-01       RWKKWGFQS--RLKEPEGDVARD-CQRLVALLSSRLVG-QHRAWLEAQGG
A0A096NM44_BCL2L10      WWKKRSFQP--RLKEQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
A0A2K6R5T5_BCL2L10      WWKKRSFQP--RLKEQEGEVARD-CQRLVALLSSRLTG-QHRAWLQAQGG
Q9HD36_BCL2L10-02       RWKKWGFQP--RLKEQEGDVARD-CQRLVALLSSRLMG-QHRAWLQAQGG
G1R3W6_BCL2L10-01       RWKKWGFQP--RLKEQEGDVARD-CQRLVALLSSRLVG-QHRAWLQAQGG
A0A2K5K3B0_BCL2L10      WWKKRSFQP--RLKEQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
A0A2K6M5H5_BCL2L10      WWKKRSFQP--RLKEQEGDVARD-CQRLVALLSSRLTG-QHRAWLQAQGG
A0A2K5TKG9_BCL2L10      WWKKRGFQP--RLKEQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
F7H6U5_BCL2L10-01       WWKKRGFQP--RLKEQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
A0A2K6B2D9_BCL2L10      WWKKRGFQP--RLKEQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
A0A2K5MMZ4_BCL2L10      WWKKRGFQP--RLKEQEGDVARD-CQRLVALLSSRLAG-QHRAWLQAQGG
H2NN92_BCL2L10-01       RWKKWGFQP--RLKEQEGDVARD-CQRLVALLSSRLVG-QHRAWLQAQGG
A0A2R9BCD9_BCL2L10      RWKKWGFQP--RLKEQEGDVARD-CQRLVALLSSRLVG-QHRAWLQAQGG
H2Q9G4_BCL2L10-01       RWKKWGFQP--RLNEQEGDVARD-CQRLVALLSSRLVG-QHRAWLQAQGG
G3QLU6_BCL2L10-01       RWKKWGFQP--RLKEQEGDVARD-CQRLVALLSSRLMG-QHRAWLQAQGG
A0A337RYG8_BCL2L10      LNLTPDQQQ--EL-EWETNVGQD-CQHLVALLCNRLTG-RHRAWLEAHDG
G1LKR4_BCL2L10-01       SNLGPDQEL--ELGEWEAGVRQD-CRHLVDFLCNRLTG-QHRAWLEAHDG
A0A452QJG0_BCL2L10      SNLGPDQEL--ELGEREAGVRQD-CRHLVDFLCNRLTG-QHRAWLEAHDG
                                                   :.  :   :    :  .:    *

G1QEX2_BCL2L10-01       W-DG--------------------------FCHNFMPAP------PPGDR
A0A3Q4MN81_BCL2L10      W-EG--------------------------FCKFSRSAREVSQDSSMKKA
A0A3B4ETX9_BCL2L10      W-EG--------------------------FCKFSRSAREVSQDSSMKKA
A0A3Q2UUN9_BCL2L10      W-EG--------------------------FCKFSRSAREVSQDSSMKKA
A0A3P8PVZ8_BCL2L10      W-EG--------------------------FCKFSRSAREVSQDSSMKKA
A0A3Q2UUN9_BCL2L10      W-EG--------------------------FCKFSRSAREVSQDSSMKKA
A0A3P9BLI0_BCL2L10      W-EG--------------------------FCKFSRSAREVSQDSSMKKA
A0A4W5MLY7_BCL2L10      W-EG--------------------------FCKFFHTAREVNQDSSMKTA
A0A3Q2PJS5_BCL2L10      W-DG--------------------------FCNYAHGARGASQDSSMKTA
A0A3Q2GL87_BCL2L10      W-DG--------------------------FCNYARNAREVSQDSSMKTA
A0A3B5MJ12_BCL2L10      W-EG--------------------------FCSYARNAREASQDSSMKTA
M4AUW7_BCL2L10-01       W-EG--------------------------FCSYARNAREASQDSSMKTA
A0A096ME02_BCL2L10      W-DG--------------------------FCSYAHNAREVSQDSSMKTA
A0A3B3TYN4_BCL2L10      W-DG--------------------------FCSYAHNAREVSQDSSMKTA
A0A3B3YT99_BCL2L10      W-DG--------------------------FCSYAHNAREVSQDSSMKTA
A0A3P9NE65_BCL2L10      W-DG--------------------------FCSYALNAREVSQDSSMKTA
A0A3P9IIZ2_BCL2L10      W-EG--------------------------FCKFSRTAREVSQDSSMKTA
A0A3P9LM07_BCL2L10      W-EG--------------------------FCKFSRTAREVSQDSSMKTA
H2MBQ3_BCL2L10-01       W-EG--------------------------FCKFSRTAREVSQDSSMKTA
A0A3B4AAV4_BCL2L10      W-VG--------------------------FCEFSCHARKVDQDSSMKTA
A0A3Q3EZT5_BCL2L10      W-EG--------------------------FCEFSRSARETSQDSSMKTA
A0A3Q3EZT5_BCL2L10      W-EG--------------------------FCEFSRSARETSQDSSMKTA
A0A3Q3JQ78_BCL2L10      W-EG--------------------------FCKFSRSAREVSHDSSVKTA
A0A3B4TIY6_BCL2L10      W-EG--------------------------FCKFSHSAREVSQDLSMKTA
A0A3B4WGF4_BCL2L10      W-EG--------------------------FCKFSHSAREVSQDLSMKTA
A0A3Q3KZW1_BCL2L10      W-EG--------------------------FCKFSHSAREVSHDSSMKTA
A0A3B5KD08_BCL2L10      W-EG--------------------------FCKYSLAAREVNHDSSMKTA
A0A3Q3VI28_BCL2L10      W-EG--------------------------FCKFSHSAREARLDSSMKTA
A0A3Q1GM98_BCL2L10      W-EG--------------------------FCKFSLSARKASQDLSMKTA
A0A3Q1D2L0_BCL2L10      W-EG--------------------------FCKFSLSAREVSQDLSMKTA
A0A3P8RL82_BCL2L10      W-EG--------------------------FCKFSLSAREVSQDLSMKTA
A0A3B4ZFS0_BCL2L10      W-EG--------------------------FVKFSLSAREVSQDLSMKTA
D2IT42_BCL2L10-02       W-EG--------------------------FCKFSRIAREVNQESSMKTA
A0A3Q0S9R1_BCL2L10      W-EG--------------------------FCKYSRSAREVSQDSSMKTA
A0A4W6FHH7_BCL2L10      W-EG--------------------------FCKFSHAAREVNHDSSMKTV
A0A3B3C5I4_BCL2L10      W-EG--------------------------FCKFSRTAREVSQDSSMKTA
A0A3Q1IAB0_BCL2L10      W-EG--------------------------FCKFSCSAREVSQDSSMKRA
A0A3P8W7K5_BCL2L10      W-EG--------------------------FCEFSHSARELSQDSSMKTA
F6VJQ0_BCL2L10-01       W-TG--------------------------FHHHFEKRQ------SPPPS
A0A4X2K2M5_BCL2L10      W-TG--------------------------FHHHFTQKQ------SSPQS
Q9Z0F3_BCL2L10-01       W-DG--------------------------FCRFFKNPLPL----GFWRR
M3Y8D1_BCL2L10-01       W-DG--------------------------FCLFFTPAL------LSWKR
A0A5F4WGS2_BCL2L10      W-DG--------------------------FCYFFRTSYSL----ALWRK
A0A1U7QVA0_BCL2L10      W-DG--------------------------FCVIFGSPLPL----DFWST
A0A4X1T1Z2_BCL2L10      W-DG--------------------------FCLFFQGSLQ-----QTWTR
F1RZB9_BCL2L10-01       W-DG--------------------------FCLFFQGSLQ-----QTWTR
Q99M66_BCL2L10-01       W-DG--------------------------FCQFFKNPLPP----GFWRR
W5QIG4_BCL2L10-01       W-DG--------------------------FCLSFSHSLQ-----PSWER
F1MV39_BCL2L10-01       W-DG--------------------------FCLFFSQSFQ-----PSWER
A0A4W2C0F3_BCL2L10      W-DG--------------------------FCLFFSQSFQ-----PSWER
A0A4W2C0F3_BCL2L10      W-DG--------------------------FCLFFSQSFQ-----PSWER
A0A4W2FG99_BCL2L10      W-DG--------------------------FCLFFSQSFQ-----PSWER
A0A4W2FG99_BCL2L10      W-DG--------------------------FCLFFSQSFQ-----PSWER
F6ZPD4_BCL2L10-01       W-DG--------------------------FCDFSLTLP------ASQRI
A0A4W2EB77_BCL2L10      W-DG---------------------------FCLFFPLIP-----PSWER
A0A4W2EB77_BCL2L10      W-DG---------------------------FCLFFPLIP-----PSWER
E1B9B3_BCL2L10-01       W-VS--------AKDAGLVGSLGRAHAAGWILSLLQPLIP-----AILGK
A0A2K6F2Q2_BCL2L10      W-DG--------------------------FCDLFRKPLPL----AVWRR
H0WZ06_BCL2L10-01       W-DG--------------------------FCQFFRTPLPL----AFWRR
A0A1U7UZD8_BCL2L10      W-DG--------------------------FCVFFSTPLPL----TFWRR
G1T264_BCL2L10-01       W-DG--------------------------FCVFYRTPLPL----TFWRR
A0A0D9RG38_BCL2L10      W-DG--------------------------FCHFFRSPFPL----AFWRK
A0A2K5RIU7_BCL2L10      W-VSTRRGTR-----GGMGTREGLTHVPRWLLLLLQDLLLT----GIMEK
A0A2K5F974_BCL2L10      W-VSMRRGTRASRVAGNIG----------WLLLLLQDLLLA----GIMEK
A0A2K6TIT7_BCL2L10      W-VSTRR-----RTWGGMGTWEGPARWGIFLLCLLNDLLLA----G-MEK
F7CT87_BCL2L10-01       W-DG--------------------------FCYFFRTSSLL----ALWRK
A0A096NM44_BCL2L10      W-VSTRRTPGRG---AGRASGKRPRGRHGWLLSLLQEPLSA----GFLEK
A0A2K6R5T5_BCL2L10      W-VSTRRTPGRG---AGRASGKRPRGRHGWLLSLLQDPLSA----GFLEK
Q9HD36_BCL2L10-02       W-VSTRRTPGHG---AGRAAGKRPRGWHGWLLSLLQDPLST----GFLEK
G1R3W6_BCL2L10-01       W-VSTRRTPGHG---AGRAAGKRPRGRHGWLLSLLQDPLSA----GFLEK
A0A2K5K3B0_BCL2L10      W-DG--------------------------FCHFFRTPFPL----AFWRK
A0A2K6M5H5_BCL2L10      W-DG--------------------------FCHFFRTPFPL----AFWRK
A0A2K5TKG9_BCL2L10      W-DG--------------------------FCHFFRSPFPL----AFWRK
F7H6U5_BCL2L10-01       W-DG--------------------------FCHFFRSPFPL----AFWRK
A0A2K6B2D9_BCL2L10      W-DG--------------------------FCHFFRSPFPL----AFWRK
A0A2K5MMZ4_BCL2L10      W-DG--------------------------FCHFFRSPFPL----AFWRT
H2NN92_BCL2L10-01       W-DG--------------------------FCHFFRTPLPL----AFWRK
A0A2R9BCD9_BCL2L10      W-DG--------------------------FCHFFRTPFPL----AFWRK
H2Q9G4_BCL2L10-01       W-DG--------------------------FCHFFRTPFPL----AFWRK
G3QLU6_BCL2L10-01       W-DG--------------------------FCHFFRTPFPL----AFWRK
A0A337RYG8_BCL2L10      W-DG--------------------------FCLFFSPMLP-----SSWRR
G1LKR4_BCL2L10-01       W-DG--------------------------FCLFFTPMLP-----SSWKR
A0A452QJG0_BCL2L10      WVNG--------------------------FCLFFTPMLAVRLGKDCWPR
                        *  .                                              

G1QEX2_BCL2L10-01       LLAPLLRACL--------------VLIILIC-LWIKIM------------
A0A3Q4MN81_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3B4ETX9_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q2UUN9_BCL2L10      LFAAAGVGLA-----------------GLTF-LL----------------
A0A3P8PVZ8_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q2UUN9_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3P9BLI0_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A4W5MLY7_BCL2L10      LFAAAGVGIA-----------------GLTF-LLVR--------------
A0A3Q2PJS5_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A3Q2GL87_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A3B5MJ12_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
M4AUW7_BCL2L10-01       LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A096ME02_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A3B3TYN4_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A3B3YT99_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A3P9NE65_BCL2L10      LVAVAGVGIA-----------------GLTF-LLVR--------------
A0A3P9IIZ2_BCL2L10      LFAAASVGLA-----------------GLTF-LLVR--------------
A0A3P9LM07_BCL2L10      LFAAASVGLA-----------------GLTF-LLVR--------------
H2MBQ3_BCL2L10-01       LFAAASVGLA-----------------GLTF-LLVR--------------
A0A3B4AAV4_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q3EZT5_BCL2L10      LFAAAGVGLA-----------------GLTF-LLIRVQA-----------
A0A3Q3EZT5_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q3JQ78_BCL2L10      LFAAAGVGLA-----------------GLTF-LLETSGTCEREQFRKSD-
A0A3B4TIY6_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3B4WGF4_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q3KZW1_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3B5KD08_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q3VI28_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q1GM98_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3Q1D2L0_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3P8RL82_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3B4ZFS0_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
D2IT42_BCL2L10-02       LFAAAGVGIA-----------------GLTF-LLVR--------------
A0A3Q0S9R1_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A4W6FHH7_BCL2L10      LVAAAGVGLA-----------------GLTF-LMVR--------------
A0A3B3C5I4_BCL2L10      LFAAASVGLA-----------------GLTF-LLVR--------------
A0A3Q1IAB0_BCL2L10      LFAAAGVGLA-----------------GLTF-LLVR--------------
A0A3P8W7K5_BCL2L10      LFAAASVGLA-----------------GLTF-LLVR--------------
F6VJQ0_BCL2L10-01       DSSNNTLCCI--------------MAAAAGF-GLVGLALLLVVR------
A0A4X2K2M5_BCL2L10      DPS-STLCCI--------------MAAAAGF-GLVGLALLLAVR------
Q9Z0F3_BCL2L10-01       LLIQAFLSGF--------------FATAIFF-IWKRL-------------
M3Y8D1_BCL2L10-01       LLVQALLSCF--------------TAVILIY-FWKRLPFIG---------
A0A5F4WGS2_BCL2L10      LLVQVFLSWL--------------LTAAFIY-FWTR--------------
A0A1U7QVA0_BCL2L10      LLIKTFLSCV--------------IATAILF-VWKRLL------------
A0A4X1T1Z2_BCL2L10      HMVWVFVSYC--------------TAVVLLY-LWRKLL------------
F1RZB9_BCL2L10-01       HMVWVFVSYC--------------TAVVLLY-LWRKLL------------
Q99M66_BCL2L10-01       LLIRAILSCF--------------FATAIFY-IWKCL-------------
W5QIG4_BCL2L10-01       QLVWFFLSYW--------------TAIIIIY-FWIKLS------------
F1MV39_BCL2L10-01       QLVWFFLAYW--------------TAIIIIY-FWIKLL------------
A0A4W2C0F3_BCL2L10      QLVWFFLAYW--------------TAIIIIY-FWIKLL------------
A0A4W2C0F3_BCL2L10      QLVWFFLAYW--------------TAIIIIY-FWIKLL------------
A0A4W2FG99_BCL2L10      QLVWFFLAYW--------------TAIIIIY-FWIKLL------------
A0A4W2FG99_BCL2L10      QLVWFFLAYW--------------TAIIIIY-FWIKLL------------
F6ZPD4_BCL2L10-01       LLVRFLLSCF--------------SASVLIY-LWTKLS------------
A0A4W2EB77_BCL2L10      QLVWFFLSYW--------------TAIIIIY-FWIKLS------------
A0A4W2EB77_BCL2L10      QLVWFFLSYW--------------TAIIIIY-FWIKLS------------
E1B9B3_BCL2L10-01       TAGLVFPLILDSNNHNLLLDKIIVSSKILIS-TCLTLSNQAKLKCERPNQ
A0A2K6F2Q2_BCL2L10      LLVQVLLSCF--------------LATTVIY-FWTRLL------------
H0WZ06_BCL2L10-01       LLFEVLLLCF--------------LATVFIY-FWTRLT------------
A0A1U7UZD8_BCL2L10      LPVQAFVSCL--------------LAMAFIYFFWTRLL------------
G1T264_BCL2L10-01       LLVRTFLSCF--------------VATALLF-AWTRVYREL---------
A0A0D9RG38_BCL2L10      LLIQAFLACL--------------LATAFGY-LWTRLL------------
A0A2K5RIU7_BCL2L10      IAGPGFPVMV--------------VNSSIHL-LLDTIIRSFKIFSPLLPA
A0A2K5F974_BCL2L10      TAGPGFPVMV--------------VNSSIHL-LLDTIIRSF---------
A0A2K6TIT7_BCL2L10      TAGPGFPVMV--------------VNSSIHL-LLDTIIRSFKIFSPLLPA
F7CT87_BCL2L10-01       VLVQVFLSWL--------------LTAVFIY-FWTR--------------
A0A096NM44_BCL2L10      TADPGFPGML--------------VSNSLRL-SLDTIIMSFNIFNPLLPA
A0A2K6R5T5_BCL2L10      TADPGFPGML--------------VNNSLRL-PLDTIIMSFKIFNPLLPA
Q9HD36_BCL2L10-02       TAGPGFSVML--------------VNNSLHL-SLDTIIMSFKTFNPLLPA
G1R3W6_BCL2L10-01       TAGPGFSVML--------------VNNSLHL-FLDTIIMSFKTFNPLLPA
A0A2K5K3B0_BCL2L10      LLIQAFLACL--------------LTTAFGY-LWTRLL------------
A0A2K6M5H5_BCL2L10      LLIQAFLACL--------------LTTAFGY-LWTRLL------------
A0A2K5TKG9_BCL2L10      LLIQAFLACL--------------LATAFGY-LWTRLL------------
F7H6U5_BCL2L10-01       LLIQAFLACL--------------LATAFGY-LWTRLL------------
A0A2K6B2D9_BCL2L10      LLIQAFLACL--------------LATAFGY-LWTRLL------------
A0A2K5MMZ4_BCL2L10      LLIQAFLACL--------------LATAFGY-LWTRLL------------
H2NN92_BCL2L10-01       QLVQAFLSCL--------------LTTAFIY-LWTRLL------------
A0A2R9BCD9_BCL2L10      QLVQAFLSCL--------------LTTAFIY-LWTRLL------------
H2Q9G4_BCL2L10-01       QLVQAFLSCL--------------LTTAFIY-LWTRLL------------
G3QLU6_BCL2L10-01       QLVQAFLSCL--------------LATAFIY-LWTRLL------------
A0A337RYG8_BCL2L10      LLVQALLSCF--------------TVMILIY-FWRRLL------------
G1LKR4_BCL2L10-01       LLAQALLSCF--------------TAVILIY-FWKRLL------------
A0A452QJG0_BCL2L10      LFCPA----S--------------QAVILIY-FWKRLCEF----------
                                                                          

G1QEX2_BCL2L10-01       -------------
A0A3Q4MN81_BCL2L10      -------------
A0A3B4ETX9_BCL2L10      -------------
A0A3Q2UUN9_BCL2L10      -------------
A0A3P8PVZ8_BCL2L10      -------------
A0A3Q2UUN9_BCL2L10      -------------
A0A3P9BLI0_BCL2L10      -------------
A0A4W5MLY7_BCL2L10      -------------
A0A3Q2PJS5_BCL2L10      -------------
A0A3Q2GL87_BCL2L10      -------------
A0A3B5MJ12_BCL2L10      -------------
M4AUW7_BCL2L10-01       -------------
A0A096ME02_BCL2L10      -------------
A0A3B3TYN4_BCL2L10      -------------
A0A3B3YT99_BCL2L10      -------------
A0A3P9NE65_BCL2L10      -------------
A0A3P9IIZ2_BCL2L10      -------------
A0A3P9LM07_BCL2L10      -------------
H2MBQ3_BCL2L10-01       -------------
A0A3B4AAV4_BCL2L10      -------------
A0A3Q3EZT5_BCL2L10      -------------
A0A3Q3EZT5_BCL2L10      -------------
A0A3Q3JQ78_BCL2L10      -------------
A0A3B4TIY6_BCL2L10      -------------
A0A3B4WGF4_BCL2L10      -------------
A0A3Q3KZW1_BCL2L10      -------------
A0A3B5KD08_BCL2L10      -------------
A0A3Q3VI28_BCL2L10      -------------
A0A3Q1GM98_BCL2L10      -------------
A0A3Q1D2L0_BCL2L10      -------------
A0A3P8RL82_BCL2L10      -------------
A0A3B4ZFS0_BCL2L10      -------------
D2IT42_BCL2L10-02       -------------
A0A3Q0S9R1_BCL2L10      -------------
A0A4W6FHH7_BCL2L10      -------------
A0A3B3C5I4_BCL2L10      -------------
A0A3Q1IAB0_BCL2L10      -------------
A0A3P8W7K5_BCL2L10      -------------
F6VJQ0_BCL2L10-01       -------------
A0A4X2K2M5_BCL2L10      -------------
Q9Z0F3_BCL2L10-01       -------------
M3Y8D1_BCL2L10-01       -------------
A0A5F4WGS2_BCL2L10      -------------
A0A1U7QVA0_BCL2L10      -------------
A0A4X1T1Z2_BCL2L10      -------------
F1RZB9_BCL2L10-01       -------------
Q99M66_BCL2L10-01       -------------
W5QIG4_BCL2L10-01       -------------
F1MV39_BCL2L10-01       -------------
A0A4W2C0F3_BCL2L10      -------------
A0A4W2C0F3_BCL2L10      -------------
A0A4W2FG99_BCL2L10      -------------
A0A4W2FG99_BCL2L10      -------------
F6ZPD4_BCL2L10-01       -------------
A0A4W2EB77_BCL2L10      -------------
A0A4W2EB77_BCL2L10      -------------
E1B9B3_BCL2L10-01       SKPPSETFLSAFM
A0A2K6F2Q2_BCL2L10      -------------
H0WZ06_BCL2L10-01       -------------
A0A1U7UZD8_BCL2L10      -------------
G1T264_BCL2L10-01       -------------
A0A0D9RG38_BCL2L10      -------------
A0A2K5RIU7_BCL2L10      QL-----------
A0A2K5F974_BCL2L10      -------------
A0A2K6TIT7_BCL2L10      QL-----------
F7CT87_BCL2L10-01       -------------
A0A096NM44_BCL2L10      QL-----------
A0A2K6R5T5_BCL2L10      QL-----------
Q9HD36_BCL2L10-02       QL-----------
G1R3W6_BCL2L10-01       QL-----------
A0A2K5K3B0_BCL2L10      -------------
A0A2K6M5H5_BCL2L10      -------------
A0A2K5TKG9_BCL2L10      -------------
F7H6U5_BCL2L10-01       -------------
A0A2K6B2D9_BCL2L10      -------------
A0A2K5MMZ4_BCL2L10      -------------
H2NN92_BCL2L10-01       -------------
A0A2R9BCD9_BCL2L10      -------------
H2Q9G4_BCL2L10-01       -------------
G3QLU6_BCL2L10-01       -------------
A0A337RYG8_BCL2L10      -------------
G1LKR4_BCL2L10-01       -------------
A0A452QJG0_BCL2L10      -------------
                                     

© 1998-2020Legal notice