Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

73 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1QEX2_BCL2L10-01       --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
A0A3Q4MN81_BCL2L10      --------------------------------------------------
A0A3B4ETX9_BCL2L10      --------------------------------------------------
D2IT42_BCL2L10-02       --------------------------------------------------
A0A3Q0S9R1_BCL2L10      --------------------------------------------------
I3J363_BCL2L10-01       ------------------------------------------MSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P8PVZ8_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUN9_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3P9BLI0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2PJS5_BCL2L10      --------------------------------------------------
A0A3Q2GL87_BCL2L10      --------------------------------------------------
A0A3B5MJ12_BCL2L10      --------------------------------------------------
M4AUW7_BCL2L10-01       --------------------------------------------------
A0A096ME02_BCL2L10      --------------------------------------------------
A0A3B3TYN4_BCL2L10      --------------------------------------------------
A0A3B3YT99_BCL2L10      --------------------------------------------------
A0A3P9NE65_BCL2L10      --------------------------------------------------
A0A3P9IIZ2_BCL2L10      --------------------------------------------------
A0A3P9LM07_BCL2L10      --------------------------------------------------
H2MBQ3_BCL2L10-01       --------------------------------------------------
A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3EZT5_BCL2L10      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      --------------------------------------------------
A0A3B4TIY6_BCL2L10      --------------------------------------------------
A0A3B4WGF4_BCL2L10      --------------------------------------------------
A0A3Q3KZW1_BCL2L10      --------------------------------------------------
A0A3B5KD08_BCL2L10      --------------------------------------------------
A0A3Q3VI28_BCL2L10      --------------------------------------------------
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3P8RL82_BCL2L10      --------------------------------------------------
A0A3B4ZFS0_BCL2L10      --------------------------------------------------
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------MFQLSWGLFLLEAESADK
A0A3P8W7K5_BCL2L10      --------------------------------------------------
Q9Z0F3_BCL2L10-01       --------------------------------------------------
M3Y8D1_BCL2L10-01       --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
F1RZB9_BCL2L10-01       --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
W5QIG4_BCL2L10-01       --------------------------------------------------
Q99M66_BCL2L10-01       --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
H0WZ06_BCL2L10-01       --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
A0A0D9RG38_BCL2L10      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K6TIT7_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2R9BCD9_BCL2L10      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
G1LKR4_BCL2L10-01       --------------------------------------------------
A0A452QJG0_BCL2L10      --------------------------------------------------
                                                                          

G1QEX2_BCL2L10-01       ----------------------------------DELKLRTRRLLTEFLE
F6VJQ0_BCL2L10-01       ------------------------------MDYKCALREETARLVTDYLE
A0A3Q4MN81_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3B4ETX9_BCL2L10      -------------------MCREQSDIAGRKMKFCGLWKETLVLAEDYLS
D2IT42_BCL2L10-02       --------------------------------MSCRLWKETLALSEDYLL
A0A3Q0S9R1_BCL2L10      --------------------------------MVPGLWKETLGLAEDYLS
I3J363_BCL2L10-01       SLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P8PVZ8_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUN9_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3P9BLI0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2PJS5_BCL2L10      -------------------MCREPSHIAGRKMS-CGLWKETVAVAEDYMR
A0A3Q2GL87_BCL2L10      -------------------MCREPLHITGRKMS-CGLWKETVAVAEDYMR
A0A3B5MJ12_BCL2L10      -------------------------------MS-CGLWKETVVVAEDYIR
M4AUW7_BCL2L10-01       -------------------------------MS-CGLWKETVVVAEDYIR
A0A096ME02_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3B3TYN4_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIR
A0A3B3YT99_BCL2L10      ---------MHRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9NE65_BCL2L10      ---------MRRGSPSAVWMCREPSHIAGRKMS-CGLWKETVAVAEDYIH
A0A3P9IIZ2_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
A0A3P9LM07_BCL2L10      -------------------------------MS-CGLRKETLAVALDYLS
H2MBQ3_BCL2L10-01       -------------------------------MS-CGLRKETLAVALDYLS
A0A3B4AAV4_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3EZT5_BCL2L10      -------------------MCRAQSDIAGRKMS-CGLWKETLALAEDYLS
A0A3Q3JQ78_BCL2L10      -------------------MCREHLDIAGRKMS-CGLWKDTLALAEDYLS
A0A3B4TIY6_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLY
A0A3B4WGF4_BCL2L10      -------------------------------MS-CGLWKETRAVAEDYLF
A0A3Q3KZW1_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3B5KD08_BCL2L10      -------------------------------MS-CGLWKETLALAEDYLS
A0A3Q3VI28_BCL2L10      -------------------------------MS-CGLWKETLALAQDYLS
A0A3Q1GM98_BCL2L10      -------------------------------MS-CGLWKETVVLAEDYLS
A0A3Q1D2L0_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3P8RL82_BCL2L10      -------------------------------MS-CGLWKETLVLAEDYLS
A0A3B4ZFS0_BCL2L10      -------------------------------MS-CGLWKETLVVAEDYLS
A0A3B3C5I4_BCL2L10      -----------------------MDGFSAQKMS-CGLRKETLAVALDYLS
A0A3Q1IAB0_BCL2L10      CADAEGKLRVHRGSPSAVRMCREQTDIAGRKMS-CGLWKDTLALAEDYLS
A0A3P8W7K5_BCL2L10      --------MCNSASPSAVSTSSEQSDIAGRKMS-CGLWKETLAVAEDYLS
Q9Z0F3_BCL2L10-01       -----------------------------MADSQDPLHERTRRLLSDYIF
M3Y8D1_BCL2L10-01       ---MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLE
E1B9B3_BCL2L10-01       --------------------------MTEGGAMVDPFRERTARLLMDYLE
A0A1U7QVA0_BCL2L10      --------------------------------MADPLRVRTRLLLTDYLT
F1RZB9_BCL2L10-01       --------------------------------MADAFRERTARLLTDYLE
F1MV39_BCL2L10-01       -----------------------------VADGQESLVERTARLLMDYLE
W5QIG4_BCL2L10-01       -----------------------GRPPGRGGAMVDPFRERTARLLMDWLE
Q99M66_BCL2L10-01       --------------------------------MGDPLQDRTRRLLTDYIL
F6ZPD4_BCL2L10-01       -------------------------------AVAEALRERTALLLIDYLQ
A0A2K6F2Q2_BCL2L10      --------------------------------MGDRFRERTERLLADYLE
H0WZ06_BCL2L10-01       --------------------------------MADPLRERTERLLTDYLE
A0A1U7UZD8_BCL2L10      --------------------------------MADPLEERTARLLADYLE
G1T264_BCL2L10-01       --------------------------------MADALEERTARLLTDYLE
A0A0D9RG38_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5RIU7_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K5F974_BCL2L10      --------------------------------MADPLRQRTERLVADYLE
A0A2K6TIT7_BCL2L10      --------------------------------MADPLQQRTEQLVADYLE
F7CT87_BCL2L10-01       --------------------------------MADPLRQRTEQLVTDYLE
A0A096NM44_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K6R5T5_BCL2L10      --------------------------------MADPLRERTERLLADYLG
Q9HD36_BCL2L10-02       ----------------------MVDQLRERTTMADPLRERTELLLADYLG
G1R3W6_BCL2L10-01       --------------------------------MVDQLRERTERLLADYLG
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K6M5H5_BCL2L10      ----------------------MADPLRERTTVADPLRERTERLLADYLG
A0A2K5TKG9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
F7H6U5_BCL2L10-01       --------------------------------MADPLRERTERLLADYLG
A0A2K6B2D9_BCL2L10      --------------------------------MADPLRERTERLLADYLG
A0A2K5MMZ4_BCL2L10      --------------------------------MADPLRERTERLLADYLG
H2NN92_BCL2L10-01       ----------------------MVDQLRERTITADLLRERTERLLADYLG
A0A2R9BCD9_BCL2L10      ----------------------MVDQWRERTTMADPLRERTERLLADYLG
H2Q9G4_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
G3QLU6_BCL2L10-01       ----------------------MVDQWRERTTMADPLRERTERLLADYLG
A0A337RYG8_BCL2L10      --------------------------------MADALRERTAQLLTDYLE
G1LKR4_BCL2L10-01       --------------------------------MADALRG-TARLLTDYLE
A0A452QJG0_BCL2L10      --------------------------------MADALRERTARLLTDYLE
                                                            :   *  :  ::: 

G1QEX2_BCL2L10-01       HRTRRRGTAPQQPSTPEATVMRSLAAHSWLGTPHSWSR--------RQRN
F6VJQ0_BCL2L10-01       YCCRREGVQELPAPTPAAATLRLVSSELRQIYQDFFECALNQLLDREPEQ
A0A3Q4MN81_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3B4ETX9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
D2IT42_BCL2L10-02       SCTAST-GTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEAD
A0A3Q0S9R1_BCL2L10      LCCTSP-HQVPPPPSESAAAMRRLGQDIERQHQARFDNLAQTFLRHCGPD
I3J363_BCL2L10-01       FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2UUN9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3P8PVZ8_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2UUN9_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3P9BLI0_BCL2L10      FCCTSP-HQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A3Q2PJS5_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVESQHQARFHALAQSFLRHSQTD
A0A3Q2GL87_BCL2L10      LRCSSP-LPAPPPPSEPAAAMRRLAQDMETQHQARFHTLAQSFLRHSGTD
A0A3B5MJ12_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSD
M4AUW7_BCL2L10-01       LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSD
A0A096ME02_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3B3TYN4_BCL2L10      LCCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3B3YT99_BCL2L10      LRCSSP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3P9NE65_BCL2L10      LRCSNP-HPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTD
A0A3P9IIZ2_BCL2L10      LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGQD
A0A3P9LM07_BCL2L10      LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPD
H2MBQ3_BCL2L10-01       LSCRSP-LQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPD
A0A3B4AAV4_BCL2L10      LCCSGP-QAAPPPPSGSASAMRRLGQDMEAQHKARFHSLSQTFLKQCGPD
A0A3Q3EZT5_BCL2L10      LCCTSP-RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPD
A0A3Q3EZT5_BCL2L10      LCCTSP-RPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPD
A0A3Q3JQ78_BCL2L10      LCCTSS-RPAPPPPSESAAAMRCLAQDMETQHQARFHSLAQTFLKQCGPD
A0A3B4TIY6_BCL2L10      LCCTSP-QPAPPPPSESAAAMRSMAQDMETQHQARFHTLAQTFVTQCGLD
A0A3B4WGF4_BCL2L10      LCCTSP-QPAPPPPSESAAAMRGMAQDMETQHQARFHTLAQTFVTQCGLD
A0A3Q3KZW1_BCL2L10      LCCTSP-QSVPPPPSESAAAMRCLAQKMERQHQARFHSLTQTFLKQCGPD
A0A3B5KD08_BCL2L10      LCSTSQ-CPAPPPPSESATAMRHLGQDMEKQHQARFNSLAQTFLRQCGPD
A0A3Q3VI28_BCL2L10      LCCTSQ-RPAPPPPSESAAAMRDLAQDMEKQHQARFHSLAQTFLRQCGTD
A0A3Q1GM98_BCL2L10      LCCAGP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQAFLRQCGPD
A0A3Q1D2L0_BCL2L10      LCCASP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPD
A0A3P8RL82_BCL2L10      LCCASP-HQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPD
A0A3B4ZFS0_BCL2L10      LCCTSP-HSAPPPPSESAAAMRCLAQDMEKQHQARFHSLTQTFLRQPGPD
A0A3B3C5I4_BCL2L10      LSCRSPVLQAPPPPSESASAMRRLAQDMETQYQPRFSTLAQDFRKHCGPD
A0A3Q1IAB0_BCL2L10      LCCTSP-WPAPPPPSESAAAMRRLAQDMEKQHQVRFHSLAQTFLKQCGPD
A0A3P8W7K5_BCL2L10      LCCSSP-RPAPPPPSESAAAMRHLAQDMEKQHQARFQTLSQSFLRQCGSE
Q9Z0F3_BCL2L10-01       FCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSS----FCES-RGN
M3Y8D1_BCL2L10-01       YCARGPGTPARSPSTREAAVLRSVAAVVRQRHERFLSD----YRGY-GGN
E1B9B3_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRRC-RRH
A0A1U7QVA0_BCL2L10      FCAREPGDPEPPPTSAEAALLRSVAEQIQQQHHFFFSS----FVGY-QGN
F1RZB9_BCL2L10-01       YCAREPGTAARQPSSPEAAVLRCVAAQIREYNVRTLSV----YRGF-RWN
F1MV39_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL----YRRC-RRH
W5QIG4_BCL2L10-01       FCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL----YRRY-RRH
Q99M66_BCL2L10-01       FCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNS----FRDY-QGN
F6ZPD4_BCL2L10-01       RRAREPATP-------EVAVLRCVAAQIQPRNQRVLSR----YRGF-RGD
A0A2K6F2Q2_BCL2L10      YCTREPGAPGLPPSSLEAAAMRFAATKIRRKHASFFSA----YVGY-PGN
H0WZ06_BCL2L10-01       YCARDPTAPEPTPSSPEAALLRSVTAYIQQRHWSFFSA----YIGY-PGN
A0A1U7UZD8_BCL2L10      YCARPPGSPEPRPSSPEAAVLRSTAARLRQRHASFFSA----FVDY-PGS
G1T264_BCL2L10-01       CCAREPGTPEPQPSTPEAAVLRCAATQLQRVHWPFFSV----YRGY-PGN
A0A0D9RG38_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K5RIU7_BCL2L10      YCSREPGTPESPPATAEAAVLRATAAGVRKVYRSFFSA----YLGY-PGN
A0A2K5F974_BCL2L10      YCSQEPGTPESPPSTAEAAVLRAMAAGVRKLYRSFFSA----YLGY-PGN
A0A2K6TIT7_BCL2L10      YCSREPGTPESPPATAEAAVLRATAAVVRKLYPSFFSA----YRGY-PRN
F7CT87_BCL2L10-01       YCSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSA----YLGY-PGN
A0A096NM44_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K6R5T5_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
Q9HD36_BCL2L10-02       YCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
G1R3W6_BCL2L10-01       CCAREPGTPEPTPSTPEAAMLRSAAARLRQLHPSFFSA----YLGY-PGN
A0A2K5K3B0_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K6M5H5_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2K5TKG9_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
F7H6U5_BCL2L10-01       CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K6B2D9_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-PGN
A0A2K5MMZ4_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSA----YRGY-RGN
H2NN92_BCL2L10-01       CCAREPGTPEPTPPTPEAAVLRSAAARLRQLHRSFFSA----YLGY-PGN
A0A2R9BCD9_BCL2L10      YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
H2Q9G4_BCL2L10-01       YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
G3QLU6_BCL2L10-01       YCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSA----YLGY-PGN
A0A337RYG8_BCL2L10      YCAREPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSA----YRGY-RGN
G1LKR4_BCL2L10-01       YCAREPGTPARAPSTPEAAVLRSVAAQVQQRHERFLSD----YRGYAGGN
A0A452QJG0_BCL2L10      YCAREPGTPARAPSTPEAAVLRSVAAQVQQRHEHFLSD----YRGY-GGN
                                         .: :*                            

G1QEX2_BCL2L10-01       RLEQMVDQIESLVPDGTDPNWLSVVALVSFAGALLERPP----------P
F6VJQ0_BCL2L10-01       VIVNVAELM-----DRGEFNWGRVAVLVVFAGALLEMEEL----------
A0A3Q4MN81_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQK---P
A0A3B4ETX9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQK---P
D2IT42_BCL2L10-02       ACAGLRKVMEELVGDGQ-LNWGRVVSLFTFTGVLARQ----LQEKKGVQL
A0A3Q0S9R1_BCL2L10      HCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARK----RLEQKP---
I3J363_BCL2L10-01       HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2UUN9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3P8PVZ8_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2UUN9_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3P9BLI0_BCL2L10      HCLSLRKVMKELVGDGH-LNWGRVVSLFAFTGVLARK----ILEQKP---
A0A3Q2PJS5_BCL2L10      LCTSLWKVMDEMVGDGH-FNWGRVVSLFTFAGVLARQ----LQEQQGRSP
A0A3Q2GL87_BCL2L10      LCSSLRKVMDEMVGDGL-FNWGRVVSLFTFAGVLARQ----LQEQTGKNP
A0A3B5MJ12_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
M4AUW7_BCL2L10-01       LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A096ME02_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3B3TYN4_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3B3YT99_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3P9NE65_BCL2L10      LCSNLRKVMDEMVGDGH-FNWGRVVSLFAFAGVLARQ----LREQTGKNP
A0A3P9IIZ2_BCL2L10      LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
A0A3P9LM07_BCL2L10      LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
H2MBQ3_BCL2L10-01       LCSSLRKVMEELVGDER-LNWGRVVSLFAFVGVLARQ----LREQTDMNP
A0A3B4AAV4_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSLFTFAGVLARH----IKEQKSSRP
A0A3Q3EZT5_BCL2L10      PCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQEDVKL
A0A3Q3EZT5_BCL2L10      PCSGLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQEDVKL
A0A3Q3JQ78_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSLFAFTGVLARQ----LTEQNGMKP
A0A3B4TIY6_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQNRVNP
A0A3B4WGF4_BCL2L10      PCSSLRKVMEELVGDGH-LNWGRVVSIFTFTGVLARL----LLEQNRVNP
A0A3Q3KZW1_BCL2L10      PCSSLRKVIEELVADGH-LNWGRVVSLFTFTGVLSRQ----LMEQKGMKP
A0A3B5KD08_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARL----MQEQKSTKP
A0A3Q3VI28_BCL2L10      PCSSLRNVMEELVGDGH-LNWGRVVSIFTFTGVLARQ----LLEQKSTKP
A0A3Q1GM98_BCL2L10      FCSSLRMVMEELVEDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKP
A0A3Q1D2L0_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKL
A0A3P8RL82_BCL2L10      LCSSLRKVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LLEQKDTKP
A0A3B4ZFS0_BCL2L10      LCSSLRRVMEELVGDGH-LNWGRVVSLFTFTGVLARQ----LQEQRDTKP
A0A3B3C5I4_BCL2L10      LCSSLRKVMEELVGDEH-LNWGRVVSLFAFVGVLARQ----LREQTDTNP
A0A3Q1IAB0_BCL2L10      PCSSLRKVMEELVGDGH-MNWGRVVSLFTFTGVLARQ----MLEQKDKKP
A0A3P8W7K5_BCL2L10      PCVCLRKVMEELVGDGH-LNWGRVVSIFTFTGVLAKQ----LLVQKGLKP
Q9Z0F3_BCL2L10-01       RLELVKQMADKLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVK------
M3Y8D1_BCL2L10-01       RVELVAQLEREILAHPQALSWGRVVALVTFAGTLLERPPSGACSNLGPDP
E1B9B3_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT------
A0A1U7QVA0_BCL2L10      RVELMTQMVDAVLPDGQDLNWGRLVLLLAFAGTIVSQE------------
F1RZB9_BCL2L10-01       RVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLERHP--REACGRKK-
F1MV39_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPP--QTT------
W5QIG4_BCL2L10-01       RVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQP--QTT------
Q99M66_BCL2L10-01       RLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDR--TVK---RRR
F6ZPD4_BCL2L10-01       HVGLAARMAQAIFGDRHVPSWGRVAALVTLAGTLLERAP--RGTYRKPKR
A0A2K6F2Q2_BCL2L10      RVYLLERMAEAVLCDS--LSWGRVVMLVTFAGTLLERGP--PVTAWWKKW
H0WZ06_BCL2L10-01       RVQVVERMVKAMLSDNQRLNWGRVVTLVTFAGTLLQRPP--VEARREKQD
A0A1U7UZD8_BCL2L10      RVDLTARMADAVLSGSRDLSWGRVVTLVTFAGTLLERGP--LLPAGGQQR
G1T264_BCL2L10-01       RIELAARVAEAVLSDGHDLSWGRVVTLVTFAGTLLDRGP--PVTTQ----
A0A0D9RG38_BCL2L10      RVELVALMADAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LMTAWWKKQ
A0A2K5RIU7_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A2K5F974_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A2K6TIT7_BCL2L10      RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
F7CT87_BCL2L10-01       RVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGP--LVTARWKKW
A0A096NM44_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6R5T5_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
Q9HD36_BCL2L10-02       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
G1R3W6_BCL2L10-01       RVELVVLMADSVLSDSPGPTWGRVVTLVAFAGTLLERGP--LVTARWKKW
A0A2K5K3B0_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6M5H5_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K5TKG9_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
F7H6U5_BCL2L10-01       RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K6B2D9_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
A0A2K5MMZ4_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREP--LVTAWWKKR
H2NN92_BCL2L10-01       RVELVALMADSVLSDSPSPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
A0A2R9BCD9_BCL2L10      RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTTRWKKW
H2Q9G4_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTTRWKKW
G3QLU6_BCL2L10-01       RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGP--LVTARWKKW
A0A337RYG8_BCL2L10      RVELVARLEQDLLSNPQTLSWGHVVALLTFAGTLLERPP--PGTYLNLTP
G1LKR4_BCL2L10-01       RVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTYSNLGP
A0A452QJG0_BCL2L10      RVELVAQVEREILAHPQPLSWGRVVALLTFAGTLLERSP--SGTYSNLGP
                                           .*  :. :. :.* :                

G1QEX2_BCL2L10-01       GHSQ--ARREWDATVD-QDCQRLVTFLCSWLTE-THRTWMEAQGGW-DG-
F6VJQ0_BCL2L10-01       ------LKEEQVLQLRRETSRRLTEKLCNYLVE-RKGAWLHENGGW-TG-
A0A3Q4MN81_BCL2L10      GLDP--GQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
A0A3B4ETX9_BCL2L10      GLDP--GQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
D2IT42_BCL2L10-02       GQDP--GTGRALGQVPGGSCRGLAETIADYLGE-EKRDWLLENGGW-EG-
A0A3Q0S9R1_BCL2L10      GLDP--GQQQELGQEP-ISCRELAETIADYLGE-EKKDWLLDNDGW-EG-
I3J363_BCL2L10-01       GLDP--GQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
A0A3Q2UUN9_BCL2L10      GLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
A0A3P8PVZ8_BCL2L10      GLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
A0A3Q2UUN9_BCL2L10      GLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
A0A3P9BLI0_BCL2L10      GLDP--RQQQELGQEP-MSCRRLAETIADYLGE-EKKDWLLDNDGW-EG-
A0A3Q2PJS5_BCL2L10      GPDP--GRQQ----EP-VSCRELAETIADYLEK-HKKDWLQENDGW-DG-
A0A3Q2GL87_BCL2L10      GLDP--GRQQELQTEP-VSCRALAETIADYLET-HKKDWLQENNGW-DG-
A0A3B5MJ12_BCL2L10      VPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNGW-EG-
M4AUW7_BCL2L10-01       VPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNGW-EG-
A0A096ME02_BCL2L10      GPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNGW-DG-
A0A3B3TYN4_BCL2L10      GPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNGW-DG-
A0A3B3YT99_BCL2L10      GPDS--GKQQELQQEP-VSCRALAETIADYLEK-HKKDWLQENNGW-DG-
A0A3P9NE65_BCL2L10      GPDS--GKQQELQQET-VSCRALAETIADYLEK-HKKDWLQENNGW-DG-
A0A3P9IIZ2_BCL2L10      GLDP----GREVAAGP-VSCQALAETVADFLGG-DKKEWMLENDGW-EG-
A0A3P9LM07_BCL2L10      GLDP----GREVAPGP-VSCQALAETVADFLGG-DKKEWMLENDGW-EG-
H2MBQ3_BCL2L10-01       GLDP----GREVAPGP-VSCQALAETVADFLGG-DKKEWMLENDGW-EG-
A0A3B4AAV4_BCL2L10      GLDP--GQVQGLGQVP-SDCRRLAQTIADYLGE-EKRDWLLENGGW-VG-
A0A3Q3EZT5_BCL2L10      GLDP--VQGQKLGQGP-GHCRGLAETIADYLGE-EKKEWLLENDGW-EG-
A0A3Q3EZT5_BCL2L10      GLDP--VQGQKLGQGP-GHCRGLAETIADYLGE-EKKEWLLENDGW-EG-
A0A3Q3JQ78_BCL2L10      GLDP--GQGQELGQGP-GNCRELAETIADYLGE-EKKDWLLENDGW-EG-
A0A3B4TIY6_BCL2L10      GLDP--GQGQGLG-----NCRGLAETIADYLGE-EKKDWLLENGGW-EG-
A0A3B4WGF4_BCL2L10      GLDP--GQGQGLR-----NCRGLAETIADYLGE-EKKDWLLENGGW-EG-
A0A3Q3KZW1_BCL2L10      GLDS--GKGQELGQGP-ESCRGLAETIADYLGE-EKKDWLQENDGW-EG-
A0A3B5KD08_BCL2L10      GLDP--GQEQQLGQVP-ENCRGLAETIADYLGE-EKKDWLLENGGW-EG-
A0A3Q3VI28_BCL2L10      GLEPRQDQDQELGQVP-GNCSELAETIADYLGE-EKKAWLLENDGW-EG-
A0A3Q1GM98_BCL2L10      GLDP--GKRQELGQRP-VNCRGLAETIADYLGE-EKKDWLLENDGW-EG-
A0A3Q1D2L0_BCL2L10      GLDP--GKQQELGQGP-VNCRELAETIADYLGE-EKKDWLLENDGW-EG-
A0A3P8RL82_BCL2L10      GLDP--GKQQELGQGP-VNCRELAETIADYLGE-EKKDWLLENDGW-EG-
A0A3B4ZFS0_BCL2L10      GLEP--GKRQELGQGP-VNCRGLAETIADYLGE-EKKDWLLENDGW-EG-
A0A3B3C5I4_BCL2L10      GLDL----GREAAPGP-VSCQALAETVADFLGG-DKKEWMLENDGW-EG-
A0A3Q1IAB0_BCL2L10      GLDL--GKGQELGQEP-GQCRGLAETIADYLGE-EKKDWLLENDGW-EG-
A0A3P8W7K5_BCL2L10      GQEP--EAGQELGPEP-GTCRELAETIADYLGE-EKKAWLLENGGW-EG-
Q9Z0F3_BCL2L10-01       --QK--RDLGNRVIVT-RDCCLIVNFLYNLLMGRRHRARLEALGGW-DG-
M3Y8D1_BCL2L10-01       ELEL--ELGEWEASVR-QDCRRLVDFLCGRLTG-QHRAWLEAHGGW-DG-
E1B9B3_BCL2L10-01       --RR--QEKRDDDGVS-RDCRLLVALLCAQFCE-RHRAWLMTNGGWVSA-
A0A1U7QVA0_BCL2L10      --QR--NRLKDKMKVL-QDCQLIVALLCNRLLR-RHRSWLEAQGGW-DG-
F1RZB9_BCL2L10-01       ----------KEGNVS-RDCRLLVALLCAQLSG-QHRTWLLANGGW-DG-
F1MV39_BCL2L10-01       ---R--RQKRDDDGVS-RDCRLLVALLCAQFCE-RHRAWLMANGGW-DG-
W5QIG4_BCL2L10-01       ---R--RQKRDDGSVS-RDCRLLVALLCAQFCE-RHRAWLMANGGW-DG-
Q99M66_BCL2L10-01       DQRN--RLL-----LE-RDCYLIVSLLYNRLTG-RHRSWLEAHGGW-DG-
F6ZPD4_BCL2L10-01       GYKL--ELREWKAGVD-RDWPRLVDFLCAWLKG-RHRAWLEAHYGW-DG-
A0A2K6F2Q2_BCL2L10      GLQP--QPKEGDPEVA-RDRQRLVALLCARLAG-QHRAWLQAQGGW-DG-
H0WZ06_BCL2L10-01       --KS--QLKEGEDEVA-RDCQRLVALLSSRLVG-QHRVWLEAQGGW-DG-
A0A1U7UZD8_BCL2L10      GFRP--RRKKEEGDVA-RDCQRLVALLSARLAG-RHRAWLQAQGGW-DG-
G1T264_BCL2L10-01       --------RVRRNEIA-RDCQRLVALLCARLAG-QHRAWLQAQGGW-DG-
A0A0D9RG38_BCL2L10      SFQP--RL-EQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-DG-
A0A2K5RIU7_BCL2L10      GFQS--RLKEPEGNVS-RDRQRLVGLLSSRLVG-QHRAWLEAQGGW-VST
A0A2K5F974_BCL2L10      GFQS--RLKEPEGDVA-RDCQRLVALLSSRLVG-QHRAWLEAQGGW-VSM
A0A2K6TIT7_BCL2L10      GFQS--RLKEPEGDVA-RDCQRLVGLLSSRLVG-QHRAWLEAQGGW-VST
F7CT87_BCL2L10-01       GFQS--RLKEPEGDVA-RDCQRLVALLSSRLVG-QHRAWLEAQGGW-DG-
A0A096NM44_BCL2L10      SFQP--RLKEQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-VST
A0A2K6R5T5_BCL2L10      SFQP--RLKEQEGEVA-RDCQRLVALLSSRLTG-QHRAWLQAQGGW-VST
Q9HD36_BCL2L10-02       GFQP--RLKEQEGDVA-RDCQRLVALLSSRLMG-QHRAWLQAQGGW-VST
G1R3W6_BCL2L10-01       GFQP--RLKEQEGDVA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-VST
A0A2K5K3B0_BCL2L10      SFQP--RLKEQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-DG-
A0A2K6M5H5_BCL2L10      SFQP--RLKEQEGDVA-RDCQRLVALLSSRLTG-QHRAWLQAQGGW-DG-
A0A2K5TKG9_BCL2L10      GFQP--RLKEQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-DG-
F7H6U5_BCL2L10-01       GFQP--RLKEQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-DG-
A0A2K6B2D9_BCL2L10      GFQP--RLKEQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-DG-
A0A2K5MMZ4_BCL2L10      GFQP--RLKEQEGDVA-RDCQRLVALLSSRLAG-QHRAWLQAQGGW-DG-
H2NN92_BCL2L10-01       GFQP--RLKEQEGDVA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-DG-
A0A2R9BCD9_BCL2L10      GFQP--RLKEQEGDVA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-DG-
H2Q9G4_BCL2L10-01       GFQP--RLNEQEGDVA-RDCQRLVALLSSRLVG-QHRAWLQAQGGW-DG-
G3QLU6_BCL2L10-01       GFQP--RLKEQEGDVA-RDCQRLVALLSSRLMG-QHRAWLQAQGGW-DG-
A0A337RYG8_BCL2L10      DQQQ--EL-EWETNVG-QDCQHLVALLCNRLTG-RHRAWLEAHDGW-DG-
G1LKR4_BCL2L10-01       DQEL--ELGEWEAGVR-QDCRHLVDFLCNRLTG-QHRAWLEAHDGW-DG-
A0A452QJG0_BCL2L10      DQEL--ELGEREAGVR-QDCRHLVDFLCNRLTG-QHRAWLEAHDGWVNG-
                                              :.  :   :    :  .:    **  . 

G1QEX2_BCL2L10-01       -------------------------FCHNFMPAPPP------GDRLLAPL
F6VJQ0_BCL2L10-01       -------------------------FHHHFEKRQSPPPSDSSNNTLCCIM
A0A3Q4MN81_BCL2L10      -------------------------FCKFSRSAREV----SQDSSMKKAL
A0A3B4ETX9_BCL2L10      -------------------------FCKFSRSAREV----SQDSSMKKAL
D2IT42_BCL2L10-02       -------------------------FCKFSRIAREV----NQESSMKTAL
A0A3Q0S9R1_BCL2L10      -------------------------FCKYSRSAREV----SQDSSMKTAL
I3J363_BCL2L10-01       -------------------------FCKFSRSAREV----SQDSSMKKAL
A0A3Q2UUN9_BCL2L10      -------------------------FCKFSRSAREV----SQDSSMKKAL
A0A3P8PVZ8_BCL2L10      -------------------------FCKFSRSAREV----SQDSSMKKAL
A0A3Q2UUN9_BCL2L10      -------------------------FCKFSRSAREV----SQDSSMKKAL
A0A3P9BLI0_BCL2L10      -------------------------FCKFSRSAREV----SQDSSMKKAL
A0A3Q2PJS5_BCL2L10      -------------------------FCNYAHGARGA----SQDSSMKTAL
A0A3Q2GL87_BCL2L10      -------------------------FCNYARNAREV----SQDSSMKTAL
A0A3B5MJ12_BCL2L10      -------------------------FCSYARNAREA----SQDSSMKTAL
M4AUW7_BCL2L10-01       -------------------------FCSYARNAREA----SQDSSMKTAL
A0A096ME02_BCL2L10      -------------------------FCSYAHNAREV----SQDSSMKTAL
A0A3B3TYN4_BCL2L10      -------------------------FCSYAHNAREV----SQDSSMKTAL
A0A3B3YT99_BCL2L10      -------------------------FCSYAHNAREV----SQDSSMKTAL
A0A3P9NE65_BCL2L10      -------------------------FCSYALNAREV----SQDSSMKTAL
A0A3P9IIZ2_BCL2L10      -------------------------FCKFSRTAREV----SQDSSMKTAL
A0A3P9LM07_BCL2L10      -------------------------FCKFSRTAREV----SQDSSMKTAL
H2MBQ3_BCL2L10-01       -------------------------FCKFSRTAREV----SQDSSMKTAL
A0A3B4AAV4_BCL2L10      -------------------------FCEFSCHARKV----DQDSSMKTAL
A0A3Q3EZT5_BCL2L10      -------------------------FCEFSRSARET----SQDSSMKTAL
A0A3Q3EZT5_BCL2L10      -------------------------FCEFSRSARET----SQDSSMKTAL
A0A3Q3JQ78_BCL2L10      -------------------------FCKFSRSAREV----SHDSSVKTAL
A0A3B4TIY6_BCL2L10      -------------------------FCKFSHSAREV----SQDLSMKTAL
A0A3B4WGF4_BCL2L10      -------------------------FCKFSHSAREV----SQDLSMKTAL
A0A3Q3KZW1_BCL2L10      -------------------------FCKFSHSAREV----SHDSSMKTAL
A0A3B5KD08_BCL2L10      -------------------------FCKYSLAAREV----NHDSSMKTAL
A0A3Q3VI28_BCL2L10      -------------------------FCKFSHSAREA----RLDSSMKTAL
A0A3Q1GM98_BCL2L10      -------------------------FCKFSLSARKA----SQDLSMKTAL
A0A3Q1D2L0_BCL2L10      -------------------------FCKFSLSAREV----SQDLSMKTAL
A0A3P8RL82_BCL2L10      -------------------------FCKFSLSAREV----SQDLSMKTAL
A0A3B4ZFS0_BCL2L10      -------------------------FVKFSLSAREV----SQDLSMKTAL
A0A3B3C5I4_BCL2L10      -------------------------FCKFSRTAREV----SQDSSMKTAL
A0A3Q1IAB0_BCL2L10      -------------------------FCKFSCSAREV----SQDSSMKRAL
A0A3P8W7K5_BCL2L10      -------------------------FCEFSHSAREL----SQDSSMKTAL
Q9Z0F3_BCL2L10-01       -------------------------FCRFFKNPLPL----GFWRRLLIQA
M3Y8D1_BCL2L10-01       -------------------------FCLFFTPAL------LSWKRLLVQA
E1B9B3_BCL2L10-01       --------KDAGLVGSLGRAHAAGWILSLLQPLIP-----AILGKTAGLV
A0A1U7QVA0_BCL2L10      -------------------------FCVIFGSPLPL----DFWSTLLIKT
F1RZB9_BCL2L10-01       -------------------------FCLFFQGSLQ-----QTWTRHMVWV
F1MV39_BCL2L10-01       -------------------------FCLFFSQSFQ-----PSWERQLVWF
W5QIG4_BCL2L10-01       -------------------------FCLSFSHSLQ-----PSWERQLVWF
Q99M66_BCL2L10-01       -------------------------FCQFFKNPLPP----GFWRRLLIRA
F6ZPD4_BCL2L10-01       -------------------------FCDFSLTLP------ASQRILLVRF
A0A2K6F2Q2_BCL2L10      -------------------------FCDLFRKPLPL----AVWRRLLVQV
H0WZ06_BCL2L10-01       -------------------------FCQFFRTPLPL----AFWRRLLFEV
A0A1U7UZD8_BCL2L10      -------------------------FCVFFSTPLPL----TFWRRLPVQA
G1T264_BCL2L10-01       -------------------------FCVFYRTPLPL----TFWRRLLVRT
A0A0D9RG38_BCL2L10      -------------------------FCHFFRSPFPL----AFWRKLLIQA
A0A2K5RIU7_BCL2L10      RRGTR-----GGMGTREGLTHVPRWLLLLLQDLLLT----GIMEKIAGPG
A0A2K5F974_BCL2L10      RRGTRASRVAGNIG----------WLLLLLQDLLLA----GIMEKTAGPG
A0A2K6TIT7_BCL2L10      RR-----RTWGGMGTWEGPARWGIFLLCLLNDLLLA----G-MEKTAGPG
F7CT87_BCL2L10-01       -------------------------FCYFFRTSSLL----ALWRKVLVQV
A0A096NM44_BCL2L10      RRTPGRG---AGRASGKRPRGRHGWLLSLLQEPLSA----GFLEKTADPG
A0A2K6R5T5_BCL2L10      RRTPGRG---AGRASGKRPRGRHGWLLSLLQDPLSA----GFLEKTADPG
Q9HD36_BCL2L10-02       RRTPGHG---AGRAAGKRPRGWHGWLLSLLQDPLST----GFLEKTAGPG
G1R3W6_BCL2L10-01       RRTPGHG---AGRAAGKRPRGRHGWLLSLLQDPLSA----GFLEKTAGPG
A0A2K5K3B0_BCL2L10      -------------------------FCHFFRTPFPL----AFWRKLLIQA
A0A2K6M5H5_BCL2L10      -------------------------FCHFFRTPFPL----AFWRKLLIQA
A0A2K5TKG9_BCL2L10      -------------------------FCHFFRSPFPL----AFWRKLLIQA
F7H6U5_BCL2L10-01       -------------------------FCHFFRSPFPL----AFWRKLLIQA
A0A2K6B2D9_BCL2L10      -------------------------FCHFFRSPFPL----AFWRKLLIQA
A0A2K5MMZ4_BCL2L10      -------------------------FCHFFRSPFPL----AFWRTLLIQA
H2NN92_BCL2L10-01       -------------------------FCHFFRTPLPL----AFWRKQLVQA
A0A2R9BCD9_BCL2L10      -------------------------FCHFFRTPFPL----AFWRKQLVQA
H2Q9G4_BCL2L10-01       -------------------------FCHFFRTPFPL----AFWRKQLVQA
G3QLU6_BCL2L10-01       -------------------------FCHFFRTPFPL----AFWRKQLVQA
A0A337RYG8_BCL2L10      -------------------------FCLFFSPMLP-----SSWRRLLVQA
G1LKR4_BCL2L10-01       -------------------------FCLFFTPMLP-----SSWKRLLAQA
A0A452QJG0_BCL2L10      -------------------------FCLFFTPMLAVRLGKDCWPRLFCPA
                                                 :                        

G1QEX2_BCL2L10-01       LRACLVLIILIC-LWIKIM-------------------------------
F6VJQ0_BCL2L10-01       AAAAGFGLVGLALLLVVR--------------------------------
A0A3Q4MN81_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3B4ETX9_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
D2IT42_BCL2L10-02       FAAAGVGIAGLTFLLVR---------------------------------
A0A3Q0S9R1_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
I3J363_BCL2L10-01       FAAAGVGLAGLTFLLVKGFRF-----------------------------
A0A3Q2UUN9_BCL2L10      FAAAGVGLAGLTFLL-----------------------------------
A0A3P8PVZ8_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q2UUN9_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3P9BLI0_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q2PJS5_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
A0A3Q2GL87_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
A0A3B5MJ12_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
M4AUW7_BCL2L10-01       VAVAGVGIAGLTFLLVR---------------------------------
A0A096ME02_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
A0A3B3TYN4_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
A0A3B3YT99_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
A0A3P9NE65_BCL2L10      VAVAGVGIAGLTFLLVR---------------------------------
A0A3P9IIZ2_BCL2L10      FAAASVGLAGLTFLLVR---------------------------------
A0A3P9LM07_BCL2L10      FAAASVGLAGLTFLLVR---------------------------------
H2MBQ3_BCL2L10-01       FAAASVGLAGLTFLLVR---------------------------------
A0A3B4AAV4_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q3EZT5_BCL2L10      FAAAGVGLAGLTFLLIRVQA------------------------------
A0A3Q3EZT5_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q3JQ78_BCL2L10      FAAAGVGLAGLTFLLETSGTCEREQFRKSD--------------------
A0A3B4TIY6_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3B4WGF4_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q3KZW1_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3B5KD08_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q3VI28_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q1GM98_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3Q1D2L0_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3P8RL82_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3B4ZFS0_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3B3C5I4_BCL2L10      FAAASVGLAGLTFLLVR---------------------------------
A0A3Q1IAB0_BCL2L10      FAAAGVGLAGLTFLLVR---------------------------------
A0A3P8W7K5_BCL2L10      FAAASVGLAGLTFLLVR---------------------------------
Q9Z0F3_BCL2L10-01       FLSGFFATAIFF-IWKRL--------------------------------
M3Y8D1_BCL2L10-01       LLSCFTAVILIY-FWKRLPFIG----------------------------
E1B9B3_BCL2L10-01       FPLILDSNNHNL-LLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPS
A0A1U7QVA0_BCL2L10      FLSCVIATAILF-VWKRLL-------------------------------
F1RZB9_BCL2L10-01       FVSYCTAVVLLY-LWRKLL-------------------------------
F1MV39_BCL2L10-01       FLAYWTAIIIIY-FWIKLL-------------------------------
W5QIG4_BCL2L10-01       FLSYWTAIIIIY-FWIKLS-------------------------------
Q99M66_BCL2L10-01       ILSCFFATAIFY-IWKCL--------------------------------
F6ZPD4_BCL2L10-01       LLSCFSASVLIY-LWTKLS-------------------------------
A0A2K6F2Q2_BCL2L10      LLSCFLATTVIY-FWTRLL-------------------------------
H0WZ06_BCL2L10-01       LLLCFLATVFIY-FWTRLT-------------------------------
A0A1U7UZD8_BCL2L10      FVSCLLAMAFIYFFWTRLL-------------------------------
G1T264_BCL2L10-01       FLSCFVATALLF-AWTRVYREL----------------------------
A0A0D9RG38_BCL2L10      FLACLLATAFGY-LWTRLL-------------------------------
A0A2K5RIU7_BCL2L10      FPVMVVNSSIHL-LLDTIIRSFKIFSPLLPAQL-----------------
A0A2K5F974_BCL2L10      FPVMVVNSSIHL-LLDTIIRSF----------------------------
A0A2K6TIT7_BCL2L10      FPVMVVNSSIHL-LLDTIIRSFKIFSPLLPAQL-----------------
F7CT87_BCL2L10-01       FLSWLLTAVFIY-FWTR---------------------------------
A0A096NM44_BCL2L10      FPGMLVSNSLRL-SLDTIIMSFNIFNPLLPAQL-----------------
A0A2K6R5T5_BCL2L10      FPGMLVNNSLRL-PLDTIIMSFKIFNPLLPAQL-----------------
Q9HD36_BCL2L10-02       FSVMLVNNSLHL-SLDTIIMSFKTFNPLLPAQL-----------------
G1R3W6_BCL2L10-01       FSVMLVNNSLHL-FLDTIIMSFKTFNPLLPAQL-----------------
A0A2K5K3B0_BCL2L10      FLACLLTTAFGY-LWTRLL-------------------------------
A0A2K6M5H5_BCL2L10      FLACLLTTAFGY-LWTRLL-------------------------------
A0A2K5TKG9_BCL2L10      FLACLLATAFGY-LWTRLL-------------------------------
F7H6U5_BCL2L10-01       FLACLLATAFGY-LWTRLL-------------------------------
A0A2K6B2D9_BCL2L10      FLACLLATAFGY-LWTRLL-------------------------------
A0A2K5MMZ4_BCL2L10      FLACLLATAFGY-LWTRLL-------------------------------
H2NN92_BCL2L10-01       FLSCLLTTAFIY-LWTRLL-------------------------------
A0A2R9BCD9_BCL2L10      FLSCLLTTAFIY-LWTRLL-------------------------------
H2Q9G4_BCL2L10-01       FLSCLLTTAFIY-LWTRLL-------------------------------
G3QLU6_BCL2L10-01       FLSCLLATAFIY-LWTRLL-------------------------------
A0A337RYG8_BCL2L10      LLSCFTVMILIY-FWRRLL-------------------------------
G1LKR4_BCL2L10-01       LLSCFTAVILIY-FWKRLL-------------------------------
A0A452QJG0_BCL2L10      ----SQAVILIY-FWKRLCEF-----------------------------
                                                                          

G1QEX2_BCL2L10-01       --------
F6VJQ0_BCL2L10-01       --------
A0A3Q4MN81_BCL2L10      --------
A0A3B4ETX9_BCL2L10      --------
D2IT42_BCL2L10-02       --------
A0A3Q0S9R1_BCL2L10      --------
I3J363_BCL2L10-01       --------
A0A3Q2UUN9_BCL2L10      --------
A0A3P8PVZ8_BCL2L10      --------
A0A3Q2UUN9_BCL2L10      --------
A0A3P9BLI0_BCL2L10      --------
A0A3Q2PJS5_BCL2L10      --------
A0A3Q2GL87_BCL2L10      --------
A0A3B5MJ12_BCL2L10      --------
M4AUW7_BCL2L10-01       --------
A0A096ME02_BCL2L10      --------
A0A3B3TYN4_BCL2L10      --------
A0A3B3YT99_BCL2L10      --------
A0A3P9NE65_BCL2L10      --------
A0A3P9IIZ2_BCL2L10      --------
A0A3P9LM07_BCL2L10      --------
H2MBQ3_BCL2L10-01       --------
A0A3B4AAV4_BCL2L10      --------
A0A3Q3EZT5_BCL2L10      --------
A0A3Q3EZT5_BCL2L10      --------
A0A3Q3JQ78_BCL2L10      --------
A0A3B4TIY6_BCL2L10      --------
A0A3B4WGF4_BCL2L10      --------
A0A3Q3KZW1_BCL2L10      --------
A0A3B5KD08_BCL2L10      --------
A0A3Q3VI28_BCL2L10      --------
A0A3Q1GM98_BCL2L10      --------
A0A3Q1D2L0_BCL2L10      --------
A0A3P8RL82_BCL2L10      --------
A0A3B4ZFS0_BCL2L10      --------
A0A3B3C5I4_BCL2L10      --------
A0A3Q1IAB0_BCL2L10      --------
A0A3P8W7K5_BCL2L10      --------
Q9Z0F3_BCL2L10-01       --------
M3Y8D1_BCL2L10-01       --------
E1B9B3_BCL2L10-01       ETFLSAFM
A0A1U7QVA0_BCL2L10      --------
F1RZB9_BCL2L10-01       --------
F1MV39_BCL2L10-01       --------
W5QIG4_BCL2L10-01       --------
Q99M66_BCL2L10-01       --------
F6ZPD4_BCL2L10-01       --------
A0A2K6F2Q2_BCL2L10      --------
H0WZ06_BCL2L10-01       --------
A0A1U7UZD8_BCL2L10      --------
G1T264_BCL2L10-01       --------
A0A0D9RG38_BCL2L10      --------
A0A2K5RIU7_BCL2L10      --------
A0A2K5F974_BCL2L10      --------
A0A2K6TIT7_BCL2L10      --------
F7CT87_BCL2L10-01       --------
A0A096NM44_BCL2L10      --------
A0A2K6R5T5_BCL2L10      --------
Q9HD36_BCL2L10-02       --------
G1R3W6_BCL2L10-01       --------
A0A2K5K3B0_BCL2L10      --------
A0A2K6M5H5_BCL2L10      --------
A0A2K5TKG9_BCL2L10      --------
F7H6U5_BCL2L10-01       --------
A0A2K6B2D9_BCL2L10      --------
A0A2K5MMZ4_BCL2L10      --------
H2NN92_BCL2L10-01       --------
A0A2R9BCD9_BCL2L10      --------
H2Q9G4_BCL2L10-01       --------
G3QLU6_BCL2L10-01       --------
A0A337RYG8_BCL2L10      --------
G1LKR4_BCL2L10-01       --------
A0A452QJG0_BCL2L10      --------
                                

© 1998-2020Legal notice