Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
miyglfvtlfctipnhdhtsagysvavvssfhsphdvpstkimsrggvthsasaegktqmyrgspsavwmcreqsdiagr
                                mfqlswglflleaesadkc dmgvalrlhsraqrdlctsvmpdqlreg
                                                         apvwae     snrsavlhwtrv
                                                          mpr a     r   gatppgaq
                                                           cn       e    srsms m
                                                                         mggf   
                                                                         h  a   
                                                                         g      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :   *  :  :::                  .: :*                                      
--mscgLrkrTlrlaeDYlslccrsP-tpappPpseeAAamRrlaadmeqqhqarfsa----flgy-ggdrcellrkvme
kmkadpfwee eavlaewieyrateqghqerr-stpsvtvl sagqrlrklyrsflhslaqtyrrqcppnlvssvalmad
ttvfea qqd av vt fmgfsssgtvravstat-ap sli cvtwqiqrrnprvwdt t g-vkhsrthpflnmvrlek
ga-vpr ev- vq sl   rc tarstls-la a va  t  htstvvwaitept qn s sa-vfrqrshlygatqqvq
adyq s vl  rl  m   hs  qprnqtp-q - m   m  am sksltk wns pl   n itcplsefivvtew ir
rntg q kg   g  s   lr   neds gq-   -      g  rg  ea ahl nd   d cd-ael aetqqwn nv
mis- l hd      q   fh   d aa   s   r      y  ey  sv yd  ev   a  -s  w   qe km   
  gk e         i   y    a  w   l   l      l   s  pe vv   r      n   q   pc  i   
                   t       v       g      f   h  ly kf   c      e   a   g   d   
                   q       g              d   e   g he          a       d       
                           d                                            a       
                           c                                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .      .*  :. :. :.* :                                       :.  :   :    :  .
elvgdgh-lnWGRVVsLftFaGvLlrr----lveqkwkkpgldp--rlkqelgqvp-rd-CrrLvetladyLgg-qkraW
avlshspgpt ynlativalt tiaeqgpymiltarg----fqsrqgqqeqeadeagvstrqaiaalissrfverehkdr
smfaepqdfs ss  m lv v s mnkersg-r--t-tnws-el  -kgrwdqggs gn wyg tdfvcaq ak r ge 
ri dndrpm  lq  a  s   a vslpe  rqkywdvqrdp-r  e-r-gvd--r qh ssl  gk ynf tt h  t 
ke pse-e    h  v      m sqms   qtat-pmrlvqr-  qr-kp--pl- mt  pe    gw er d  s 
 mkrtv       l         khq   pgvrnslgqeykq  vtlvdrvert -q  ch     l m  t  v 
   egnlt                 d h   s-snsrrtd hsn  npegkktnid ee           c       
   c  gs                   d   mmpkqnps    k  lev -art l s            s       
       r                   a   ae clksd       ddn r ps g i              l       
       a                       vk  geq        aad n nk e                k       
                               tc  e              a mi                          
                                                    la                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:    **  .                          :                                           
LqangGW-dg--------------------------fckfsrsarev----sqdssmktalfaaagvglagltfllvr--
mleqd  vestrrtpgrgrvwagratgkrprgrhgwllhyfhtplplrlgkafwrkllvqavlscllatsfiy-fwttll
 edhn   vam  gtrhs tdgnmgswegrahwprfivsllqnlfsa    gslertaipglpvmfttiilglgsvdkii
 mtly   t       a  ka  lvasl ltrvgi  hlsalpspl-    dimltqskwv-vlysfnnvihf i k-vs
 h      s              i gr     aa    enysdms-t    thqpivpgrftsg-vssvtvrc v ilsy
        n                             vi tkrqqp    p-pk imdnti--wwqvsnhf  p rcat
                                      qh kh ik     nlgt hfaln rciimlm an  a -  q
                                      n  cg  g     -veg d sk    gci a       g  p
                                      d  nq  a     rt d   re      d         e  m
                                      y  mi        qp     f                    g
                                      r  ge        lc     c                    c
                                      c  ea                                     

       330       340       350         
....:....|....:....|....:....|....:....
                                       
---------------------------------------
rsfkifnpllpaqlnqaklkcerpnqskppsetflsafm
mlvvtqsstsltls                         
visrrlirkcd                            
tflne f                                
leg                                    
fce                                    
e                                      
a                                      
                                       
                                       
                                       
© 1998-2020Legal notice