Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
miyglfvtlfctipnhdhtsagysvavvssfhsphdvpstkimsrggvthsasaegktqlyrrspsavcmcreqsdiagr
                                mfqlswglflleaesadkcldmgvalrmhsgaqrdlwtsvmpdqlreg
                                                         apvwae     snrsavlhwtrv
                                                          mpr a     r   gatppgaq
                                                           cn       e    srsms m
                                                                         mggf   
                                                                         h  a   
                                                                         g      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :   *  :  :::                  .: :*                                      
-mm-cgLrkrTlrlaeDYlslccrsP-tpappPpseeAAamRrlaadmeqqhqarfsa----flgy-ggdrcellrkvme
k-sadpfwee eavlaewieyrateqghqerr-stpsvtvl sagqrlrklyrsflhslaqtyrrqcppnlvssvalmad
ttkfea qqd av vt fmgfsssgtvravstat-ap sli cvtwqiqrrnprvwdtatng-vkhsrthpflnmvrlek
gavvpr ev- vq sl   rc tarstls-la a va  t  htstvvwaitept qn s sl-vfrqrshlvgatqqvq
ad-q s vl  rl  m   hs  qprnqtp-q - m   m  am sksltk wns pl l n idcpesqviyvtew ir
rnyg q kg   g  s   lr   neds gq-   -      g  rg  ea ahl nd   q ct-e lef tq wn  -
mits l hd      q   fh   d aa   s   r      y  ey  sv yd  ev   d  -sa w a qc km   
  gk e         i   y    a  w   l   l      l   s  pe vv   r   a  er  q   g   e   
                   t       v       g      f   h  ly kf   c      a   e   d   d   
                   q       g              d   e   g he              a   a       
                           d                                                    
                           c                                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .*  :. :. :.* :                                      :.  :   :    :  .:
elvgdgh-lnWGRVVsLftFaGvLarr----lveqkwkkpgldp--rlkqelgqvp-rdCrrLvetladyLgg-qkraWL
avlshspgpt ynlativalt tileqgpymiltarg----fqsrqgqqeqeadearvsrqaiaalissrfverehkdrm
sm-aepqdfs ss  m lv v s mnkersg-r--t-tnws-el  -kgrwdqggsgmnwyg tdfvcaq ak r ge  
rifdndrpm  lq  a  s   a vslpel rqkywdvqrdp-r  e-r-gvd--r gtssl  gk ynf tt h  t  
k- pse-e    h  v      m sqms   qtat-pmrlvqr-  qr-kp--pl- qh pe    gw er d  s  
-  -krtv       l         khq   pgvrnslgqeykq  vtlvdrvert eq ch     l m  t  v  
d  egnlt                 d h   s-snsrrtd hsn  npegkktnid -           c        
   c  gs                   d   mmpkqnps    k  lev -art l s           s        
       r                   a   ae clksd       ddn r ps g i             l        
       a                       vk  geq        aad n nk e               k        
                               tc  e              a mi                          
                                                    la                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    **  .                          :                                            
langGW-dg--------------------------fckfsrsarev----sqdssmktalfaaagvglagltfllvr---
qeqd  vestrrtpgrgrvwagratgkrprgrhgwllhyfhtplplrpskafwrkllvqavlscllatsfiy-fwttllr
edhn   vam  gtrhs tdgnmgswegrahwprfivsllqnlfsaplgdgslertaipglpvmfttiilglls dkiim
mtly   t       a  ka  lvasl ltrvgi  hlsalpspl-    dimltqpkwv-vlysfnnvihf i k-vsv
h      s              i gr     aa    enysdmsqt    thqkivmgrfisg-vssvtvrc v ivsyt
       n                             vi tkrq-p    p-nt ifdlta--wwqvsnhfa p rcrtf
                                     qh kh ik     nlgp hcckm r icilm  n  a - gqe
                                     n  cg  g     -ven   ai    g d a       e  pa
                                     d  nq  a     rt g   re                   m 
                                     y  mi        qc d   f                    g 
                                     r  ge        l                           f 
                                     c  ea                                    c 

       330       340       350        
....:....|....:....|....:....|....:...
                                      
--------------------------------------
sfkifnpllpaqlnqaklkcerpnqskppsetflsafm
fsrtqsstsltls                         
ilnelirkcd                            
eg   f                                
ce                                    
                                      
                                      
                                      
                                      
                                      
                                      
© 1998-2020Legal notice