Dataset for protein BCL-2-like of organism Taeniopygia guttata

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H0Z8G3_BCL2L1-01      ----MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDG
H0ZCL9_BCL2A1-01      METAEFYYVYYLAQDYLQYVLQESHLGPAQ--------------------
                           :     *. *::.* *.:.  . :*                    

H0Z8G3_BCL2L1-01      VLNGSPSWHAATSHIVNGATVHQNSLEVHEIRRAADVRQALREAGDEFEL
H0ZCL9_BCL2A1-01      ----------------------------------TRVAHVLRTMASSLQD
                                                        : * :.**  ...:: 

H0Z8G3_BCL2L1-01      RYRRAFSDLTSQLHITP-STAYQSFEQVVNELFRDG-VNWGRIVAFFSFG
H0ZCL9_BCL2A1-01      QTEEAVRPLLDRIDITSVAAAKRIFNGVMDEKFADGNTNWGRIMTIFTFG
                      .   *.  * ..: **. ::* . *: *::* * ** .*****:::*:**

H0Z8G3_BCL2L1-01      GALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWIQENGGWER-FVD
H0ZCL9_BCL2A1-01      GLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWIDANGGWENGFLT
                      * *  :   : :.: .   :.*  ::* *: ::   **: *****. *: 

H0Z8G3_BCL2L1-01      LYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK--
H0ZCL9_BCL2A1-01      KFE--------------RRSLLSFSKITALFIALVSLFREYY
                       :               .. **: :.::.:::    * *:  

© 1998-2020Legal notice