Dataset for protein BCL-2-like of organism Taeniopygia guttata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :     *. *::.* *.:.  . :*                                                  
----myyyvyyLvqDyvsYvLsqshyswsQ--------------------------------------------------
metaefssnre ai flq k qekglgpa leeedenrtdfageedemdgvlngspswhaatshivngatvhqnslevhe

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    : * :.**  ...:: .   *.  * ..: **. ::* . *: *::* * ** .*****:::*:*** *  :   :
----trVrqvLRtmgsslqlryrrAvspLtsrlhITs-stAyrsFnqVvnElFrDG-vNWGRIvtiFtFGGlLtvksvvk
irraad aha  eaadefedqtee frd ldqid  pvaa kqi eg md k a  nt     maf s   a ckelqeh

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :.: .   :.*  ::* *: ::   **: *****. *:  :               .. **: :.::.:::    * *:
gvrvtv---krIvywmTtYltnnldpWIqeNGGWEr-Fvtlyg--------------rrwLLtgstvtgvllllvsLsRk
emqllaeekeq ssfi e iidhkae  da     ng ldkfendaaaemrkgqetfnks  sfakiaalfiagsl f e

  
..
  
--
yy
© 1998-2020Legal notice