Dataset for protein Mcl-1 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287BK44_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVG
A0A287BK44_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVG
A0A287BK44_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLL-------------
Q95KR3_MCL1-01          MFGLQRNAVIGLNLYCGGAGLGPGSGSS----------------------
                        ****************************                      

A0A287BK44_MCL1-01      GGEAGMVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A287BK44_MCL1-02      GGEAGMVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A287BK44_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
                                                                          

A0A287BK44_MCL1-01      APTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A287BK44_MCL1-02      APTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A287BK44_MCL1-03      --------------------------------------------------
Q95KR3_MCL1-01          --------------------------------------------------
                                                                          

A0A287BK44_MCL1-01      ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPM
A0A287BK44_MCL1-02      ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPM
A0A287BK44_MCL1-03      ----------------------------------------ATGAKDAKPM
Q95KR3_MCL1-01          --------------------------------------------------
                                                                          

A0A287BK44_MCL1-01      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A287BK44_MCL1-02      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A287BK44_MCL1-03      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
Q95KR3_MCL1-01          ---------------------------AFQGMLRKLDIKNEDDVKSLSRV
                                                   ***********************

A0A287BK44_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A287BK44_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A287BK44_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
Q95KR3_MCL1-01          MVHVLSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
                        ****:*********************************************

A0A287BK44_MCL1-01      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A287BK44_MCL1-02      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRSNKIAF--------------
A0A287BK44_MCL1-03      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q95KR3_MCL1-01          RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
                        ******************************.  :**              

A0A287BK44_MCL1-01      R
A0A287BK44_MCL1-02      -
A0A287BK44_MCL1-03      R
Q95KR3_MCL1-01          R
                         

© 1998-2020Legal notice