Dataset for protein Mcl-1 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q95KR3_MCL1-01          MFGLQRNAVIGLNLYCGGAGLGPGSGSS----------------------
A0A287BK44_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVG
A0A287BK44_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVG
                        ****************************                      

Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-02      GGEAGMVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A287BK44_MCL1-01      GGEAGMVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLLFF
                                                                          

Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-02      APTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A287BK44_MCL1-01      APTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
                                                                          

Q95KR3_MCL1-01          --------------------------------------------------
A0A287BK44_MCL1-02      ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPM
A0A287BK44_MCL1-01      ASSGPGTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPM
                                                                          

Q95KR3_MCL1-01          ---------------------------AFQGMLRKLDIKNEDDVKSLSRV
A0A287BK44_MCL1-02      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A287BK44_MCL1-01      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
                                                   ***********************

Q95KR3_MCL1-01          MVHVLSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A287BK44_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A287BK44_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
                        ****:*********************************************

Q95KR3_MCL1-01          RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A287BK44_MCL1-02      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRSNKIAF--------------
A0A287BK44_MCL1-01      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
                        ******************************.  :**              

Q95KR3_MCL1-01          R
A0A287BK44_MCL1-02      -
A0A287BK44_MCL1-01      R
                         

© 1998-2020Legal notice