Dataset for protein Mcl-1 of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A287BK44_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=198 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A287BK44_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=351 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTPAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A287BK44_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=336 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTPAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVEDLEGGIRSNKIAF
>gnl|bcl2dbpro|Q95KR3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=152 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSAFQGMLRKLDIKNEDDVKSLSRVMVHVLSDGVTNWGRIVTLISFGAFVAKHL
KSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice