Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U9CJ81_MCL1-01      MNIIPSTKRAAFNVTTGVMGCLILPQNGVVEGAMHYGSGNSLPQIAVGSV
A0A2U9BY16_BCL2L1-      -----------------------------------MSQNKELVVFYIQYK
A0A2U9BY16_BCL2L1-      -----------------------------------MSQNKELVVFYIQYK
A0A2U9BY16_BCL2L1-      -----------------------------------MSQNKELVVFYIQYK
A0A2U9BY16_BCL2L1-      -----------------------------------MSQNKELVVFYIQYK
A0A2U9BJ09_BCL2-01      ---------------------------------MASECNRNIVEKYICHK
A0A2U9BIG9_BCL2L1-      ----------------------------------MSDSNRELVEFFIGYK
A0A2U9BY16_BCL2L1-      ----------------------------------------DARQRFCGEH
                                                                .         

A0A2U9CJ81_MCL1-01      IDSRGG------------------NVGAGDAPKRPKNLQVSATKAYAAKS
A0A2U9BY16_BCL2L1-      LSQRKY------------------PLNHMGLNEPPN------------RT
A0A2U9BY16_BCL2L1-      LSQRKY------------------PLNHMGLNEPPN------------RT
A0A2U9BY16_BCL2L1-      LSQRKY------------------PLNHMGLNEPPN------------RT
A0A2U9BY16_BCL2L1-      LSQRKY------------------PLNHMGLNEPPN------------RT
A0A2U9BJ09_BCL2-01      LSKRGY---------------VWGFDDVRDEDAADNGSIVAPPPTLVRRC
A0A2U9BIG9_BCL2L1-      LSQRNY-----------PTSLL-RPEDAGGRTEGDKANSAASNGLLVDGG
A0A2U9BY16_BCL2L1-      HSRPEWIRQLFCRFGFHPQSLLWISADHGCLNRGKQGDSLAQRAFTLTQT
                         .                        .        :              

A0A2U9CJ81_MCL1-01      CREDGGGG----------GDVGGGSLPSTPESDGEHDVSGCPAADEALDS
A0A2U9BY16_BCL2L1-      DRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSLDAVKE
A0A2U9BY16_BCL2L1-      DRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSLDAVKE
A0A2U9BY16_BCL2L1-      DRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSLDAVKE
A0A2U9BY16_BCL2L1-      DRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSLDAVKE
A0A2U9BJ09_BCL2-01      HGASTGPDDES--------------------HPDLCRRPPQSEPRAAVHR
A0A2U9BIG9_BCL2L1-      NRC----------------------------GQLGTDPLPPDGGVGAVKE
A0A2U9BY16_BCL2L1-      DRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSLDAVKE
                                                                      *:  

A0A2U9CJ81_MCL1-01      FTRELISQFLRDYVARTDPRWTDSKALSTMKRVVDRLVEKHRYAYNGMMN
A0A2U9BY16_BCL2L1-      ALRDSANEFELRYAR----------------------------AFSDLHN
A0A2U9BY16_BCL2L1-      ALRDSANEFELRYAR----------------------------AFSDLHN
A0A2U9BY16_BCL2L1-      ALRDSANEFELRYAR----------------------------AFSDLHN
A0A2U9BY16_BCL2L1-      ALRDSANEFELRYAR----------------------------AFSDLHN
A0A2U9BJ09_BCL2-01      VLREAGDELERLYQP----------------------------DFTEMSR
A0A2U9BIG9_BCL2L1-      ALRDSAHEFEQLFNQ----------------------------AFSDLSL
A0A2U9BY16_BCL2L1-      ALRDSANEFELRYAR----------------------------AFSDLHN
                          *:   ::   :                               :. :  

A0A2U9CJ81_MCL1-01      RLSLDNRRDDVTFVGAVARSLFGDGNTNWGRVSSLVAFGAVVSQHLKE-T
A0A2U9BY16_BCL2L1-      QLHITPATAYQSF-ESVMNEVFRDG-VNWGRIIGLFAFGGALSVECVE-K
A0A2U9BY16_BCL2L1-      QLHITPATAYQSF-ESVMNEVFRDG-VNWGRIIGLFAFGGALSVECVE-K
A0A2U9BY16_BCL2L1-      QLHITPATAYQSF-ESVMNEVFRDG-VNWGRIIGLFAFGGALSVECVE-K
A0A2U9BY16_BCL2L1-      QLHITPATAYQSF-ESVMNEVFRDG-VNWGRIIGLFAFGGALSVECVE-K
A0A2U9BJ09_BCL2-01      QLYLTSTTAQRRF-AEVIDELFRDG-VNWGRIIAFFEFGGTVCVECADTE
A0A2U9BIG9_BCL2L1-      QLDITPDTAYQSF-KSVMDEVFKDG-VNWGRIVGLFAFGGVLCVECVE-K
A0A2U9BY16_BCL2L1-      QLHITPATAYQSF-ESVMNEVFRDG-VNWGRIIGLFAFGGALSVECVE-K
                        .* :        *   *  .:* ** .****: .:. **..:.    :  

A0A2U9CJ81_MCL1-01      GRGNCVELVGQEISTYLLTDQRDWLVKNNSWEGFVE--------------
A0A2U9BY16_BCL2L1-      EMSSLVGRIVEWMTVYLDNNIQPWIQSQGGWTFCHQTTRPVKPRKMKMPP
A0A2U9BY16_BCL2L1-      EMSSLVGRIVEWMTVYLDNNIQPWIQSQGGWEHFAE--------------
A0A2U9BY16_BCL2L1-      EMSSLVGRIVEWMTVYLDNNIQPWIQSQGGWEHFAE--------------
A0A2U9BY16_BCL2L1-      EMSSLVGRIVEWMTVYLDNNIQPWIQSQGGWEHFAE--------------
A0A2U9BJ09_BCL2-01      EMTSQVDNIAEWMTEYLNGPLNSWIMDNGGWDAFVE--------------
A0A2U9BIG9_BCL2L1-      NRGELVARIADWMTMYLDEHISPWIQSQGGWGCFAE--------------
A0A2U9BY16_BCL2L1-      EMSSLVGRIVEWMTVYLDNNIQPWIQSQGGWEHFAE--------------
                           . *  : : :: **      *: .:..*    :              

A0A2U9CJ81_MCL1-01      ---FFRVADP-------ETTMRNTLIG-----------------------
A0A2U9BY16_BCL2L1-      RTVFHSADGSCISGKVWQNLSRYTAAGQRGEKQEGVQCHGCNRLTHPPPL
A0A2U9BY16_BCL2L1-      ---IFGQDAAAGSRRSQESFKKWLLAG-----------------------
A0A2U9BY16_BCL2L1-      ---IFGQDAAAGSRRSQESFKKWLLAG-----------------------
A0A2U9BY16_BCL2L1-      ---IFGQDAAAGSRRSQESFKKWLLAG-----------------------
A0A2U9BJ09_BCL2-01      ---LYDRHGESVFSCSWPSIKTVFGLA-----------------------
A0A2U9BIG9_BCL2L1-      ---IFGQGAGAEARRYRESVRRWLLVG-----------------------
A0A2U9BY16_BCL2L1-      ---IFGQDAAAGSRRSQESFKKWLLAG-----------------------
                           :.             .       .                       

A0A2U9CJ81_MCL1-01      --LAGFAGVGATLALLIR--
A0A2U9BY16_BCL2L1-      SVVCVVAGSLSLIFSTARGI
A0A2U9BY16_BCL2L1-      --MTLVTGVVVGSLIAQKRL
A0A2U9BY16_BCL2L1-      --MTLVTGVVVGSLIAQKRL
A0A2U9BY16_BCL2L1-      --MTLVTGVVVGSLIAQKRL
A0A2U9BJ09_BCL2-01      --ALGAASLTIGAYLTQK--
A0A2U9BIG9_BCL2L1-      --VGMLTGVLIAMFIAKKQ-
A0A2U9BY16_BCL2L1-      --MTLVTGVVVGSLIAQKRL
                              :.         .  

© 1998-2020Legal notice