Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U9CJ81_MCL1-01      MNIIPSTKRAAFNVTTGVMGCLILPQNGVVEGAMHYGSGNSLPQIAVGSV
A0A2U9BY16_BCL2L1-      -----------------------------------MSQNKELVVFYIQYK
A0A2U9BIG9_BCL2L1-      ----------------------------------MSDSNRELVEFFIGYK
A0A2U9BJ09_BCL2-01      ---------------------------------MASECNRNIVEKYICHK
                                                              ...:    :   

A0A2U9CJ81_MCL1-01      IDSRGG---NVGAGDAPKRPKNLQVSATKAYAAKSCREDGGGGGDVGGGS
A0A2U9BY16_BCL2L1-      LSQRKYPLNHMGLNEPPNRTDRGEAGLGEEQQTAPHANGTLNGVNPG---
A0A2U9BIG9_BCL2L1-      LSQRNYPTSLLRPEDAGGRTEGDKANSAASNGLLVDGGNRCGQLGTD---
A0A2U9BJ09_BCL2-01      LSKRGY---VWGFDDVRDEDAADNGSIVAPPPTLV---RRCHGASTG---
                        :..*          :        : .                  . .   

A0A2U9CJ81_MCL1-01      LPSTPESDGEHDVSGCPAADEALDSFTRELISQFLRDYVARTDPRWTDSK
A0A2U9BY16_BCL2L1-      ----TPPESPLRLQR-LPSSPSLDAVKE----------------------
A0A2U9BIG9_BCL2L1-      ----P-----------LPPDGGVGAVKE----------------------
A0A2U9BJ09_BCL2-01      ----PDDESHPDLCRRPPQSEPRAAVHR----------------------
                            .            . .    :.                        

A0A2U9CJ81_MCL1-01      ALSTMKRVVDRLVEKHRYAYNGMMNRLSLDNRRDDVTFVGAVARSLFGDG
A0A2U9BY16_BCL2L1-      ---ALRDSANEFELRYARAFSDLHNQLHITPATAYQSF-ESVMNEVFRDG
A0A2U9BIG9_BCL2L1-      ---ALRDSAHEFEQLFNQAFSDLSLQLDITPDTAYQSF-KSVMDEVFKDG
A0A2U9BJ09_BCL2-01      ---VLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRF-AEVIDELFRDG
                           .:.     :   .   :. :  .* :        *   *  .:* **

A0A2U9CJ81_MCL1-01      NTNWGRVSSLVAFGAVVSQHLKE-TGRGNCVELVGQEISTYLLTDQRDWL
A0A2U9BY16_BCL2L1-      -VNWGRIIGLFAFGGALSVECVE-KEMSSLVGRIVEWMTVYLDNNIQPWI
A0A2U9BIG9_BCL2L1-      -VNWGRIVGLFAFGGVLCVECVE-KNRGELVARIADWMTMYLDEHISPWI
A0A2U9BJ09_BCL2-01      -VNWGRIIAFFEFGGTVCVECADTEEMTSQVDNIAEWMTEYLNGPLNSWI
                         .****: .:. **..:.    :     . *  : : :: **      *:

A0A2U9CJ81_MCL1-01      VKNNSWEGFVEFFRVADP-------ETTMRNTLIGLAGFAGVGATLALLI
A0A2U9BY16_BCL2L1-      QSQGGWEHFAEIFGQDAAAGSRRSQESFKKWLLAGMTLVTGVVVGSLIAQ
A0A2U9BIG9_BCL2L1-      QSQGGWGCFAEIFGQGAGAEARRYRESVRRWLLVGVGMLTGVLIAMFIAK
A0A2U9BJ09_BCL2-01      MDNGGWDAFVELYDRHGESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQ
                         .:..*  *.*::             :       .    :.:     :  

A0A2U9CJ81_MCL1-01      R--
A0A2U9BY16_BCL2L1-      KRL
A0A2U9BIG9_BCL2L1-      KQ-
A0A2U9BJ09_BCL2-01      K--
                        .  

© 1998-2022Legal notice