Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      ...:    :   :..*          :        : .    
-----------------------------------sssnrelvefyigyklsqRgy---vwgpndapnrtkrdqassvas
mniipstkraafnvttgvmgclilpqngvvegammygqgnsipvkfvqsvids ngptsnvrlgevrkepenlnvnltkp
                                  hmec kn  qia ch   k k  lnlm fe pgg ddggkggigee
                                  a d                      hl ad   d  aa e  aa a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              . .       .            . .    :.                           .:.    
yqtlv---rrcggvstg-------p--es--dl-r-ppssesldavkr-------------------------alrdsad
qplkshrnntlnqlnvdggslpsttps--pp--s-rlaqdppvgsfteelisqflrdyvartdprwtdskalsvmkrvvn
pgaapdgggggh ggp         epdghlrvqgc  p ggra  h                          t  eagh
na   caed    ad          dd  eh  c    a  a                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :   .   :. :  .* :        *   *  .:* ** .****: .:. **..:.    :     . *  : : :: 
elerlyryafsdmsnqLyltpttayqsF-ksVmdevFrDG-vNWGRiiglfaFGgvvsvecve-kergslVgriaewmtv
rfvqrhqrdytglmrr sidsrrdqvt vge irsl k  nt    vvsfve  atlcqhlkdttnmtnq envvqeist
   lkfnq  ne hl  h  nd  drr  ea an   g         sa      a     a  eg sec dl gd   m
   e  ap         d   a       a                                               e

       250       260       270       280       290       300   
....:....|....:....|....:....|....:....|....:....|....:....|...
**      *: .:..*  *.*::             :       .    :.:     :  .  
YLdtpispWiqsqggWehFvEifgqhapa--rrs-esvkrwllvgvtgvtgvvigsylaqk--
  nnnqrs lvknns gg a lyrvggg-vs---wpttrtvtglamlmlasltvtmlitkrrl
  lghlqd  md    dc   drddesgfscyr  imknf i lglf   laalf li 
   ed n          a       a a ea   q  f     a aa a   g  aa      
© 1998-2022Legal notice