Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  *.                                                            
------------------Mgc--------------------------lilpqngvvegamhyGsgnslpqiavgsmidsr
mniipstkraafnvttgv s-esnrelvefyiqyklsqrnypwslmrvrd---r--------------ap--n-------
                   asdq kni vkf gh   k k vtnhlgpnwkpt-terdeagn ekvqt--ts-rtv    
                      c         c      g  lgfddgleaggl d    dl diqns ahl  rl    
                                                e  e            eaap       c    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ggnvgagdapkr-pknlqvsatkayaakscredgggggdvgggslpstpesdgehdvsgcpaadealdsftrelisqflr
------------h---------------------------------------a---------------------------
 ngast tpdes  lrcr alaed lslc ks           rp qsesrl-                           
 h  np pd     dl                                 plal                           
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :     :   .   :  :   :              *  .:  **  ****: .:. *...
dyvartdprwtdskalstmkrvvdrlvekhryayngmmnrLsldnrrddvtFvgaVarslFgDGntNWGRvsslvaFGav
-----------vk---ralrdsareferlyqrrfsdlsrqfyitpttayqss-rs mdevar  -v    iigift agt
   p pa s pphesagvn elgndm qrfnqd te hqa lrqsgp qrr lke in   k  hl     vaf e   a
            d   eg   a h   lq ap  ha al  h  cd  pc   e   e                      
                a          k   a         d   a       a                          
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  .  :                    .      : :: **      *: .:..*  * ::              :    
vsqhlkE---------------t-grgncVelvgqeistYLltdqrdWlvknnsWegFvEffrva-d------pettmrn
lcvecvdqeglkpgldpgqelakeemtslrgriaewmtv  depisp iqsqgg dh akiygqharavsrrsqpsvkk-
 vrq l                q npseq dn-vdt am  nnnlqs  me  gc c lsdsgggsmfscywd srtt
     a                        a       e  gghkn   ld     a      rd eega   r  i   
                                      d    e k                    a e       f   
                                                                                
                                                                                

       330       340       350       360       370       380    
....:....|....:....|....:....|....:....|....:....|....:....|....
  :  ...   ..  .   :                                            
tligLAGfa-gvGatlalli-------------------------------------------r
-wl-avavgmltsvvigsyvrrtcssatsllqptrhipkisvdlaasvkqcglsppslqkqrsl
avf  mtlvllv-mflsgiltflqrd glhk an f             e h cvaklr-
       l  a    f a   d aea n a                         f   trkqw
                                                           npflq
                                                             ckk
                                                              i 
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice