Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        .          .                        .   
-----------------------------------msqnkelvvfyiqyklsqrky------------------plnhmg
mniipstkraafnvttgvmgclilpqngvvegamms-s-rsirqrfvgsvidspgwirqlfcrfgfhptsllwrsvdagd
                                  h-g-g-napekacchhh r ng            q  v inegvrc
                                  ayec nd   i   e   k e                  gfd    
                                    d                                      a    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :                                                            *:    *:   :: 
lneppn------------rtdrgeaglgeeqqtaphangtlngvnpgtppesplrlqrlpsspsldAvkealRdsanefe
rtrgdkgssvastptlvtqsnge----------------------------hqgltdvsgqpgpvg lhsvt elisqll
epkrkqnnqlsqrklylrkgh cst pdd s        dvg gslpst  gddghrpp pdegre  drf   agh   
adaa  alia ppgftadgcc adg g                           ec    c aada          d   
       d   anaa  a                                                              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :                               :. :  .* :        *   *  .:* ** .****: .:. **.
lryar----------------------------afsdlhnqLhitpatayqsF-esVmnevFrDG-vNWGRiiglfaFGg
rlfvqrtdprwtdskalstmkrvvdrlvekhrydytgmsrr yldstrdqvt vke idsl k  nt    vvsfve  a
qd qp                              ne ml  s  nr  drr  ga ar   g         sa      
   na                                     d   d       a                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.:.    :     . *  : : :: **      *: .:..*    :                 :.             . 
alsvecve-kemsslVgrivewmtvYLdnniqpWiqsqggWehfae-----------------ifgqdaaagsrrsqesf
vvcqhlkdttnrgnq envaqeist  ntpqss lvknns tgcvqttrpvkprkmkmpprtvfysvhgs------wqtv
t     a  eg tec dl gd   m  lghlrd  md    gf h                  lhrrgdpsvfsky-pnt
                      e   ed n         dc                      daa gciagcvr  l
                                          a                          e e       i

       330       340       350       360       370
....:....|....:....|....:....|....:....|....:....|
      .                             :.         .  
kkwllag-------------------------mtlvtgvvvgsliaqkrl
srytgvaqrgekqegvqchgcnrlthppplsvvlglasslitmfltkr--
rtvfal                          lgvf  ltsllysli qi
m n  i                          acma   gaaia  a 
                                 a        a       
© 1998-2020Legal notice