Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                    .....*  : :   :..*    . :   :.  *..        :
mniipstkraafnvttgvmgclilpqngvvegammsgqgns pqifvqsvids k--tnlmrlgepgk pergeagl-ek
                                  hmd  k   e a        g  lghl ae   g  d       de

        90       100       110       120       130       140       150       160
 : :.      .. .      . :    **.           .  *..*** . :.*:   :               .*:
lntspskglllksgrpdtppgspvrlgr  psgesdgehdvsslg ad   dsftn liqqylrdyvartdprwtdnq l
a s  haagaac ecggge d  gdp   d           cd          h   ll               ak  

       170       180       190       200       210       220       230       240
* :   :     .   :::.:*:                   .:* ** .****: .*.***..:.    *.  .. *  
 tmknvvhrlvdkhryaykgm drlsldnrrddvtfvgavarsl k  nt    vss v   aavcqhlk tgmsnc el
   hl      a      e                          g         i                 e  

       250       260       270       280       290       300       310
: : :: **      *: .:..*  *.*:*       : *         * *:  .:**     :  .  
vgeeist  lnhqrd lvknns gg v f rvddgegsm sr--vrr-- i mglla  ligmfllkrrl
 ad   m   ed q          c       a a ea  nq  fkk   a lagf   gaala  i 
© 1998-2022Legal notice