Dataset for protein Bcl-xL of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4P3X2_BCL2L1-      MPEPAFLPRISEESCQADPRLREQLSQKGYNWSQFEDENRTEASEGTEIP
A0A7N4P3X2_BCL2L1-      --------MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIP
                                   .:   .   *  :**************************

A0A7N4P3X2_BCL2L1-      STVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFE
A0A7N4P3X2_BCL2L1-      STVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFE
                        **************************************************

A0A7N4P3X2_BCL2L1-      LRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGG
A0A7N4P3X2_BCL2L1-      LRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGG
                        **************************************************

A0A7N4P3X2_BCL2L1-      ALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENGGWDTFVELYGND
A0A7N4P3X2_BCL2L1-      ALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENGGWDTFVELYGND
                        **************************************************

A0A7N4P3X2_BCL2L1-      AAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
A0A7N4P3X2_BCL2L1-      AAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
                        ***********************************

© 1998-2021Legal notice