Dataset for protein Bcl-xL of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3WKX6_BCL2L1-01      --------MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIP
G3WKX6_BCL2L1-02      MPEPAFLPRISEESCQADPRLREQLSQKGYNWSQFEDENRTEASEGTEIP
                                 .:   .   *  :**************************

G3WKX6_BCL2L1-01      STVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFE
G3WKX6_BCL2L1-02      STVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFE
                      **************************************************

G3WKX6_BCL2L1-01      LRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGG
G3WKX6_BCL2L1-02      LRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGG
                      **************************************************

G3WKX6_BCL2L1-01      ALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENGGWDTFVELYGND
G3WKX6_BCL2L1-02      ALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENGGWDTFVELYGND
                      **************************************************

G3WKX6_BCL2L1-01      AAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
G3WKX6_BCL2L1-02      AAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
                      ***********************************

© 1998-2021Legal notice