Dataset for protein Bcl-xL of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           .:   .   *  :********************************************************
--------rsssnseqvvprLsyqLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAH
mpepaflpmiheercladdf rek                                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKE
                                                                                

       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
***************************************************************************
MEVLVARITSWMATYLDEHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
                                                                           
© 1998-2021Legal notice