Dataset for protein Bfl1 of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3WSP8_BCL2A1-01      --------------------------------------------------
G3WSP8_BCL2A1-02      MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEK
G3WSP8_BCL2A1-04      MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEK
G3WSP8_BCL2A1-03      MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEK
                                                                        

G3WSP8_BCL2A1-01      -----------------------------------MAAAAALSGFKRNLR
G3WSP8_BCL2A1-02      DMETFLSTLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI
G3WSP8_BCL2A1-04      DMETFLSTLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI
G3WSP8_BCL2A1-03      DMETFLSTLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI
                                                          .  .:: .*   * 

G3WSP8_BCL2A1-01      AEMKQRLRALSAEERLRQSRLLTEKVI---------------AHSKYQES
G3WSP8_BCL2A1-02      KKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWVIAHSKYQES
G3WSP8_BCL2A1-04      KKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGW----------
G3WSP8_BCL2A1-03      KKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGW----------
                       :: ..  .*: : .   *.:::* ::                       

G3WSP8_BCL2A1-01      QRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRLFSAE
G3WSP8_BCL2A1-02      QRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRLFSAE
G3WSP8_BCL2A1-04      --------------------------ENGFIKNFEPNMVWPNFTDISTKI
G3WSP8_BCL2A1-03      --------------------GVWISSSCQVLDLTNRETAWEGGRDTMTLT
                                                .  .:   : :  : .     :  

G3WSP8_BCL2A1-01      -EIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGR
G3WSP8_BCL2A1-02      -EIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGR
G3WSP8_BCL2A1-04      WNVFSFLK------------------------------------------
G3WSP8_BCL2A1-03      --------------------------------------------------
                                                                        

G3WSP8_BCL2A1-01      GKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYE
G3WSP8_BCL2A1-02      GKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYE
G3WSP8_BCL2A1-04      --------------------------------------------------
G3WSP8_BCL2A1-03      --------------------------------------------------
                                                                        

G3WSP8_BCL2A1-01      DK
G3WSP8_BCL2A1-02      DK
G3WSP8_BCL2A1-04      --
G3WSP8_BCL2A1-03      --
                        

© 1998-2021Legal notice