Dataset for protein Bfl1 of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEK
A0A7N4P573_BCL2A1-      MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEK
A0A7N4P573_BCL2A1-      MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEK
                                                                          

A0A7N4P573_BCL2A1-      -----------------------------------MAAAAALSGFKRNLR
A0A7N4P573_BCL2A1-      DMETFLSTLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI
A0A7N4P573_BCL2A1-      DMETFLSTLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI
A0A7N4P573_BCL2A1-      DMETFLSTLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI
                                                            .  .:: .*   * 

A0A7N4P573_BCL2A1-      AEMKQRLRALSAEERLRQSRLLTEKVI---------------AHSKYQES
A0A7N4P573_BCL2A1-      KKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWVIAHSKYQES
A0A7N4P573_BCL2A1-      KKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGW----------
A0A7N4P573_BCL2A1-      KKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGW----------
                         :: ..  .*: : .   *.:::* ::                       

A0A7N4P573_BCL2A1-      QRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRLFSAE
A0A7N4P573_BCL2A1-      QRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRLFSAE
A0A7N4P573_BCL2A1-      --------------------GVWISSSCQVLDLTNRETAWEGGRDTMTLT
A0A7N4P573_BCL2A1-      --------------------------ENGFIKNFEPNMVWPNFTDISTKI
                                                  .  .:   : :  : .     :  

A0A7N4P573_BCL2A1-      -EIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGR
A0A7N4P573_BCL2A1-      -EIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGR
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      WNVFSFLK------------------------------------------
                                                                          

A0A7N4P573_BCL2A1-      GKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYE
A0A7N4P573_BCL2A1-      GKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYE
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4P573_BCL2A1-      DK
A0A7N4P573_BCL2A1-      DK
A0A7N4P573_BCL2A1-      --
A0A7N4P573_BCL2A1-      --
                          

© 1998-2021Legal notice