Dataset for protein Bfl1 of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4P573_BCL2A1-      -MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVE
A0A7N4P573_BCL2A1-      MAAAAALSGFKRNLRAEMKQRLRALSAEERLRQSRLLTEKVIAHSKYQES
A0A7N4P573_BCL2A1-      -MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVE
A0A7N4P573_BCL2A1-      -MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVE
                          * . :  .:   .  :*:  .     . *..:  : :**    : : .

A0A7N4P573_BCL2A1-      KDMETFLSTLD-ITSVDCARRIFNS-----VMEKEFEDGIINWGRIVTIF
A0A7N4P573_BCL2A1-      QRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRL----
A0A7N4P573_BCL2A1-      KDMETFLSTLD-ITSVDCARRIFNS-----VMEKEFEDGIINWGRIVTIF
A0A7N4P573_BCL2A1-      KDMETFLSTLD-ITSVDCARRIFNS-----VMEKEFEDGIINWGRIVTIF
                        : :. ***  * * : :  . **:.     :   :*:.. ::  *:    

A0A7N4P573_BCL2A1-      AFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWVIA
A0A7N4P573_BCL2A1-      -FSAEEIFSLPKTSWNIHQPGDDEVRE-----------------------
A0A7N4P573_BCL2A1-      AFGGILIKKLLRHRAPLTMDTHEEISH-----------------------
A0A7N4P573_BCL2A1-      AFGGILIKKLLRHRAPLTMDTHEEISH-----------------------
                         *..  * .* .    :     :*:                         

A0A7N4P573_BCL2A1-      HSKYQESQRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDM
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4P573_BCL2A1-      VRLFSAEEIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQ
A0A7N4P573_BCL2A1-      -----------------------------EALSTGGLDLIFMPGLGFDQQ
A0A7N4P573_BCL2A1-      ----------------------------------------FIAEFIMNNI
A0A7N4P573_BCL2A1-      ----------------------------------------FIAEFIMNNI
                                                                *:. : ::: 

A0A7N4P573_BCL2A1-      GNRLGRGKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRI
A0A7N4P573_BCL2A1-      GNRLGRGKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRI
A0A7N4P573_BCL2A1-      AEWIRQNGGWGVWISSSCQVLDLTNRETAWEGGRDTMT----------LT
A0A7N4P573_BCL2A1-      AEWIRQNGGW------ENGFIKNFEPNMVWPNFTDIST----------KI
                        .:.: .. *:           .            :               

A0A7N4P573_BCL2A1-      DEVLYEDK
A0A7N4P573_BCL2A1-      DEVLYEDK
A0A7N4P573_BCL2A1-      --------
A0A7N4P573_BCL2A1-      WNVFSFLK
                                

© 1998-2022Legal notice