Dataset for protein Bfl1 of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
madcefhyvhmlaqdylkhvqqmprlgsclhrtsqilqkvafsvqeevekdmetflstlditsvdcarrifnsvmekefe
--------------------------------------------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .  .:: .*   *  :: ..  .*: : .   *.:::* ::                                 
dgiinwgrivtifaFggiLikkllrhrapLtmdtheeiShfiaEfimnniaewirqnggw--------------------
-----maaaaalsg krn raemkqrlra saeerlrq rllt kvi-------------viahskyqesqrisiflsmq
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .  .:   : :  : .     :                                          
----------difkqgktcfiprykfnsnymdmvrlftae-eifslpk--------------------------------
deieteeiik------snqvlkntnretvwpngtdtssltw-------tswnihqpgddevreealstggldlifmpglg
          gvwissecg  dlfep ma egfr im ki nv  fl                                 

       250       260       270       280       290       300  
....:....|....:....|....:....|....:....|....:....|....:....|..
                                                              
--------------------------------------------------------------
fdqqgnrlgrgkgyydtylkrcfqhqkrrpytialafkeqicdavpvgeddmridevlyedk
                                                              
© 1998-2021Legal notice