Dataset for protein Mcl-1 of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674D1T7_MCL1-01      -------------------------------------------------S
A0A674D165_MCL1-01      -------------MLRFQSGLLAFPEFKLYSNVGYVTIAGTKHCIICASP
A0A673VWA7_MCL1-01      MSLSNSITRATTTMLHFQN---GGSSYLADDARPLYYFHGAGAICAGASP
A0A674ELG3_MCL1-01      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A674ELG3_MCL1-03      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A674ELG3_MCL1-02      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
                                                                         .

A0A674D1T7_MCL1-01      PNRLTAPSPSREGTYPPRDITR----------------------------
A0A674D165_MCL1-01      PGQD--------------------HYIACPEIGNLLKTKLKHLKLSGSID
A0A673VWA7_MCL1-01      KSKV--DMGNGTGDTPPRPTTLGVNVVKSNGLDNHLSDRSNNDD---SLP
A0A674ELG3_MCL1-01      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHISDRSNDDDSDGSLP
A0A674ELG3_MCL1-03      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHISDRSNDDDSDGSLP
A0A674ELG3_MCL1-02      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHISDRSNDDDSDGSLP
                         ..                                               

A0A674D1T7_MCL1-01      --------------------------------------------------
A0A674D165_MCL1-01      STPLFTRRGPGHEYSWGGLEPDSALAYDTTNFGVLLPHTVDTHKCFMCNL
A0A673VWA7_MCL1-01      CTPQMASE---------------------------------------CGP
A0A674ELG3_MCL1-01      CTPQMASE---------------------------------------CGP
A0A674ELG3_MCL1-03      CTPQMASE---------------------------------------CGP
A0A674ELG3_MCL1-02      CTPQMASE---------------------------------------CGP
                                                                          

A0A674D1T7_MCL1-01      ---------------------------NSLNGQCTGLLKPRWNESKALST
A0A674D165_MCL1-01      EINNFISHQETYHHQTGALDTDTRQLIKCVLGQCTGLLKPRWNESKALST
A0A673VWA7_MCL1-01      ELSNCPSGDE-------VLEDDTRQLIENFLGDYTGLSHPRWKQSKPLTT
A0A674ELG3_MCL1-01      ELSNCPSGDE-------VLEHDTRQLIENLLGDYTGLSPPRWKQSKALTT
A0A674ELG3_MCL1-03      ELSNCPSGDE-------VLEHDTRQLIENLLGDYTGLSPPRWKQSKALTT
A0A674ELG3_MCL1-02      ELSNCPSGDE-------VLEHDTRQLIENLLGDYTGLSPPRWKQSKALTT
                                                   : . *: ***  ***::**.*:*

A0A674D1T7_MCL1-01      MSRVVGQLLEKHRYTSNGMINTLYVDDRGDDVKFLSAVTHIIFQDGTVNW
A0A674D165_MCL1-01      MSRVVGQLLEKHRYTYNGMINTLYVDDRGDDVKFLSAVAHIIFQDGTVNW
A0A673VWA7_MCL1-01      MKRVVEDVIAKHRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNW
A0A674ELG3_MCL1-01      MTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNW
A0A674ELG3_MCL1-03      MTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNW
A0A674ELG3_MCL1-02      MTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNW
                        *.*** ::: **.*: ***: .* :*** **: .:.:*:: :*.** .**

A0A674D1T7_MCL1-01      GRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDWLVKHNS
A0A674D165_MCL1-01      GRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDWLVKHNS
A0A673VWA7_MCL1-01      GRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDWLIKNNA
A0A674ELG3_MCL1-01      GRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLVKNNA
A0A674ELG3_MCL1-03      GRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLVKNNA
A0A674ELG3_MCL1-02      GRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLVKNNA
                        **:***.:***.*.* **: **.:*:*:.*::*: **:: : ***:*:*:

A0A674D1T7_MCL1-01      WNGFVEFYPVAEPESRSRNIIITLVGLAGIGAAMTLLVM-----------
A0A674D165_MCL1-01      WNGFVEFFPVAEPESRSRNIIMTPVGLAGIGAAMTLLVM-----------
A0A673VWA7_MCL1-01      WNGFVEFFHVQDPESSVRNTLLAIAGVAGIGATLAMFIR-----------
A0A674ELG3_MCL1-01      WNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRQFPAQPQGCVV
A0A674ELG3_MCL1-03      WNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRNSAD-------
A0A674ELG3_MCL1-02      WNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRN----------
                        *******: * :***  ** ::: .*.**:**::::::            

A0A674D1T7_MCL1-01      --
A0A674D165_MCL1-01      --
A0A673VWA7_MCL1-01      --
A0A674ELG3_MCL1-01      CL
A0A674ELG3_MCL1-03      --
A0A674ELG3_MCL1-02      --
                          

© 1998-2020Legal notice