Dataset for protein Mcl-1 of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A673VWA7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=285 residues).
MSLSNSITRATTTMLHFQNGGSSYLADDARPLYYFHGAGAICAGASPKSKVDMGNGTGDTPPRPTTLGVNVVKSNGLDNH
LSDRSNNDDSLPCTPQMASECGPELSNCPSGDEVLEDDTRQLIENFLGDYTGLSHPRWKQSKPLTTMKRVVEDVIAKHRY
AYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDW
LIKNNAWNGFVEFFHVQDPESSVRNTLLAIAGVAGIGATLAMFIR
>gnl|bcl2dbpro|A0A674D165_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=306 residues).
MLRFQSGLLAFPEFKLYSNVGYVTIAGTKHCIICASPPGQDHYIACPEIGNLLKTKLKHLKLSGSIDSTPLFTRRGPGHE
YSWGGLEPDSALAYDTTNFGVLLPHTVDTHKCFMCNLEINNFISHQETYHHQTGALDTDTRQLIKCVLGQCTGLLKPRWN
ESKALSTMSRVVGQLLEKHRYTYNGMINTLYVDDRGDDVKFLSAVAHIIFQDGTVNWGRVASLTSFGAAVCQYLKDKGRD
NCVEVAGEEISAYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRSRNIIMTPVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A674D1T7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=185 residues).
SPNRLTAPSPSREGTYPPRDITRNSLNGQCTGLLKPRWNESKALSTMSRVVGQLLEKHRYTSNGMINTLYVDDRGDDVKF
LSAVTHIIFQDGTVNWGRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDWLVKHNSWNGFVEFYPVAEPE
SRSRNIIITLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A674ELG3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=300 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHI
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYTGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRQFPAQPQGCVVCL
>gnl|bcl2dbpro|A0A674ELG3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=291 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHI
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYTGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A674ELG3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=288 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHI
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYTGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRN
© 1998-2020Legal notice