Dataset for protein Bcl-2 of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3LY44_BCL2-01      MANDDN----RCIVEKYICHKLLKRGYAWDFENAEDEEDADNNGSMISPP
A0A1S3R1W1_BCL2-01      MANDDN----RFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPR
A0A1S3NIV8_BCL2-01      MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNS
A0A1S3Q9V5_BCL2-01      MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNS
                        *  ::*    * ****** ****: *:.*.*:  ::. .   . .  .  

A0A1S3LY44_BCL2-01      PGLARRCHGANNARPGSVPHLSKRLSQTDPHAAIHRVLREAGDELERLYQ
A0A1S3R1W1_BCL2-01      LGLARRCHGANNAGPSSVPSLSKWLSQPDPHAAIHRVLREAGDELERLYQ
A0A1S3NIV8_BCL2-01      PEVFARRSQPTAAGEDTDPPYQNRSPQPDPHARLHRVLRDAGGEIERMYQ
A0A1S3Q9V5_BCL2-01      PEVFARRSQPSAEGVDTDSPLPNRIPQPDRHARLHRVLREAGDEIEIMYQ
                          :  *   ..    .: .   :. .*.* ** :*****:**.*:* :**

A0A1S3LY44_BCL2-01      PDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICV
A0A1S3R1W1_BCL2-01      PDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICV
A0A1S3NIV8_BCL2-01      RDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCV
A0A1S3Q9V5_BCL2-01      RDFAEMSGQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVAFFEFGGTMCV
                         ****** **::*.* *:***  **:*** ********:********:**

A0A1S3LY44_BCL2-01      ECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENGGWEAFVELYDRQRDSV
A0A1S3R1W1_BCL2-01      ECVNKEMTSQVDHIAVWMTEYLNGPLLSWIQENGGWEAFVELYDRQRDSV
A0A1S3NIV8_BCL2-01      ESVNREMTSQVDNIARWMMEYLNGPLQNWIQENGGWDAFVEIYEQQRIS-
A0A1S3Q9V5_BCL2-01      ESVNREMTTQVDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISV
                        *.**.***:***:** ** ******* .******.*:****:* .** * 

A0A1S3LY44_BCL2-01      FCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A1S3R1W1_BCL2-01      FCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A1S3NIV8_BCL2-01      -HSWPYLKTVFGLAALGAAGVTIGALFTQK
A0A1S3Q9V5_BCL2-01      FHSWPYLKTVFGLAALGAAGVTIGALFIQK
                          *** :************.:**** : **

© 1998-2020Legal notice