Dataset for protein Bcl-2 of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A1S3LY44_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=226 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEDEEDADNNGSMISPPPGLARRCHGANNARPGSVPHLSKRLSQTDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHI
AGWMTEYLNGPLHSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A1S3NIV8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=228 residues).
MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDPPYQNRSPQPDP
HARLHRVLRDAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMMEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|A0A1S3Q9V5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNSPEVFARRSQPSAEGVDTDSPLPNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTTQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISVFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A1S3R1W1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRLGLARRCHGANNAGPSSVPSLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2020Legal notice