Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6RW35_BCL2L2-      -MATPASAPDTRALVADFLGYK----LRQKGY------------------
A0A2K6PPI3_MCL1-01      -----------------MFGFKRNAVIGLNLY------------------
A0A2K6PPI3_MCL1-02      -----------------MFGFKRNAVIGLNLY------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --MTDCEFGYIYRLAQDYLQYV----LQ----------------------
A0A2K6PHF2_BCL2A1-      --MTDCEFGYIYRLAQDYLQYV----LQ----------------------
A0A2K6RW35_BCL2L2-      -MATPASAPDTRALVADFLGYK----LRQKGY------------------
A0A2K6RW35_BCL2L2-      -MATPASAPDTRALVADFLGYK----LRQKGY------------------
A0A2K6RW35_BCL2L2-      --------MEEEAEKLKELQNE----VEKQMN------------------
A0A2K6PPI3_MCL1-03      ----------------------------MFGFKRNAVIGLNLYCGGAGLG
A0A2K6QFA2_BCL2L1-      ------MSQSNRELVVDFLSYK----LSQKGYSWSQFSDVEENRTEAPEG
A0A2K6QFA2_BCL2L1-      ------MSQSNRELVVDFLSYK----LSQKGYSWSQFSDVEENRTEAPEG
A0A2K6R5T5_BCL2L10      MADPLRERTER--LLADYL-------------------------------
A0A2K6R2I5_BCL2-02      MAHAGRTGYDNREIVMKYIHYK----LSQRGYEW--------DAGDVGAA
A0A2K6R2I5_BCL2-01      MAHAGRTGYDNREIVMKYIHYK----LSQRGYEW--------DAGDVGAA
                                                                          

A0A2K6RW35_BCL2L2-      ------------------------------------------VCGAGPGE
A0A2K6PPI3_MCL1-01      ------------------------------------------CGGAGLGA
A0A2K6PPI3_MCL1-02      ------------------------------------------CGGAGLGA
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      ------------------------------------------IPQPGSGP
A0A2K6PHF2_BCL2A1-      ------------------------------------------IPQPGSGP
A0A2K6RW35_BCL2L2-      ------------------------------------------VCGAGPGE
A0A2K6RW35_BCL2L2-      ------------------------------------------VCGAGPGE
A0A2K6RW35_BCL2L2-      ------------------------------------------MSPPPGNA
A0A2K6PPI3_MCL1-03      AGSGGATP------PGGRLLATGAKDTKPMGRSGATSRKALET-------
A0A2K6QFA2_BCL2L1-      TESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQA-
A0A2K6QFA2_BCL2L1-      TESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQA-
A0A2K6R5T5_BCL2L10      --------GCCAREPG-----------------TPEPRPSTPEAAV----
A0A2K6R2I5_BCL2-02      TPGAAPAPGIFSSQPGH--TPHPAASRDPVARTSPLPTPAAPAAAAGPAL
A0A2K6R2I5_BCL2-01      TPGAAPAPGIFSSQPGH--TPHPAASRDPVARTSPLPTPAAPAAAAGPAL
                                                                          

A0A2K6RW35_BCL2L2-      GP-AADPLHQAMRAAGDEF---ETRFRRTFSDL----AAQLHVTPGSAQQ
A0A2K6PPI3_MCL1-01      GSGGATPPGGRLLATEKEA---SARREIGGGEA----GTVIGESAGASPP
A0A2K6PPI3_MCL1-02      GSGGATPPGGRLLATEKEA---SARREIGGGEA----GTVIGESAGASPP
A0A2K6QFA2_BCL2L1-      ------MWKRTGLRPQKGL---NRRWRPPVPSM--------ATHPGTAYQ
A0A2K6PHF2_BCL2A1-      SK-TSRVLQKVAFSVQKEV---EKNLKPCLDNV----NVASI---DTART
A0A2K6PHF2_BCL2A1-      SK-TSRVLQKVAFSVQKEV---EKNLKPCLDNV----NVASI---DTART
A0A2K6RW35_BCL2L2-      GP-AADPLHQAMRAAGDEF---ETRFRRTFSDL----AAQLHVTPGSAQQ
A0A2K6RW35_BCL2L2-      GP-AADPLHQAMRAAGDEF---ETRFRRTFSDL----AAQLHVTPGSAQQ
A0A2K6RW35_BCL2L2-      GP-VIMSIEEKMEADARSIYVGNVDYGATAEEL----EAHFH---GCGSV
A0A2K6PPI3_MCL1-03      -----------LRRVGDGV---QRNHETAFQGM----LRKLDIKNEDDVK
A0A2K6QFA2_BCL2L1-      -----------LREAGDEF---ELRYRRAFSDL----TSQLHITPGTAYQ
A0A2K6QFA2_BCL2L1-      -----------LREAGDEF---ELRYRRAFSDL----TSQLHITPGTAYQ
A0A2K6R5T5_BCL2L10      -----------LRSAAARL---RQLHRSFFSAYLGYPGNRVELVALMAEA
A0A2K6R2I5_BCL2-02      SP-VPPVVHLTLRQAGDDF---SRRYRRDFAEM----SSQLHLTPFTARG
A0A2K6R2I5_BCL2-01      SP-VPPVVHLTLRQAGDDF---SRRYRRDFAEM----SSQLHLTPFTARG
                                                                          

A0A2K6RW35_BCL2L2-      RFTQVSDELFQGGP-NWGRLVAFFVFGAALC------------------A
A0A2K6PPI3_MCL1-01      ---------------------------AALT------------------P
A0A2K6PPI3_MCL1-02      ---------------------------AALT------------------P
A0A2K6QFA2_BCL2L1-      SFEQVVNELFRDGV-NWGRIVAFFSFGGALC------------------V
A0A2K6PHF2_BCL2A1-      LFNQVMEKEFEDGIINWGRIVTIFAFEGILI------------------K
A0A2K6PHF2_BCL2A1-      LFNQVMEKEFEDGIINWGRIVTIFAFEGILI------------------K
A0A2K6RW35_BCL2L2-      RFTQVSDELFQGG-PNWGRLVAFFVFGAALC------------------A
A0A2K6RW35_BCL2L2-      RFTQVSDELFQGG-PNWGRLVAFFVFGAALC------------------A
A0A2K6RW35_BCL2L2-      NRVTILCDKFSGH-P---KGFAYIEFSDKES------------------V
A0A2K6PPI3_MCL1-03      SLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKH----------------L
A0A2K6QFA2_BCL2L1-      SFEQVVNELFRDGV-NWGRIVAFFSFGGALC------------------V
A0A2K6QFA2_BCL2L1-      SFEQVVNELFRDGV-NWGRIVAFFSFGGALC------------------V
A0A2K6R5T5_BCL2L10      VLSD------SPGP-TWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRL
A0A2K6R2I5_BCL2-02      RFATVVEELFRDGV-NWGRIVAFFEFGGVMC------------------V
A0A2K6R2I5_BCL2-01      RFATVVEELFRDGV-NWGRIVAFFEFGGVMC------------------V
                                                                          

A0A2K6RW35_BCL2L2-      ESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVRE
A0A2K6PPI3_MCL1-01      DARRVARPP---PIG-----------AEVPDVTGTPARLLFFAPTRRAAP
A0A2K6PPI3_MCL1-02      DARRVARPP---PIG-----------AEVPDVTGTPARLLFFAPTRRAAP
A0A2K6QFA2_BCL2L1-      ESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNA
A0A2K6PHF2_BCL2A1-      KLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK---------
A0A2K6PHF2_BCL2A1-      KLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFV------
A0A2K6RW35_BCL2L2-      ESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGA
A0A2K6RW35_BCL2L2-      ESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGA
A0A2K6RW35_BCL2L2-      RTSLALDES---LFRGRQIKVIPKRTNRPG------------ISTTDRGF
A0A2K6PPI3_MCL1-03      KTINQESC-----IEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVED
A0A2K6QFA2_BCL2L1-      ESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNA
A0A2K6QFA2_BCL2L1-      ESVDKEMQV---LVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNA
A0A2K6R5T5_BCL2L10      KEQEGEVAR---DCQRLVALLSSRLTGQHRAWLQAQGGWVSTRRTPGRGA
A0A2K6R2I5_BCL2-02      ESVNREMSP---LVDNIALWMTEYLNRHLHTWIQDNGGWRTMC-------
A0A2K6R2I5_BCL2-01      ESVNREMSP---LVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYG---
                                                                          

A0A2K6RW35_BCL2L2-      MEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVG
A0A2K6PPI3_MCL1-01      LEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTD
A0A2K6PPI3_MCL1-02      LEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTD
A0A2K6QFA2_BCL2L1-      AAESRKGQERFN--------------------------------------
A0A2K6PHF2_BCL2A1-      -----------W--------------------------------------
A0A2K6PHF2_BCL2A1-      ---KKFEPKSGW--------------------------------------
A0A2K6RW35_BCL2L2-      LEEARRLREGNW--------------------------------------
A0A2K6RW35_BCL2L2-      LEEARRLREGNW--------------------------------------
A0A2K6RW35_BCL2L2-      PRARYRARTTNY--------------------------------------
A0A2K6PPI3_MCL1-03      LEG-----------------------------------------------
A0A2K6QFA2_BCL2L1-      AAESRKGQERFN--------------------------------------
A0A2K6QFA2_BCL2L1-      AAESRKGQERFN--------------------------------------
A0A2K6R5T5_BCL2L10      GRASGKRPRGRH--------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2K6R2I5_BCL2-01      ---PSMRPLFDF--------------------------------------
                                                                          

A0A2K6RW35_BCL2L2-      NV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKES
A0A2K6PPI3_MCL1-01      GSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATGAKDTKPMGRSG
A0A2K6PPI3_MCL1-02      GSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATGAKDTKPMGRSG
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
                                                                          

A0A2K6RW35_BCL2L2-      VRTSLALD-------------ESLFRGRQIKV------------------
A0A2K6PPI3_MCL1-01      ATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHV
A0A2K6PPI3_MCL1-02      ATSRKALETLRRVGDGVQRNHETAFQGWVCGV-----------------L
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
                                                                          

A0A2K6RW35_BCL2L2-      --------------------IPKRTNRPGISTTDRGFPRARYRARTTNYN
A0A2K6PPI3_MCL1-01      FSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESIT---DVLVR
A0A2K6PPI3_MCL1-02      PCRGPRRW---------------------HQKCAAGFCRCCW---S----
A0A2K6QFA2_BCL2L1-      ---------------------------------------------RWF--
A0A2K6PHF2_BCL2A1-      ---------------------------------------------HNHMP
A0A2K6PHF2_BCL2A1-      ---------------------------------------------MTFLE
A0A2K6RW35_BCL2L2-      ---------------------------------------------ASVRT
A0A2K6RW35_BCL2L2-      ---------------------------------------------ASVRT
A0A2K6RW35_BCL2L2-      ---------------------------------------------NSSRS
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      ---------------------------------------------RWF--
A0A2K6QFA2_BCL2L1-      ---------------------------------------------RWF--
A0A2K6R5T5_BCL2L10      ---------------------------------------------GWLLS
A0A2K6R2I5_BCL2-02      ---------------------------------------------TWC--
A0A2K6R2I5_BCL2-01      ---------------------------------------------SWL--
                                                                          

A0A2K6RW35_BCL2L2-      SSRSRF----------------------------YSGFNSRPRGRVYRSG
A0A2K6PPI3_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K6PPI3_MCL1-02      --RSWF---------------------------------GISNKIALL--
A0A2K6QFA2_BCL2L1-      -------------------------------LTGMTVAGVVLLGSLFSRK
A0A2K6PHF2_BCL2A1-      M---LVE-------------------SVAHKKKKMAL-------------
A0A2K6PHF2_BCL2A1-      VTGKICE-------------------MLSLLKQYC---------------
A0A2K6RW35_BCL2L2-      V---LTG-------------------AV-------ALGALVTVGAFFASK
A0A2K6RW35_BCL2L2-      V---LTG-------------------AV-------ALGALVTVGAFFASK
A0A2K6RW35_BCL2L2-      R---FYS-------------------GFNSRPRGRVYRGRARATSWYSPY
A0A2K6PPI3_MCL1-03      --------------------------GIRNVLLAFAGVAGVGAGLAYLIR
A0A2K6QFA2_BCL2L1-      -------------------------------LTGMTVAGVVLLGSLFSRK
A0A2K6QFA2_BCL2L1-      -------------------------------LTGMTVAGVVLLGSLFSRK
A0A2K6R5T5_BCL2L10      LLQDPLSAGFLEKTADPGFPGMLVNNSLRLPLDTIIMSFKIFNPLLPAQL
A0A2K6R2I5_BCL2-02      --------------------------RFR------------------GCD
A0A2K6R2I5_BCL2-01      --------------------------SLKTLLSLALVGACITLGAYLGHK
                                                                          

© 1998-2022Legal notice