Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------d-r-lv-dyl-y---q-gy----------------------------------------------------
mmatpreap-n-e--a-f-g-kls-k--kwnaviglnlycggaglgtgsggatppggrllatekeasarreigggeagtv
 amagassyytyaiavk-isq  rmf fsrsqfsdveenrtevpeaapgempa                           
  hpdctgqsikr qqeveq     r  e         da d  a  e aae                            
  dmlemfgkr   lm   h                                                            
    e  rtel    n   k                                                            
        e                                                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------pg------p---------------------------------------------------------------
iggvcgag--egltpd-rrvarpppigaevpdvtgtparllffaptrraapleemeapaadaimspeeeldgyepeplgk
  ssisss swhpaasa                                                               
  eifngq pha vdhg                                                               
   aaarn  ar l t                                                                
   c   e  g                                                                     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------akqt-p-g------r-alp-----
rpavlpllelvgesgnssstdgslpstpppaeeeedelyrqsleiisrylreqatglhdap-p-rsspts-p---taavs
                                                        ----ktmhstgalptkviekveak
                                                        vvsrdqvangpsktsrsaqmm fg
                                                        mlnia g  atldameit a   d
                                                         amg        vi s e e    
                                                         n s        e           
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .   :              
-------------lrragdeferryrrafsdl-----sqlhitpgtarqsftqvveelfrdGv-nWgrivaffs------
valspvppvvhltm-av-kgvqtnhettlqgmlgypa--v-vsnfsdytrlst-snhv-sgapitf--l-tlivslalde
qqsiy gn d  m-k--alrlsklfkpc-dnv    vaknvlkied-qkl-erfmd-epqr itr sd-esi-t      
pr           ygqt edprlhlnsdwae-    trs-da--d-vvg-cn- --k-kep yre   v --ve      
a            w e  a   qg hgr --y    sprme-vv-r --v ak  v p gf       k  vra      
               s      a    f rpw    lng athanm ti  -d  g   c             -      
                              ap    gc   g  l  ea  d                            
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--Fggalc------------------vesvnkemqplvsr--------------------iaewmaeylnrhlrdWiqsn
sl-eavvikreplvtawwkkrsfqprkklldrqievdidttdrgfpraryrarttnyykevsafvttfietrtgpvlres
   --imaeh                a---rq-va-ccgq                 nsslqysivav-vdtket yhqq
   r f--                  lvtq--tsss-aep                    rvrlyss-nmnn-ae fvk-
   a -ql                  -hiptinqrrg qn                    fclclwdr ---rhs  -dr
     t                      ekkg nck  ag                        c g  tgqh r   - 
     r                       ie  h                                   s p  a   g 
                                                                              a 

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ggwd--fvelyg----ee-----e----w----------------------------------l-g----g-v-------
r--elt------nnal--srklq-rfnr-ftsmpmtppsgnwlsvtmspgfpmmlvnnslrtv-t-mvva-v-llvleah
-raa ettaffhvgdaagavrgrrprsgvlsqlnvsglpvesapliadieekgea   giknpylaatgvagivte    
a  - gmrrtrvremgsapsmrpllqht ynpylqd klcgmvek             rf sl vtfaalfalgn     
   v saikap d  er fg kk gkfs mlh e    ia fgah             da li slnlmy ktta     
   t a c        n  e  f fd e hkf         a                      d iids c se     
   r            k            e                                       g   f      
   g                         c                                           a      

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
fhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrartt
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       570       580     
....:....|....:....|....:
                         
------------------gslfs-k
nynssrsrfysgfnsrpr-layls-
                  ka--arr
                  p-flgil
                  lkyp-qg
                   rvkrhd
                   iq mc 
                    k ca 
© 1998-2021Legal notice