Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------d-r-lv-dylgyk----lsqkgy------------------------------------------------
mmatprsap-n-e--a-f----rnav------swsqfsdveenrgeagegtpsemptpgiissqpgwhlvpspavsrdpv
 amagaesyytyaiavk-iqfv    irlrlnernaviglnldatdvpaaaegaaea safngn shr tdhg angatg
  hpdctgqsierelq mfsne    vqmnmfk         yc g  l  g gga   ccare  g  lat  kdtk m
  d l mfger   km e h       gkq                                                  
       rt e    l           e f                                                  
        m                                                                       
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------vagagpg-gp----plh--lraagdef---erryrrtfsel----gsqlh-tpgtarqrftqvveelf
hrssplprpaipmcav--ae--gvad---qtmlsvqkgvyvgstnfepalgdmlgypaavsiv--fssyts-et------
asttldatevaei--pks-ass astvvqlaafrterdl   nllrkiggdnv    tvaiglsadagqp-l--isnke 
g  gats kst cpq-pqnp k tprspgkvgeqpaasa   rkdlgtdvasa    st--eivnlmdpglrsr mdhv 
     e    l agp  l l   gipmwkgr  ed  ri   qa h scaqgy    n-rvdek ed vvv nd lvdk 
            -s   g       m ierk            v w ap pa     -rkfath  c skn a   c   
            t                e             q    f e      lnh        ea  v       
            e                                            e                      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rdgv-nwgrivaffsfggalc------------------vesvnkemep---lvgriaewmaeylnthlgdwiqsnggwd
sg--p----l-t--v--avmtkreplvtawwkkrsfqpraktrrqqrqvdvdtisqvqa-vvt--errvepvthesarll
q-hpit  k-f-lie edivieh                pdlldvaia-   pyk----f-tafi-nntat-lrtq---e
-p it    v siv- s tes                  lraslrlvss   -fdnlsysl--vrtdepre -gqpr  a
e        g  y a a k l                  k eqeg spr   dcrervllissr matkp-  -d-   -
              t   f a                     i a dc      qp  ik ipk vgqhha  v-    v
                                                      eg      d           k    r
                                                                          a    g
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tfvelyg--alee-rk--e--w----------------------------------------------------------
f-a-t--ng----s--gr-rnnmspeeeldgyepeplgkrpavlpllelvgesgnssstdgslpstpppaeeeedelyrc
ettp-rrvnpaaamerrqlgf-qnev kqmnms p gnag vimsie kmeadar iyvgnv  dygat   l ahfhg 
-m-akthrafprgayappadai                                                          
sgrvfpddrem  rsmlattry                                                          
neis f aedg  pkfekrsgl                                                          
l fr a       kg a kkeh                                                          
k ci               fdf                                                          
g                                                                               
a                                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gsvqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgwvrkvdikneddvkslsrvmvhv
   nrvt lcdkfsghpk fayiefsdkesvrtsl  d              sl r rqigl                 l
                                                         mlc                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------rwf--------------------------------
psrgvtrwgrivtlisfgafvpkrtntpnqstcirgfprsryrartslrtvtrsltskqrlwktfvpgfpvmlvnnsvrn
fcd prn             ia hlkrigiqstdeplceciw   s--lstsqdwlgagfgedgadef hgedlegglsl
                             hek aa  a act   atvyrslgkrfe                   aint
                                             -vsvprk  pyv                   rfks
                                             nnnmnm   iv                    m ah
                                             m h el   fc                        
                                             h c                                
                                             g                                  
                                             d                                  

       490       500
....:....|....:....|
                    
-l---av-a-v-lgslfs-k
v-tgm--g-v-t----yls-
lklaftlaggilatla-arr
rpsyyvgvnlrgvpafl-iy
p rtrsysfsasnkrypgql
k qlilmr r rr iw rpg
  kkci f k p   v  hd
  d a    c f      c 
                    
                    
© 1998-2022Legal notice