Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------fgydnralvadylgykl-q-gy--------------------------------------------------vc
mmatprsapst--vivlfi----s-k--swsqgsvgagtrgaappggrsssepgstpnpnpswhpvartapngtpahp-a
 atdgatsqkrneiaqkn-ycv r r  e ggfglveesptet eptillmttphaihgaarrdltdsrsvlpatgass-
  hacmm-fiy  --m-- s   q      daadd  ang    a  efeaqgakdtk mgmskasslptqetresttis
  dple-r---   lg   q                           ccar          ekgr g kplk g  g ap
      e te     -   h                                           e     eig      ei
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               .                     :                          
gagpg-sp-a-vlh--lrsagdeferryrrtfsdl----asqlhvtpgtarqrfeqv-----------veelfrdGv-nW
a----e--a-d--qqamfavqkdvstnfkpavpnmtgyp-a-nvlsifsrytsltt-eapaadaimspsnke-qgepitl
-pasevgkvsapv-lva-q----l-lplgtdldevl t t-r--i-ndrdqgl srm           md--dsy itp 
qdsrapi tprlkpkt- e rpr-rklhesc asy    srlvfavatm vav ne            --hv ep  e  
lv a l  m p t a r - aap q- w ap qg     ltk e-k ld ekp ad            ev   g      
 e   a  p     d   v   g nq i  f  a     gnh dfa e  a                             
                  r           e                                                 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*.  :.. :   :                         :              :   :            :  . .    
GRiVaffsFggalc------------------vesvnkemqplvd---riaewmaeylnthl-----edWiqsnGGWd--
 klptlvvleavviesgpsvttwwslrstqpraklldqqievdystykqvqafvvtfierrttgakdapplhesraterg
  sile leimlkrenlssadgkkp f   lptqrr va--ig   nlsysitav mdqk     rt mrqq   an 
   via a t g h                k pieg ssr cr   esvlllssr vnnh     he  vd    vl 
       t   l a                  p ea e ede  q   p l i  r  tgta     gk  gr    sk 
       p   f                            c   e          d  re       ta   k    r  
                                                                        a    g  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------tfvelyg-na--esrklqe----w--------------------------------------ltg---
fvkkfepksgwmeatat--rg-ee-a--g--rfnr-flsvlqdrlsrrwsqktgnwgsvimwvrsslrtslrtv---mvv
           hstl--tvn-vaav-sr-rymrqgvlcgl pcpkqmnmlpppadpaprgcssnnwfelpnssiyvsati
            nmrrvrrdemlslqlnrptlqlt v       gpagfhe c agffpc lieermkiliknailafka
            khmpmphvvggraphmkkrgdhs e                  a c       k gggadl  m ncg
            g ikfl klcdm  glhelfafe c                            d  ad  i     ad
            a c af  i  g  e   kc                                                
                               a                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-g------------------------------------------------------------------------------
a-vvllvleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrg
lnalvte                                                                         
ylgtyp                                                                          
vapage                                                                          
t   aa                                                                          
f                                                                               
                                                                                

       410       420       430      
....:....|....:....|....:....|....:.
                                    
-----------------------------g-l----
fpraryrarttnynssrsrfysgfnsrpr-s-fssk
                             aafyarr
                              rv rig
                              qk l  
                              ld    
                              ha    
                              c     
© 1998-2020Legal notice