Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KHG1_BCL2-01      MAHAGRTGYDNREIVMKYIHYK----LSQRGYEWDAGDVGAATPGAAPAP
A0A2K6ME72_BCL2L2-      -MATPASAPDTRALVADFVGYK----LRQKGYVCGAG-PGEGP-AADPLH
A0A2K6KRW9_MCL1-02      -----------------MFGFKRNAVIGLNLYCGGAG-LGAGSGGATPPG
A0A2K6KRW9_MCL1-01      -----------------MFGFKRNAVIGLNLYCGGAG-LGAGSGGATPPG
A0A2K6LV19_BCL2A1-      --------------------------MTDCEFGYIYR-LAQDYLQYVLQ-
A0A2K6LV19_BCL2A1-      --------------------------MTDCEFGYIYR-LAQDYLQYVLQ-
A0A2K6ME72_BCL2L2-      ----------------MATPASAPDTRA----------LVADFVGYKLRQ
A0A2K6KRW9_MCL1-03      -----------------MFGFKRNAVIGLNLYCGGAG-LGAGSGGATPPG
A0A2K6M5H5_BCL2L10      ----------------MADPLRERTTVADPLRERTER-LLADYLGCCAR-
                                                                          

A0A2K6KHG1_BCL2-01      GIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLT
A0A2K6ME72_BCL2L2-      Q------------------------------------------------A
A0A2K6KRW9_MCL1-02      G------------------------------------------------R
A0A2K6KRW9_MCL1-01      G------------------------------------------------R
A0A2K6LV19_BCL2A1-      -----IPQPGSGPSKTSRVLQKVAFS-----------------------V
A0A2K6LV19_BCL2A1-      -----IPQPGSGPSKTSRVLQKVAFS-----------------------V
A0A2K6ME72_BCL2L2-      KGYVCGAGPGEGPAAD------PLHQ-----------------------A
A0A2K6KRW9_MCL1-03      GRLLATGAKDTKPMGRSGATSRKALE-----------------------T
A0A2K6M5H5_BCL2L10      ----EPGTPEPRPSTPEAAVLRSAAA-----------------------R
                                                                          

A0A2K6KHG1_BCL2-01      LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG--VNW
A0A2K6ME72_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNW
A0A2K6KRW9_MCL1-02      LLATEKEASARREIGGGEAGTVIGESAGASPP------------------
A0A2K6KRW9_MCL1-01      LLATEKEASARREIGGGEAGTVIGESAGASPP------------------
A0A2K6LV19_BCL2A1-      QKEVEKNLKPCLDNVNVAS-------IDTARTLFNQVMEKEFEDGI-INW
A0A2K6LV19_BCL2A1-      QKEVEKNLKPCLDNVNVAS-------IDTARTLFNQVMEKEFEDGI-INW
A0A2K6ME72_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNW
A0A2K6KRW9_MCL1-03      LRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNW
A0A2K6M5H5_BCL2L10      LRQ----LHRSFFSAYLGY-------PGNRVELVALMAEAVLSDSPGPTW
                                                                          

A0A2K6KHG1_BCL2-01      GRIVAFFEFGGVMCVES-------VNREMSPLVDN-----------IALW
A0A2K6ME72_BCL2L2-      GRLVAFFVFGAALCAES-------VNKEMEPLVGQ-----------VQEW
A0A2K6KRW9_MCL1-02      ----------AALTPDA-------RRVARPPPIG----------------
A0A2K6KRW9_MCL1-01      ----------AALTPDA-------RRVARPPPIG----------------
A0A2K6LV19_BCL2A1-      GRIVTIFAFEGILIKKL-------LRQQIAPDVDTYKE--------ISYF
A0A2K6LV19_BCL2A1-      GRIVTIFAFEGILIKKL-------LRQQIAPDVDTYKE--------ISYF
A0A2K6ME72_BCL2L2-      GRLVAFFVFGAALCAES-------VNKEMEPLVGQ-----------VQEW
A0A2K6KRW9_MCL1-03      GRIVTLISFGAFVAKHLKTIN---QESCIEP---------------LAES
A0A2K6M5H5_BCL2L10      GRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVAL
                                  . :                 *                   

A0A2K6KHG1_BCL2-01      MTEYLNRHLHTWIQDNGGWDA-FVELY-----------------------
A0A2K6ME72_BCL2L2-      MVAYLETRLADWIHSSGGWEL-EAIKARVREMEE-EAEKLKELQNEVEKQ
A0A2K6KRW9_MCL1-02      ------AEVPDVTGTPARLLF-FAPTRRAAPLEEMEAPAADAIMSPEEEL
A0A2K6KRW9_MCL1-01      ------AEVPDVTGTPARLLF-FAPTRRAAPLEEMEAPAADAIMSPEEEL
A0A2K6LV19_BCL2A1-      VAEFIMNNTGEWIRQNGGWGK-----------------------------
A0A2K6LV19_BCL2A1-      VAEFIMNNTGEWIRQNGGWENGFVKKFEPK--------------------
A0A2K6ME72_BCL2L2-      MVAYLETRLADWIHSSGGWAE-FTALYGDGALEE----------------
A0A2K6KRW9_MCL1-03      ITDVLVRTKRDWLVKQRGWDG-FVEFFHVEDLE-----------------
A0A2K6M5H5_BCL2L10      LSSRLTGQHRAWLQAQGGWDG-FCHFFRTPFPL-----------------
                                                                          

A0A2K6KHG1_BCL2-01      ----------GPSMRPLFDF------------------------------
A0A2K6ME72_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELEAHFHG
A0A2K6KRW9_MCL1-02      DGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSLPSTPPPAEEEEDELYR
A0A2K6KRW9_MCL1-01      DGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSLPSTPPPAEEEEDELYR
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6KHG1_BCL2-01      ---------------------------------SWLSLKTLLSLALVGAC
A0A2K6ME72_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD-----------
A0A2K6KRW9_MCL1-02      ----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQR
A0A2K6KRW9_MCL1-01      ----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQR
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6KHG1_BCL2-01      ITLGAYLGHK----------------------------------------
A0A2K6ME72_BCL2L2-      --ESLFRGRQIKV-------------------------------------
A0A2K6KRW9_MCL1-02      NHETAFQGWVCGV-----------------LPCRGPRRW-----------
A0A2K6KRW9_MCL1-01      NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6ME72_BCL2L2-      -IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF-------------
A0A2K6KRW9_MCL1-02      ----------HQKCAAGFCRCCW---S------RSWF-------------
A0A2K6KRW9_MCL1-01      FVAKHLKTINQESCIEPLAESIT---DVLVRTKRDWLVKQRGWDGFVEFF
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      -----------------------------------------------ARR
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6KHG1_BCL2-01      ----------------------------------
A0A2K6ME72_BCL2L2-      ---------------YSGFNSRPRGRVYRSG---
A0A2K6KRW9_MCL1-02      --------------------GISNKIALL-----
A0A2K6KRW9_MCL1-01      HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR---
A0A2K6LV19_BCL2A1-      --------WHNHMPM---LVESVAHRKKKMAL--
A0A2K6LV19_BCL2A1-      ------SGWMTFLEVTGKICEMLSLLKQYC----
A0A2K6ME72_BCL2L2-      LREGNWASVRTVLTGAVALGALVTVGAFFASK--
A0A2K6KRW9_MCL1-03      ------GGIRNVLLAFAGVAGVGAGLAYLIR---
A0A2K6M5H5_BCL2L10      ------AFWRKLLIQAFLACLLTTAFGYLWTRLL
                                                          

© 1998-2021Legal notice