Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K6KRW9_MCL1-02      MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      GEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFA
A0A2K6KRW9_MCL1-02      GEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFA
A0A2K6M5H5_BCL2L10      ---------------------------------------MADPLR----E
A0A2K6ME72_BCL2L2-      ---------------------------------------MATPAS----A
A0A2K6ME72_BCL2L2-      ---------------------------------------MATPAS----A
                                                                          

A0A2K6LV19_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQI------------------------
A0A2K6LV19_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQI------------------------
A0A2K6KHG1_BCL2-01      -MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIF
A0A2K6KRW9_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K6KRW9_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K6M5H5_BCL2L10      RTTVADPLRERTERLLADYLG-----------------------------
A0A2K6ME72_BCL2L2-      PDTRA---------LVADFVGYKLRQKGY---------------------
A0A2K6ME72_BCL2L2-      PDTRA---------LVADFVGYKLRQKGY---------------------
                            :              :                              

A0A2K6LV19_BCL2A1-      -----------------------------------------------PQP
A0A2K6LV19_BCL2A1-      -----------------------------------------------PQP
A0A2K6KHG1_BCL2-01      SSQPGHTPHPAASRDPVARTSPL-------------------PTPAAPAA
A0A2K6KRW9_MCL1-01      GNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K6KRW9_MCL1-02      GNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K6M5H5_BCL2L10      ------------------------------------------CCAREPGT
A0A2K6ME72_BCL2L2-      ------------------------------------------VCGAGPG-
A0A2K6ME72_BCL2L2-      ------------------------------------------VCGAGPG-
                                                                       *  

A0A2K6LV19_BCL2A1-      GSGPSKTS------RVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTL
A0A2K6LV19_BCL2A1-      GSGPSKTS------RVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTL
A0A2K6KHG1_BCL2-01      AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGR
A0A2K6KRW9_MCL1-01      RSGATSRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKS
A0A2K6KRW9_MCL1-02      RSGATSRK----ALETLRRVGDGVQRNHETAFQGWVCGV-----------
A0A2K6M5H5_BCL2L10      PEPRPSTP----EAAVLRSAAARLRQLHRSFFSAYLG----YP-GNRVEL
A0A2K6ME72_BCL2L2-      -EGPAADP----LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQR
A0A2K6ME72_BCL2L2-      -EGPAADP----LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQR
                            .          .:. ..  .       :                  

A0A2K6LV19_BCL2A1-      FNQVMEKEFED--GIINWGRIVTIFAFEGIL--------------IKKLL
A0A2K6LV19_BCL2A1-      FNQVMEKEFED--GIINWGRIVTIFAFEGIL--------------IKKLL
A0A2K6KHG1_BCL2-01      FATVVEELFRD--GV-NWGRIVAFFEFGGVM--------------CVESV
A0A2K6KRW9_MCL1-01      LSRVMVHVFSD--GVTNWGRIVTLISFGAFV--------------AKHLK
A0A2K6KRW9_MCL1-02      -------LPCR--GPRRW--------------------------------
A0A2K6M5H5_BCL2L10      VALMAEAVLSDSPGP-TWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPR
A0A2K6ME72_BCL2L2-      FTQVSDELFQG--GP-NWGRLVAFFVFGAAL--------------CAESV
A0A2K6ME72_BCL2L2-      FTQVSDELFQG--GP-NWGRLVAFFVFGAAL--------------CAESV
                                     *   *                                

A0A2K6LV19_BCL2A1-      RQQIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWG---------
A0A2K6LV19_BCL2A1-      RQQIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWE---------
A0A2K6KHG1_BCL2-01      NREMSPLVD---NIALWMTEYLNRHLHT----WIQDNGGWD---------
A0A2K6KRW9_MCL1-01      TINQESCIE---PLAESITDVLVRTKRD----WLVKQRGWD---------
A0A2K6KRW9_MCL1-02      ---HQKCAA---GFCRCCWS------RS----WF----------------
A0A2K6M5H5_BCL2L10      LKEQEGDVA---RDCQRLVALLSSRLTGQHRAWLQAQGGWD---------
A0A2K6ME72_BCL2L2-      NKEMEPLVG---QVQEWMVAYLETRLAD----WIHSSGGWA-EFTALYGD
A0A2K6ME72_BCL2L2-      NKEMEPLVG---QVQEWMVAYLETRLAD----WIHSSGGWELEAIKARVR
                                                        *:                

A0A2K6LV19_BCL2A1-      ----------------------------K-----------WHNHMPM---
A0A2K6LV19_BCL2A1-      ----------------------------NGFVKKFEPKSGWMTFLEVTGK
A0A2K6KHG1_BCL2-01      -----------------------AFVELYGPSMRPLFDFSWLSLKTL---
A0A2K6KRW9_MCL1-01      -----------------------------GFVEFFHVEDLEGGIRNV---
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6M5H5_BCL2L10      -----------------------------GFCHFFRTPFPLAFWRKL---
A0A2K6ME72_BCL2L2-      GALEEARRLRE---------------GNWASV------------RTV---
A0A2K6ME72_BCL2L2-      EMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSI---
                                                                          

A0A2K6LV19_BCL2A1-      LVESVAHRKKKMAL------------------------------------
A0A2K6LV19_BCL2A1-      ICEMLSLLKQYC--------------------------------------
A0A2K6KHG1_BCL2-01      LSLALVGACITL--------------------------------------
A0A2K6KRW9_MCL1-01      LLAFAGVAGVGAGL------------------------------------
A0A2K6KRW9_MCL1-02      --------GISNKI------------------------------------
A0A2K6M5H5_BCL2L10      LIQAFLACLLTTAF------------------------------------
A0A2K6ME72_BCL2L2-      LTGAVALGALVTV-------------------------------------
A0A2K6ME72_BCL2L2-      YVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKE
                                                                          

A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      SVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYN
                                                                          

A0A2K6LV19_BCL2A1-      -----------------------
A0A2K6LV19_BCL2A1-      -----------------------
A0A2K6KHG1_BCL2-01      ---------------GAYLGHK-
A0A2K6KRW9_MCL1-01      ---------------AYLIR---
A0A2K6KRW9_MCL1-02      ---------------ALL-----
A0A2K6M5H5_BCL2L10      ---------------GYLWTRLL
A0A2K6ME72_BCL2L2-      ---------------GAFFASK-
A0A2K6ME72_BCL2L2-      SSRSRFYSGFNSRPRGRVYRSG-
                                               

© 1998-2020Legal notice