Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6LV19_BCL2A1-      ------------------MTDCEFGYIYRLAQDYLQYVL-----------
A0A2K6LV19_BCL2A1-      ------------------MTDCEFGYIYRLAQDYLQYVL-----------
A0A2K6KHG1_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAA-------
A0A2K6KRW9_MCL1-02      -----MFGFKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K6KRW9_MCL1-01      -----MFGFKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K6ME72_BCL2L2-      ----MATPASAPDT----RA---------LVADFVGYKLRQKGYV-----
A0A2K6ME72_BCL2L2-      ----MATPASAPDT----RA---------LVADFVGYKLRQKGYV-----
A0A2K6KRW9_MCL1-03      -----MFGFKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLL-----
A0A2K6M5H5_BCL2L10      ----MADPLRERTT----VADPLRERTERLLADYLGCCAR----------
                                                        .                 

A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------PAPGIFSSQPGH
A0A2K6KRW9_MCL1-02      ASARREIGGGEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTG
A0A2K6KRW9_MCL1-01      ASARREIGGGEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTG
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      TPHPAASRDPVARTSPLPTPAAPA--------------------------
A0A2K6KRW9_MCL1-02      TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K6KRW9_MCL1-01      TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6LV19_BCL2A1-      ------------------------------------------------QI
A0A2K6LV19_BCL2A1-      ------------------------------------------------QI
A0A2K6KHG1_BCL2-01      ------------------------------------------------AA
A0A2K6KRW9_MCL1-02      PLLELVGESGNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
A0A2K6KRW9_MCL1-01      PLLELVGESGNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
A0A2K6ME72_BCL2L2-      ------------------------------------------------CG
A0A2K6ME72_BCL2L2-      ------------------------------------------------CG
A0A2K6KRW9_MCL1-03      ------------------------------------------------AT
A0A2K6M5H5_BCL2L10      ------------------------------------------------EP
                                                                          

A0A2K6LV19_BCL2A1-      PQPGSGPS--------KTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASID
A0A2K6LV19_BCL2A1-      PQPGSGPS--------KTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASID
A0A2K6KHG1_BCL2-01      AGPALSPVPP------VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
A0A2K6KRW9_MCL1-02      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV------
A0A2K6KRW9_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
A0A2K6ME72_BCL2L2-      AGPGEGPAAD------PLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
A0A2K6ME72_BCL2L2-      AGPGEGPAAD------PLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
A0A2K6KRW9_MCL1-03      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
A0A2K6M5H5_BCL2L10      GTPEPRPSTPEAAVLRSAAARLRQ----LHRSFFSAYLGY-------P-G
                              *              :.     .                     

A0A2K6LV19_BCL2A1-      TARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKKL-------LRQQ
A0A2K6LV19_BCL2A1-      TARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKKL-------LRQQ
A0A2K6KHG1_BCL2-01      TARGRFATVVEELFRDG--VNWGRIVAFFEFGGVMCVES-------VNRE
A0A2K6KRW9_MCL1-02      ------------LPCRGP-RRW------------------------HQKC
A0A2K6KRW9_MCL1-01      DDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESC
A0A2K6ME72_BCL2L2-      SAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCAES-------VNKE
A0A2K6ME72_BCL2L2-      SAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCAES-------VNKE
A0A2K6KRW9_MCL1-03      DDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESC
A0A2K6M5H5_BCL2L10      NRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRS
                                        .    *                            

A0A2K6LV19_BCL2A1-      IAPDVDTYKE--------ISYFVAEFIMNNTGEWIRQNGGWE--------
A0A2K6LV19_BCL2A1-      IAPDVDTYKE--------ISYFVAEFIMNNTGEWIRQNGGWG--------
A0A2K6KHG1_BCL2-01      MSPLVDN-----------IALWMTEYLNRHLHTWIQDNGGWD--------
A0A2K6KRW9_MCL1-02      AAG---------------FCRCCWS------RSWF---------------
A0A2K6KRW9_MCL1-01      IEP---------------LAESITDVLVRTKRDWLVKQRGWD--------
A0A2K6ME72_BCL2L2-      MEPLVGQ-----------VQEWMVAYLETRLADWIHSSGGWA-EFTALYG
A0A2K6ME72_BCL2L2-      MEPLVGQ-----------VQEWMVAYLETRLADWIHSSGGWELEAIKARV
A0A2K6KRW9_MCL1-03      IEP---------------LAESITDVLVRTKRDWLVKQRGWD--------
A0A2K6M5H5_BCL2L10      FQPRLKEQEGDVARDCQRLVALLSSRLTGQHRAWLQAQGGWD--------
                                          .              *:               

A0A2K6LV19_BCL2A1-      -------------------------------------NGFVKKFEPKSGW
A0A2K6LV19_BCL2A1-      -------------------------------------K-----------W
A0A2K6KHG1_BCL2-01      ------------------------------AFVELYGPSMRPLFDFSWLS
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-01      ------------------------------GFVEFFHVE-----DLEGGI
A0A2K6ME72_BCL2L2-      DGALEEARRLRE---------------GNWASV-----------------
A0A2K6ME72_BCL2L2-      REMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEE-----KMEADA
A0A2K6KRW9_MCL1-03      ------------------------------GFVEFFHVE-----DLEGGI
A0A2K6M5H5_BCL2L10      ------------------------------GFCHFFRTP-----FPLAFW
                                                                          

A0A2K6LV19_BCL2A1-      MTFLEVTGKICEMLSLLKQYC-----------------------------
A0A2K6LV19_BCL2A1-      HNHMPM---LVESVAHRKKKMAL---------------------------
A0A2K6KHG1_BCL2-01      LKTLLSLALVGACITLGAYLGHK---------------------------
A0A2K6KRW9_MCL1-02      -----------GISNKIALL------------------------------
A0A2K6KRW9_MCL1-01      RNVLLAFAGVAGVGAGLAYLIR----------------------------
A0A2K6ME72_BCL2L2-      RTVLTGAVALGALVTV----------------------------------
A0A2K6ME72_BCL2L2-      RSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFS
A0A2K6KRW9_MCL1-03      RNVLLAFAGVAGVGAGLAYLIR----------------------------
A0A2K6M5H5_BCL2L10      RKLLIQAFLACLLTTAFGYLWTRLL-------------------------
                                                                          

A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6LV19_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K6ME72_BCL2L2-      --------------------------------------------------
A0A2K6ME72_BCL2L2-      DKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTT
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6LV19_BCL2A1-      -------------------------
A0A2K6LV19_BCL2A1-      -------------------------
A0A2K6KHG1_BCL2-01      -------------------------
A0A2K6KRW9_MCL1-02      -------------------------
A0A2K6KRW9_MCL1-01      -------------------------
A0A2K6ME72_BCL2L2-      ------------------GAFFASK
A0A2K6ME72_BCL2L2-      NYNSSRSRFYSGFNSRPRGRVYRSG
A0A2K6KRW9_MCL1-03      -------------------------
A0A2K6M5H5_BCL2L10      -------------------------
                                                 

© 1998-2020Legal notice