Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfgfkrnaviglnlycggaglgagsggatppggrllatekeasarreigggeagtvigesagasppaaltpdarrvarpp
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :              :                                        
-----------tpa-----apttradpl-e---rlaadylgyklrq-gy-------------------------------
pigaevpdvma---rllff----mt---f-yiy-avqaivspveqlk--epeplgkrpavlpllelvgesgnssstdgsl
         tgd ls    erdrv aceegmeapildkfmq-e-eid   wdagdvga tpgaapap ifssqpghtphp
                     mah grtryrtre  m  ih - --r                                 
                            g dne           s                                   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     *      .          .:. ..  .       :        
---------------------------------c-a-Pg--sgpastp-----hrvlrrvgdsvqrrhrrtfspmldqlh
pstpppaeeeedelyrqsleiisrylreqatgv-g-k qprepatkrsvppvl-qtmqkaafgfetnvetnlqglaanv-
aasrd vartspl                   akdtg mgga rsadk    alea  a  aelskef ka kdcvs--n
                                ptpre atp   pls     val   s   r rqly sf aeysrk d
                                c a a  aa           e a   q   d       d  aw gg  
                                                                            c   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       *   *                                                    
vtp-gtartrftqvmeelfsd--Gp-nWgrivtffvfggil--------------ckesvnkemeplvd---qisewmve
-asids-vql-n--sdkvpqgsp vit --l-al-a-eaa-lereplvtawwkkriakllrqqqasdigtykevqyfvta
l-- --rq--vatm---eler   itr   - -iv- ---v              --------iskcaa   rlcrslas
iyn fnd-ksl-r vvh  r     r    v s-it a vm              svqprtrnhqg  e   pfaqriwd
 k  ed  g  sl a a  c               s   t               afh kli          nd lcc  
        e                          e   f                                g       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            *:                                                                  
ylmtrlrd----Wirsnggwd--------------------------------------gfv--------w---rtv---
fierntgeqhra lqqs---eleftklyvrgmleearrlrelqnevekqmnmsppvgny---mffrvefs-atw--ltgk
---n--at     fh-qr  -  aiaargdeae   ek k             afpelwapskrsltpspemslms-   
v v-tkts      -k-   g                                     n scimpipkkmllnilpm   
l ssh hg      vd    a                                     k   hk hfddl hghkni   
  n            a                                          a   e  ee  g gff k    
                                                                        da e    

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lvgavalgkltt--------------------------------------------------------------------
--e-l--agiynaleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgi
yt-s-vy-avvmvi                                                                  
isqnfsvrltslkf                                                                  
 llmalhlcqkeg                                                                   
 iaf ggc kgce                                                                   
 c   da   aa                                                                    

       490       500       510       520   
....:....|....:....|....:....|....:....|...
                                           
-----------------------------------g-l-----
sttdrgfpraryrarttnynssrsrfysgfnsrpr-y-yrskl
                                   aaywtrl 
                                    rvlghg 
                                    lfia   
                                      f    
                                           
© 1998-2020Legal notice