Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------mfgfk----iglnlycggag-lgagylgatpp-g-------p---p----------a------
mmhtprtgydtrelvmm-----rnavmtdcgfgyiyrdvaqdsgqyvlrg-ryvsipq-gsg-sktsrvvqrv-fsptpa
 aaagasap n ai akavpyserttlaq-e-e---- pveat-ackaqqqilsetggktpr aasrgalsktspq    
                dythlrapd vs-r-r-wte   l  pv  d lpkgflcqathetk mtredptl slll    
                 fi a     rr p  vrd       fp  c ah    ap a deh  gp a  a p he    
                  d          k   c            a        g         d      k aa    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------rlravgkelsrrfrrvfves---l---pgtartrf-qvmeelf-dg--pnwgrivtff-fg
apaaaagpalspvppvvhlvqlqaednfktcrentnsgmgtq-hvtidssvql-t-------s--ig-------a--v--
                   tmket---aepsldigggdlaavigesafarqp-vntmsdkvlqgsv it   l -lva e
                   a  r-  gvqanyftayqaassk dlknendpkslar vvhe e  p v    v siit a
                          d h  h sd l ylr   i   d  g  sl a a  r    t         s  
                                    a              e                         e  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :                 *                                                           
aalckes-------vrvemePlvg------------i-ewm-eyl-trlrdwirtnggwdg-fvptfr---le-------
givtpklptvtawwrnrqip pidtykedvardcqr-s---v---mrnvpevtqssarllfg-aely-vap--emeapaa
 vmiadaklin   lkqara d--qqeg        vqyfvtafienetgt lhqqr  en e--krharfpl    ekl
 t lvre       qeksfs -lkn           lalslasv vatkaa  gkp   gl  tkf-gtpem        
 f aeh        k sc q r  e            valisdr tgqhh   vd    ak  ci-aepkd         
                                             n h      a     e   h   dga         
                                                            a   a    e          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
daimspeeeldgyepeplgkrpavlpllelvgesgnssstdgslpstpppaeeeedelyrcgsvqsleiisrylreqatg
kelqnev kqmnms p gnag vmrsifdkmeadar iyvgnv  dygat   l ahfhg    nrvt lcdkfsghpk 
                      sim  e f                                                  
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
akdtkpmgrsgatsrlaletlrrvgdgvqrnhetafqgwvrkvdikneddvkslsrvmvhvpsrgvtrwgrivtlisfga
fayiefsdkesvrtwks k  lslalvgacitlslyr rqigl                 lfcd prn            
              s   d              g  l mlc                                       
                                      hk                                        
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------r--l-------gvvaglayl-
fvpkrtntpnqstcirgfprsryrartvnyrtsrswfvkqrgwdgfverrlvegnwggw-nv-lafagvcelgt-rk--i
 ia hlkrigiqstdeplceciw   stlvnsk drl          affhr dleasimtlmtvavlla----v--qyw
          hek aa  a act   d                             sfvhkh pqyskivsstslivlrs
                                                             f imtgafnlrsrkggkkm
                                                               eg f agampnhf ffc
                                                                       il a    a

    
....
    
----
rrll
tl  
sk  
g   
a   
    
© 1998-2022Legal notice