Dataset for protein Bcl-2 of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1LNV0_BCL2-02      ------------------------------------------------------------
Q7TSN8_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
F1LNV0_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
P49950_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
                                                                                

F1LNV0_BCL2-02      ------------------------------------------------------------
Q7TSN8_BCL2-01      VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
F1LNV0_BCL2-01      VHRDTAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
P49950_BCL2-01      VHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
                                                                                

F1LNV0_BCL2-02      -----------------------XVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
Q7TSN8_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
F1LNV0_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
P49950_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSVNREMSPLVDNIALWMTEYLNR
                                            ************ ***********************

F1LNV0_BCL2-02      HLHTWIQDNGGW------------------------------VGACLVE-------
Q7TSN8_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
F1LNV0_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
P49950_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
                    ************                              ****:.        

© 1998-2022Legal notice