Dataset for protein Bcl-2 of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P49950_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
Q7TSN8_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
                    *******************************:** *:*** ***************  **

P49950_BCL2-01      VHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
Q7TSN8_BCL2-01      VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
                    **** ************.******************************************

P49950_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSVNREMSPLVDNIALWMTEYLNR
Q7TSN8_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
                    ************************************ ***********************

P49950_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Q7TSN8_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
                    ********************************************************

© 1998-2022Legal notice