Dataset for protein Bcl-2 of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
maqagrtgydnreivmkyihyklsqrgyewdtgdedsaplraaptpgifsfqpesnrtpavhrdtaartsplrplvatag
--------------------------------------------------------------------------------
                               a  a a   g               pm      m            n  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                ************ ***
palspvppvvhltlrragddfsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgriVAFFEFGGVMCVeSVN
---------------------------------------------------------------x            g   
                                                                                

       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
********************************                              ****:.        
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWdafvelygpsmrplfdfswlslktllslalVGACitlgaylghk
                                ------------------------------    lve-------
                                                                            
© 1998-2021Legal notice