Dataset for protein BCL-2-like of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4DTL9_BCL2L1-      ------MSYYNRELVVYFIKYKLSQRNYPYNHIGLMED-------TNRTE
A0A3B4C6H5_MCL1-01      --LFSFVWEFSRKWPWNF-----------------LWEK-----------
A0A3B4C6H5_MCL1-03      MMMSPKEMYFDKKTVFPS-----------------LLAKRPFTLGISSQT
A0A3B4CGU9_MCL1-03      MESAAISLFCNGAGRIPFNKGSESQLDRPDRPDRGLEG-------LQAAP
A0A3B4CGU9_MCL1-02      ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQ
                                                           :              

A0A3B4DTL9_BCL2L1-      GGQAAEENAEGAAVTPTAVVNGSVNG------------------------
A0A3B4C6H5_MCL1-01      ---LIAAVTDGSLPTSPASDCEELDS------------------------
A0A3B4C6H5_MCL1-03      RAPRIAAVTDGSLPTSPASDCEELDS------------------------
A0A3B4CGU9_MCL1-03      GPASKAAMAGGSLPESPESDDFVPDF------------------------
A0A3B4CGU9_MCL1-02      GGSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTISLCDGEVTVLIK
                                  *:   ..       :                         

A0A3B4DTL9_BCL2L1-      -----------TSHGPAGSPTSSPQRRSNGAGGLDAVKEALRDSANEFEL
A0A3B4C6H5_MCL1-01      DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVVDGLVV
A0A3B4C6H5_MCL1-03      DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVVDGLVV
A0A3B4CGU9_MCL1-03      ----GGSALVEETRRLIGGFYRGYIG--QKTRDQHPAHGTMSRVVEGVIL
A0A3B4CGU9_MCL1-02      PKPKGRVRLEEETLCIIGDFYQGY-----RSRNQHPASDTLSRVVEGMLH
                                    :     .   .             .  ::   .: .  

A0A3B4DTL9_BCL2L1-      RYSRAFSDLSSQLHITP-ATAYQSFESVMDEVFRDGV-NWGRVVGLFAFG
A0A3B4C6H5_MCL1-01      KHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFG
A0A3B4C6H5_MCL1-03      KHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFG
A0A3B4CGU9_MCL1-03      KHSIAYNGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIASLVAFG
A0A3B4CGU9_MCL1-02      KHSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFDDGITNWGRIASLVALG
                        .:. .:..:  .* :         : :* . :* **  ****:..*.*:*

A0A3B4DTL9_BCL2L1-      GALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGK
A0A3B4C6H5_MCL1-01      AVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHV
A0A3B4C6H5_MCL1-03      AVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHV
A0A3B4CGU9_MCL1-03      AVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFVEFFRE
A0A3B4CGU9_MCL1-02      AVVCEWLKEVGREQCVENVIQHISMYLSTDQRQWLINNKAWGGFVEFFRE
                        ..:*    :      *  : : :: ** .  . *: :: .*  *.*:*  

A0A3B4DTL9_BCL2L1-      DAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3B4C6H5_MCL1-01      PDPESKMRNA-------LMALVTAAGVGAGLVLLSR--
A0A3B4C6H5_MCL1-03      PDPESKMRNA-------LMALVTAAGVGAGLVLLSR--
A0A3B4CGU9_MCL1-03      DDSESRVRNA-------LMAFAGFAGLGAGLALLMR--
A0A3B4CGU9_MCL1-02      DDSESRVRNA-------LMAFAGFAGLGAGLALLMR--
                          . .  *.        * .:.  :*: .*  :  .  

© 1998-2020Legal notice