Dataset for protein BCL-2-like of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   :                        *:   ..       :     
m-------yfnrkwvipf----------p------leg-------i----gg-siaavtdGslptspasdceevds----
-essskvw-ysggvrwnsnkyslsqrny-yrhissmwekvtltyl-sstt--srsssnat a-veptevvnvvlngisis
 mmfpissfchketqvymiahpggsldr vnpgrlfldprpfilgtqrqqrpqlkeemqg  a a lthgsp f    
  laafmmead alpf  a gke  ica dl dgg ga       lnggp apaa  a e          dfq       
      el     g                                haae  a                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                :     .   .             .  ::   .: .  .:. .:..: 
-----------------------kgsetldretseivgdfyqnytg-srscgrqrpvvqtlrrvveglvvkhslaysgmv
stkeqttislcdgevtvlikdqf-e-----edsrrpiisplsgf--l--rtrnhhgasgaisdsadevllryevvfkdlf
                    pkp -rvr v-t lgla g trspqrr qks glda ke m    n mih   r   s
                         gsa e   hc         i   nga d    hd        f   i      
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .* :         : :* . :* **  ****:..*.*:*..:*    :      *  : : :: ** .  . *: :: .
trLgmeqrgdsmhiissVakelFsDGitNWGRiasLvAfGavvCqhqnemgrgqcVsnviqhissYLstdqrqWllnnka
qq cltdqdtdyeffrt mdtv r  v-    vvg l l gal ewmkqvemehl eligeemtv  lshikd iikqgg
s  hi p-a a qs e       n          f       vqlv k  sp  gr a w  t  dn  qp  q  
                       d                     ec  a              m               
                                                                                

       250       260       270       280        
....:....|....:....|....:....|....:....|....:...
*  *.*:*    . .  *.        * .:.  :*: .*  :  .  
WggFvEfFrvddsesrvRna-------LmalvtfaGvgaGlvllsr--
 dr a i hepapaekm sqenfkkwl agfagat lvv saiamkrl
      gk  a  sr             mtlv       l  q   
                                                
                                                
© 1998-2020Legal notice