Dataset for protein BCL-2-like of organism Periophthalmus magnuspinnatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4AAV4_BCL2L10      MSCGLWKETLALAEDYLSLCCSGP--------------------------
A0A3B4AFB7_MCL1-02      MNIINSPKRTALKLSTMGLFLPQNGLAEGDMHCGAADSSAQMPRPATMDT
A0A3B4AFB7_MCL1-01      -------DTTCLQGVLTPPLGTAH--------------------------
A0A3B3ZMX9_BCL2L1-      ---------MSLNRELVEFYIQYK--------------------------
A0A3B4A3G8_BCL2-01      -------MANDCNRNIVEKYICHK--------------------------
A0A3B3ZMX9_BCL2L1-      ---------MSLNRELVEFYIQYK--------------------------
A0A3B4BFZ8_BCL2L1-      --------MSPSNRELVEFFISYK--------------------------
                                                                          

A0A3B4AAV4_BCL2L10      ------QAAPPPP-------------------------------------
A0A3B4AFB7_MCL1-02      RKGNTASSGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSD
A0A3B4AFB7_MCL1-01      ------ICGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSD
A0A3B3ZMX9_BCL2L1-      ------LSQRDCP----------LQHLGLGDRSTQSDTEHLGLGDRGVDR
A0A3B4A3G8_BCL2-01      ------LSKRGFA--------WGFHEDAEDEGDVANNGSIVASSPVLVNR
A0A3B3ZMX9_BCL2L1-      ------LSQRDCP----------LGLEDGTEIDTERDRDLLGLGDRSVDR
A0A3B4BFZ8_BCL2L1-      ------LSQKNYP--------SSLLMSDPARVQCEGNKAANVPNGMLTNR
                               .    .                                     

A0A3B4AAV4_BCL2L10      -------------------------------------------SGSASAM
A0A3B4AFB7_MCL1-02      SEMELSSYSAEHEVL---ESDTRQLLSDFFKLFTGISQPKWKQRPALSTM
A0A3B4AFB7_MCL1-01      SEMELSSYSAEHEVL---ESDTRQLLSDFFKLFTGISQPKWKQRPALSTM
A0A3B3ZMX9_BCL2L1-      ARLQRETEVDSTELRLDSASDSAPVHS---------PAPLLDLDAVKEAL
A0A3B4A3G8_BCL2-01      ------------------RCRAERLCS---------A-PSDPHAAIHRVL
A0A3B3ZMX9_BCL2L1-      ------------------NSTPSLRLR---------L---DSASDSAPAL
A0A3B4BFZ8_BCL2L1-      ------------------NGNRQTLAS---------LPPDDHLDAIKTAL
                                                                        .:

A0A3B4AAV4_BCL2L10      RRLGQDMEAQHKARFHSLSQTFLKQCGPDPCSSLRKVMEELVGDGHLNWG
A0A3B4AFB7_MCL1-02      KGVVDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWG
A0A3B4AFB7_MCL1-01      KGVVDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWG
A0A3B3ZMX9_BCL2L1-      RDSANEFELRFSRAFSDLHRQLHITPATAYQSF-ESVMDEVFRDG-VNWG
A0A3B4A3G8_BCL2-01      REAGDELERLYQPDFTEMSRQLYLTSSTAQRRF-AEVIDELFRDG-VNWG
A0A3B3ZMX9_BCL2L1-      RDSANEFELRFSRAFSDLHRQLHITPATAYQSF-ESVMDEVFRDG-VNWG
A0A3B4BFZ8_BCL2L1-      TDSADEFEELFTQAFSNLSSQLDITPDTAYNSF-KSVMDEVFKDG-VNWG
                            :.:   .   :  :   :              * ..:. **  ***

A0A3B4AAV4_BCL2L10      RVVSLFTFAGVLARHIKEQKSSRPGLDPGQVQGLGQVPSDCRRLAQTIAD
A0A3B4AFB7_MCL1-02      RIASLIAFGAVVCQYLKTK----------------GRESCVERVGQEISS
A0A3B4AFB7_MCL1-01      RIASLIAFGAVVCQYLKTK----------------GRESCVERVGQEISS
A0A3B3ZMX9_BCL2L1-      RVVGLFAFGGALAVECVDK----------------EMSTLVARIVTWMTV
A0A3B4A3G8_BCL2-01      RIIAFFEFGGTVCVECASKE---------------DMSSQVDNIADWMTE
A0A3B3ZMX9_BCL2L1-      RVVGLFAFGGALAVECVDK----------------EMSTLVARIVTWMTV
A0A3B4BFZ8_BCL2L1-      RIVGLFVFGGVLSVECVEK----------------DMSILVPRIANWMTI
                        *: .:: *...:.     :                       .:   :: 

A0A3B4AAV4_BCL2L10      YLGEEKRDWLLENGGWVGFCEF---SCHARKVDQDSSMKTALFAAAG--V
A0A3B4AFB7_MCL1-02      YLLLDQRDWLVRNNAWDGFVDFFRVEDPESAVRNT-------LMAVAGLA
A0A3B4AFB7_MCL1-01      YLLLDQRDWLVRNNAWDGFVDFFRVEDPESAVRNT-------LMAVAGLA
A0A3B3ZMX9_BCL2L1-      YLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVT
A0A3B4A3G8_BCL2-01      YLNGTLSSWIQDNGGWEAFVELYDRQRDSVFSCSWPSIKTVFGLAAIGAA
A0A3B3ZMX9_BCL2L1-      YLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVT
A0A3B4BFZ8_BCL2L1-      YLDENIATWIQNQGGWASFAQIFGQNAAGEARRSRETLKKWLLVGVGLLA
                        **      *:  :..*  * ::   .       .          .    .

A0A3B4AAV4_BCL2L10      GLAGLTFLLVR--
A0A3B4AFB7_MCL1-02      GIGATLAMLIR--
A0A3B4AFB7_MCL1-01      GIGATLAMLIR--
A0A3B3ZMX9_BCL2L1-      GVVVGSLLAQRRL
A0A3B4A3G8_BCL2-01      SLTIGAYLSQK--
A0A3B3ZMX9_BCL2L1-      GVVVGSLLAQRRL
A0A3B4BFZ8_BCL2L1-      GVLVAMLIAKK--
                        .:     :  .  

© 1998-2020Legal notice