Dataset for protein BCL-2-like of organism Periophthalmus magnuspinnatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .    .                 
---------tslnrelvefyisyk--------------------------------lsqrphp----------llnkntr
msiinwpmtmasqlvytslflqqpglaegdmhcgaadssaqmprpatmdtrkgntascgsdcarptalvmkne----d--
 ncglskkrspckgstmpplgthn                                qakpny         wsfqms-pt
       emnd aenilgkccpgh                                i akgp         sg hllglg
       dalc   d      ca                                      f            gheagd
                                                                           ed ea

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    .:    :.:   
eedyensegslpltprlvsr------------------nsdtrqlls---------s-p-dkqsaslsalrdsadeleer
---t--n----gcgdefhndsemelssysaehevlldse--------dffklftgilq-kw-lrpikttmkgvvnkflll
rvs-qsdtslv-------d-arlqretevdst lr   -gtsstvhr         -p s-s-dgaarv trlgqdm rk
drqvar-reinvssgvst-                   rcrrqrrc          pa llphadvhp   ea     aq
 i c g kdh apn mg                     a npep a          a  d ha    e            
 g     gaa                               aal                 d                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   :  :   :              * ..:. **  ****: .:: *...:.     :                     
hsyafsglsrqlhltprtayvsf-gsVmdevfrDG-vNWGRivslfaFggvlcvecvtk----------------gmssl
frrryndminkfaiddagddqrsiet akslve  tt    vagfiv aaavaqylkeqkssrpgldpgqvqglgeretc
ytqd ts hst ykqssp qr  lrk ii k  hl     ia  t   t srhiad e               dvpiq
 qp  hn  q  l  cg  pn   ke      g             e          s                 q   d
 ka   e     d   d   c   a                                                       
                                                                                

       250       260       270       280       290       300       310   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
  .:   :: **      *:  :..*  * ::   .       .          .    ..:     :  .  
veriaqwmtvYLdehirdWivsnggWagFveiygqeaaasavrste--kkwllaavtllagvvvgslllqr--
canvvteiss  lldqqt lqrqna dr adffrvddpeqsrhne-sf----fmgmggvtslgatlamaikrl
 r lgnt ai  ngtlss  dn    vs cql---srhsvksdqwsrm tvfgv aa--itiltyisv   
 p   d   e  g nka   le    ea     drqcdgrf c rptl  a  l  i a   lgamf  k   
 d       d    e      d             n   e    d  i              a  a       
                                                                         
© 1998-2020Legal notice